1B69A

The solution structure of tn916 integrase n-terminal domain/dna complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
69
structure length
69
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDAISLREKIAELQKDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the Tn916 integrase-DNA complex.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Integrase/dna
molecule keywords DNA (5'-D(*GP*AP*GP*TP*AP*GP*TP*AP*AP*AP*TP*TP*C)-3')
total genus 8
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1b69A00
2GHFA 2EMLA 2EOZA 4FK5C 2EOQA 1BB8A 1RMDA 2YTPA 2EN2A 4IJDA 1A1LA 2EOIA 2EN7A 2EN4A 2WCC3 1TN9A 2YTGA 5KL2A 2ENCA 2EQ0A 4F6NA 2EMZA 2LT7A 2LCEA 2CT1A 4M9VC 2YRMA 3VHTB 5KL3A 2DRPA 1A1IA 2EMBA 2YTQA 4R2SA 2HGHA 2JPAA 2EOEA 2EN3A 2PRTA 2YTJA 2I13A 2EM3A 2EMXA 1WJPA 2M9AA 2EOOA 2EE8A 2EMKA 2EOJA 2DMIA 2E72A 1X5WA 1JK1A 2EPZA 1UBDC 3MHSC 1X6FA 2EMCA 2EM5A 2EMIA 2YTFA 1ZR9A 1X6HA 1NCSA 2EMAA 2EQ1A 2ENAA 2WBSA 2ELYA 2EOFA 1X6EA 2YRKA 4IS1C 4GZNC 2EN1A 2EQ3A 5KL5A 2CTDA 2J7JA 1TF6A 2D9HA 2EPRA 5KL6A 2EJ4A 1X3CA 1ZAAC 1Z1BA 2EMHA 2EL5A 1A1FA 2ENHA 2EN8A 2YU8A 4F6MA 2LO3A 2ADRA 2EORA 2R1FA 2EM0A 2YTEA 2ELZA 2DLKA 4R2DA 4R2CA 2EMGA 1P47A 2MKNA 4R2QA 2EOXA 2EM8A 1F2IG 2NABA 2RPCA 4R2AA 2A25A 2MDGA 1LLMC 2WBTA 2EMFA 3EPHA 1A1JA 3MHHC 1G2DC 3EPJA 2EP3A 2EL6A 1BBOA 2EM9A 2EPXA 2YSPA 2CSHA 1MEYC 2EPUA 2YTIA 1YUIA 2YRHA 2YU5A 1B69A 1KJKA 2YTNA 1YUJA 2EPPA 3UK3C 2EMYA 2EPAA 1AAYA 4F2JC 1UN6B 2VRDA 3EPLA 1A1KA 5KL7A 1A1GA 2EM7A 2YSOA 2DLQA 3M99B 2EMWA 4R2PA 2LVHA 1G2FC 4R2EA 2EOHA 2EOMA 2EM4A 3EPKA 2EM2A 1JK2A 2EPCA 1A1HA 2MKDA 2DGCA 2YTDA 2JP9A 2YTOA 1TF3A 2EOYA 4X9JA 2EM6A 1DGCA 5KL4A 1ZU1A 2LV2A 2EL4A 2RSIA 2EN6A 2WBUA 2GLIA 2BB8A 4R2RA 4WSGA 2EOSA 1YSAC
chains in the Genus database with same CATH superfamily
2GHFA 5DNYA 2EMLA 4HTGA 4JI4E 1BB8A 1FKAE 2YT4A 4LU9A 2EWLA 2CPNA 3F6GA 2EOIA 1XMQE 2YTGA 4F6NA 2LT7A 2UUAE 4DV0E 2JXPA 1J5EE 4ZYDA 4R2SA 2MDRA 2EOEA 2V83A 2I13A 3FIGA 2EM3A 4JI0E 1XNQE 1WJPA 2HC5A 2EPMX 4X8WA 2EE8A 1X5WA 2EPZA 5FLXC 2EM5A 2EMIA 2YTFA 1T39A 1X6HA 2UUBE 2EQ1A 2H36X 2ELYA 1X6EA 3KWRA 3HQ1A 2R76A 4DR6E 4GZNC 2EN1A 2EQ3A 4F9BB 4DMIA 3J7AG 2UXCE 3BF2A 2CTDA 4YY3E 4RH8A 2M1SA 5KL6A 2EJ4A 4B3ME 2EMHA 2KHXA 5AASA 4JI2E 2EORA 3H09A 4X65E 4DV1E 4R2QA 2DB2A 2EM8A 1YZ9A 2B7VA 2NABA 4DUYE 4R2AA 1EH7A 2RQLA 2F8BA 2EMFA 5BR8E 3RMPA 1G2DC 2M7QA 1MGTA 2EL6A 2EM9A 2YSPA 2F4VE 2YRHA 1B69A 3UK3C 2EPAA 2EPLX 3VYXA 2EPNA 1YFHA 3ZOQB 2VRDA 5AE2A 3BGHA 2LBSB 4O24A 5KL7A 1A1KA 2YSOA 5A6AA 3M99B 2EMWA 4DV3E 3HPSA 2EM4A 2LJHA 4BHCA 1JK2A 2MKDA 5LMUE 4JI1E 4LF6E 1STUA 2JP9A 2L2MA 1TF3A 4X9JA 4LF5E 1WRJA 3ECRA 1N33E 1ZBTA 2EN6A 2VF1A 1RQ0A 5IXMB 2JYAA 1HR0E 2RS7A 4WSGA 5A69A 4FK5C 2UXBE 1RMDA 2YTPA 2EN2A 4GKKE 3MSWA 2EMZA 3J80C 4LFAE 5LLQA 1FJGE 5KL3A 2DRPA 4LFBE 2B9DA 4F9CB 4NZVA 1WHNA 3HXLA 2PRTA 1QU6A 2EMXA 4MLVA 3TQMA 4KHPE 1JK1A 1UBDC 1T4LB 1ZR9A 4DR2E 2YRKA 4F9AB 4DV5E 4P7DA 5KL5A 3HTXA 3VK6A 4ZYGA 2L3CA 2DMYA 1EH6A 4ZYEA 3ADLA 4BC9A 2JY9A 1TF6A 1X3CA 4KWYA 4BS9A 3BBGA 4OX9E 4X62E 2EL5A 4DR1E 2YU8A 4KZSA 2YTEA 2R1FA 2EM0A 2DLKA 3LMLA 2UXDE 4HEIA 3THNA 2EOXA 1QNTA 4JV5E 1GQEA 3ADIA 2NA2A 1IBLE 4DR5E 3EPJA 4RHBB 4DV6E 2EPUA 2YTIA 1YUIA 3C4BA 2DIXA 1YUJA 1NEIA 4JI8E 4ZYHA 5IWAE 1UN6B 2RTXA 4WSPA 4BBYA 3EPLA 4DUZE 3THOB 1A1GA 1UHZA 3VYYA 2ODRC 4OOGC 2LVHA 1G2FC 4X64E 2EOHA 2EOMA 3EPKA 2K7IA 2DGCA 2L33A 4DKKA 2YTDA 2L2NA 4GKJE 1IBKE 4L5NC 3J7Yp 2EOYA 5A6KA 3C4TA 2JVAA 5KL4A 1ZU1A 2LMZA 2EZ6A 1N34E 2NUEA 4R8OA 2WBUA 2GLIA 3JTZA 3DJWA 1RC7A 3C6KA 4M30A 1SFEA 2GPIA 3AV0A 4B3RE 2JWOA 4M0VA 2YWQA 4IJDA 2V87A 1TN9A 2WZOA 2EQ0A 2LCEA 3ADGA 5CFFE 2YRMA 2V85A 3L00A 2EMBA 4P78A 2HGHA 2LUPB 2EN3A 2RS6A 1YYKA 2VQEE 2IHR1 2V86A 2KONA 2EOOA 4BMJA 2EMKA 2DMIA 2E72A 4NXNE 4LF8E 2EMCA 4MLQA 4DR3E 2ENAA 3OMLA 2L6MA 1I94E 2EOFA 1GZ6A 1J26A 4B3SE 3KZZA 4TUGA 4BHBA 1IMUA 2HHHE 2J7JA 5T6JA 3OTOE 2D9HA 1Z1BA 1AH5A 1A1FA 4JI3E 2KOUA 4LTYA 4F6MA 2ADRA 2ELZA 5IT9C 1N36E 4R2DA 1P47A 2NUGA 3JAMC 4AQYE 1T4NA 1F2IG 1KYQA 2HJJA 2EPKX 4M2ZA 2A25A 2WBTA 3P1XA 4J8ZA 2B7TA 5AC5A 1A1JA 1PJSA 1X48A 2MC5A 2LJUA 4I8OA 4L8NA 2EP3A 4NHRA 2JOBA 1BBOA 2G7HA 2LE2A 1PJQA 2EPXA 4YHHE 1MEYC 2ODRD 1GTKA 5AE1A 1PKPA 2YTNA 2JR1A 4DV4E 2M4IA 2EMYA 4BC7A 1XMOE 1AAYA 4F2JC 2I9IA 1YYOA 1L4SA 2DLQA 4DV2E 4R2PA 4DV7E 1HNXE 2L92A 3IWDA 1N32E 1T38A 2EPCA 4WXCA 1A1HA 4JI6E 5AC4A 4DR4E 4WPYA 2YTOA 4WFTA 1DGCA 2YPNA 2LV2A 4LF4E 1YYWA 5A6BA 1PJTA 2FV4B 1WXRA 1YPNA 2NUFA 2LTRA 2BB8A 2V89A 3IWBA 4R2RA 4LF9E 2WBSA 2DSYA 1YSAC 2EOZA 4N4RB 2L3JA 4LF7E 2EOQA 1HNZE 5A6JA 4JI7E 5TSEA 1WHQA 1A1LA 1PDAA 2EN7A 2EN4A 2WCC3 5KL2A 2K4VA 2ENCA 1BBGA 2CT1A 2Q8UA 5ADZA 3VHTB 4M9VC 1A1IA 2YTQA 2V88A 2JPAA 1X49A 2JOXA 2N3HA 2YTJA 3C6MA 2B3TB 5AE3A 1IQSA 2RSMA 2EPOA 2M9AA 4DR7E 2FTXB 2EOJA 2UU9E 2LTSA 5IV8B 3LLHA 1X47A 3MHSC 1X6FA 2LUQA 1NCSA 2EMAA 3DF6A 3IWCA 1T4OA 1UILA 1DQ3A 3AUZA 4JYAE 4WYQB 4IS1C 3J81C 4Q35B 3T1YE 4K0KE 2BBGA 4Q28A 2EPRA 2E1MA 1ZAAC 1EH8A 2N8XA 3KZYA 5LL6R 2ENHA 2EN8A 2UUCE 1XNRE 1DI2A 2LO3A 4F54A 4R2CA 2EMGA 2MKNA 1IBME 3K6QA 2RPCA 3JU0A 1EKZA 2MDGA 1LLMC 2ZM6E 3EPHA 3ADJA 3MHHC 4GEQB 2VE7C 4BCAA 2E5LE 2V8QB 2FGGA 2CSHA 1N3GA 1O0WA 2YU5A 1KJKA 1SR9A 4R03A 2EPPA 4WXDA 1ZBQA 5A2QC 2EM7A 4X66E 4O43A 4TUIA 2L8TA 3EQ1A 4R2EA 4JI5E 2MC6A 5F3WA 2EM2A 3BIDA 4NXME 4B3TE 4O4KA 1IQOA 2YZTA 2L2KB 4LFCE 2LRSA 5A6BD 3HPZA 4O5GA 1HNWE 2EM6A 3T1HE 5LMNE 2VQFE 2EL4A 2RSIA 4WX9A 3F6HA 3QG5C 2EOSA 2N3GA
chains in the Genus database with same CATH topology
2GHFA 2EMLA 2EOZA 4FK5C 2EOQA 1BB8A 1RMDA 2YTPA 2EN2A 4IJDA 1A1LA 2EOIA 2EN7A 2EN4A 2WCC3 1TN9A 2YTGA 5KL2A 2ENCA 2EQ0A 4F6NA 2EMZA 2LT7A 2LCEA 2CT1A 4M9VC 2YRMA 3VHTB 5KL3A 2DRPA 1A1IA 2EMBA 2YTQA 4R2SA 2HGHA 2JPAA 2EOEA 2EN3A 2PRTA 2YTJA 2I13A 2EM3A 2EMXA 1WJPA 2M9AA 2EOOA 2EE8A 2EMKA 2EOJA 2DMIA 2E72A 1X5WA 1JK1A 2EPZA 1UBDC 3MHSC 1X6FA 2EMCA 2EM5A 2EMIA 2YTFA 1ZR9A 1X6HA 1NCSA 2EMAA 2EQ1A 2ENAA 2WBSA 2ELYA 2EOFA 1X6EA 2YRKA 4IS1C 4GZNC 2EN1A 2EQ3A 5KL5A 2CTDA 2J7JA 1TF6A 2D9HA 2EPRA 5KL6A 2EJ4A 1X3CA 1ZAAC 1Z1BA 2EMHA 2EL5A 1A1FA 2ENHA 2EN8A 2YU8A 4F6MA 2LO3A 2ADRA 2EORA 2R1FA 2EM0A 2YTEA 2ELZA 2DLKA 4R2DA 4R2CA 2EMGA 1P47A 2MKNA 4R2QA 2EOXA 2EM8A 1F2IG 2NABA 2RPCA 4R2AA 2A25A 2MDGA 1LLMC 2WBTA 2EMFA 3EPHA 1A1JA 3MHHC 1G2DC 3EPJA 2EP3A 2EL6A 1BBOA 2EM9A 2EPXA 2YSPA 2CSHA 1MEYC 2EPUA 2YTIA 1YUIA 2YRHA 2YU5A 1B69A 1KJKA 2YTNA 1YUJA 2EPPA 3UK3C 2EMYA 2EPAA 1AAYA 4F2JC 1UN6B 2VRDA 3EPLA 1A1KA 5KL7A 1A1GA 2EM7A 2YSOA 2DLQA 3M99B 2EMWA 4R2PA 2LVHA 1G2FC 4R2EA 2EOHA 2EOMA 2EM4A 3EPKA 2EM2A 1JK2A 2EPCA 1A1HA 2MKDA 2DGCA 2YTDA 2JP9A 2YTOA 1TF3A 2EOYA 4X9JA 2EM6A 1DGCA 5KL4A 1ZU1A 2LV2A 2EL4A 2RSIA 2EN6A 2WBUA 2GLIA 2BB8A 4R2RA 4WSGA 2EOSA 1YSAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GHF A;  2EML A;  2EOZ A;  4FK5 C;  2EOQ A;  1BB8 A;  1RMD A;  2YTP A;  2EN2 A;  4IJD A;  1A1L A;  2EOI A;  2EN7 A;  2EN4 A;  2WCC 3;  1TN9 A;  2YTG A;  5KL2 A;  2ENC A;  2EQ0 A;  4F6N A;  2EMZ A;  2LT7 A;  2LCE A;  2CT1 A;  4M9V C;  2YRM A;  3VHT B;  5KL3 A;  2DRP A;  1A1I A;  2EMB A;  2YTQ A;  4R2S A;  2HGH A;  2JPA A;  2EOE A;  2EN3 A;  2PRT A;  2YTJ A;  2I13 A;  2EM3 A;  2EMX A;  1WJP A;  2M9A A;  2EOO A;  2EE8 A;  2EMK A;  2EOJ A;  2DMI A;  2E72 A;  1X5W A;  1JK1 A;  2EPZ A;  1UBD C;  3MHS C;  1X6F A;  2EMC A;  2EM5 A;  2EMI A;  2YTF A;  1ZR9 A;  1X6H A;  1NCS A;  2EMA A;  2EQ1 A;  2ENA A;  2WBS A;  2ELY A;  2EOF A;  1X6E A;  2YRK A;  4IS1 C;  4GZN C;  2EN1 A;  2EQ3 A;  5KL5 A;  2CTD A;  2J7J A;  1TF6 A;  2D9H A;  2EPR A;  5KL6 A;  2EJ4 A;  1X3C A;  1ZAA C;  1Z1B A;  2EMH A;  2EL5 A;  1A1F A;  2ENH A;  2EN8 A;  2YU8 A;  4F6M A;  2LO3 A;  2ADR A;  2EOR A;  2R1F A;  2EM0 A;  2YTE A;  2ELZ A;  2DLK A;  4R2D A;  4R2C A;  2EMG A;  1P47 A;  2MKN A;  4R2Q A;  2EOX A;  2EM8 A;  1F2I G;  2NAB A;  2RPC A;  4R2A A;  2A25 A;  2MDG A;  1LLM C;  2WBT A;  2EMF A;  3EPH A;  1A1J A;  3MHH C;  1G2D C;  3EPJ A;  2EP3 A;  2EL6 A;  1BBO A;  2EM9 A;  2EPX A;  2YSP A;  2CSH A;  1MEY C;  2EPU A;  2YTI A;  1YUI A;  2YRH A;  2YU5 A;  1B69 A;  1KJK A;  2YTN A;  1YUJ A;  2EPP A;  3UK3 C;  2EMY A;  2EPA A;  1AAY A;  4F2J C;  1UN6 B;  2VRD A;  3EPL A;  1A1K A;  5KL7 A;  1A1G A;  2EM7 A;  2YSO A;  2DLQ A;  3M99 B;  2EMW A;  4R2P A;  2LVH A;  1G2F C;  4R2E A;  2EOH A;  2EOM A;  2EM4 A;  3EPK A;  2EM2 A;  1JK2 A;  2EPC A;  1A1H A;  2MKD A;  2DGC A;  2YTD A;  2JP9 A;  2YTO A;  1TF3 A;  2EOY A;  4X9J A;  2EM6 A;  1DGC A;  5KL4 A;  1ZU1 A;  2LV2 A;  2EL4 A;  2RSI A;  2EN6 A;  2WBU A;  2GLI A;  2BB8 A;  4R2R A;  4WSG A;  2EOS A;  1YSA C; 
#chains in the Genus database with same CATH topology
 2GHF A;  5DNY A;  2EML A;  4HTG A;  4JI4 E;  1BB8 A;  1FKA E;  2YT4 A;  4LU9 A;  2EWL A;  2CPN A;  3F6G A;  2EOI A;  1XMQ E;  2YTG A;  4F6N A;  2LT7 A;  2UUA E;  4DV0 E;  2JXP A;  1J5E E;  4ZYD A;  4R2S A;  2MDR A;  2EOE A;  2V83 A;  2I13 A;  3FIG A;  2EM3 A;  4JI0 E;  1XNQ E;  1WJP A;  2HC5 A;  2EPM X;  4X8W A;  2EE8 A;  1X5W A;  2EPZ A;  5FLX C;  2EM5 A;  2EMI A;  2YTF A;  1T39 A;  1X6H A;  2UUB E;  2EQ1 A;  2H36 X;  2ELY A;  1X6E A;  3KWR A;  3HQ1 A;  2R76 A;  4DR6 E;  4GZN C;  2EN1 A;  2EQ3 A;  4F9B B;  4DMI A;  3J7A G;  2UXC E;  3BF2 A;  2CTD A;  4YY3 E;  4RH8 A;  2M1S A;  5KL6 A;  2EJ4 A;  4B3M E;  2EMH A;  2KHX A;  5AAS A;  4JI2 E;  2EOR A;  3H09 A;  4X65 E;  4DV1 E;  4R2Q A;  2DB2 A;  2EM8 A;  1YZ9 A;  2B7V A;  2NAB A;  4DUY E;  4R2A A;  1EH7 A;  2RQL A;  2F8B A;  2EMF A;  5BR8 E;  3RMP A;  1G2D C;  2M7Q A;  1MGT A;  2EL6 A;  2EM9 A;  2YSP A;  2F4V E;  2YRH A;  1B69 A;  3UK3 C;  2EPA A;  2EPL X;  3VYX A;  2EPN A;  1YFH A;  3ZOQ B;  2VRD A;  5AE2 A;  3BGH A;  2LBS B;  4O24 A;  5KL7 A;  1A1K A;  2YSO A;  5A6A A;  3M99 B;  2EMW A;  4DV3 E;  3HPS A;  2EM4 A;  2LJH A;  4BHC A;  1JK2 A;  2MKD A;  5LMU E;  4JI1 E;  4LF6 E;  1STU A;  2JP9 A;  2L2M A;  1TF3 A;  4X9J A;  4LF5 E;  1WRJ A;  3ECR A;  1N33 E;  1ZBT A;  2EN6 A;  2VF1 A;  1RQ0 A;  5IXM B;  2JYA A;  1HR0 E;  2RS7 A;  4WSG A;  5A69 A;  4FK5 C;  2UXB E;  1RMD A;  2YTP A;  2EN2 A;  4GKK E;  3MSW A;  2EMZ A;  3J80 C;  4LFA E;  5LLQ A;  1FJG E;  5KL3 A;  2DRP A;  4LFB E;  2B9D A;  4F9C B;  4NZV A;  1WHN A;  3HXL A;  2PRT A;  1QU6 A;  2EMX A;  4MLV A;  3TQM A;  4KHP E;  1JK1 A;  1UBD C;  1T4L B;  1ZR9 A;  4DR2 E;  2YRK A;  4F9A B;  4DV5 E;  4P7D A;  5KL5 A;  3HTX A;  3VK6 A;  4ZYG A;  2L3C A;  2DMY A;  1EH6 A;  4ZYE A;  3ADL A;  4BC9 A;  2JY9 A;  1TF6 A;  1X3C A;  4KWY A;  4BS9 A;  3BBG A;  4OX9 E;  4X62 E;  2EL5 A;  4DR1 E;  2YU8 A;  4KZS A;  2YTE A;  2R1F A;  2EM0 A;  2DLK A;  3LML A;  2UXD E;  4HEI A;  3THN A;  2EOX A;  1QNT A;  4JV5 E;  1GQE A;  3ADI A;  2NA2 A;  1IBL E;  4DR5 E;  3EPJ A;  4RHB B;  4DV6 E;  2EPU A;  2YTI A;  1YUI A;  3C4B A;  2DIX A;  1YUJ A;  1NEI A;  4JI8 E;  4ZYH A;  5IWA E;  1UN6 B;  2RTX A;  4WSP A;  4BBY A;  3EPL A;  4DUZ E;  3THO B;  1A1G A;  1UHZ A;  3VYY A;  2ODR C;  4OOG C;  2LVH A;  1G2F C;  4X64 E;  2EOH A;  2EOM A;  3EPK A;  2K7I A;  2DGC A;  2L33 A;  4DKK A;  2YTD A;  2L2N A;  4GKJ E;  1IBK E;  4L5N C;  3J7Y p;  2EOY A;  5A6K A;  3C4T A;  2JVA A;  5KL4 A;  1ZU1 A;  2LMZ A;  2EZ6 A;  1N34 E;  2NUE A;  4R8O A;  2WBU A;  2GLI A;  3JTZ A;  3DJW A;  1RC7 A;  3C6K A;  4M30 A;  1SFE A;  2GPI A;  3AV0 A;  4B3R E;  2JWO A;  4M0V A;  2YWQ A;  4IJD A;  2V87 A;  1TN9 A;  2WZO A;  2EQ0 A;  2LCE A;  3ADG A;  5CFF E;  2YRM A;  2V85 A;  3L00 A;  2EMB A;  4P78 A;  2HGH A;  2LUP B;  2EN3 A;  2RS6 A;  1YYK A;  2VQE E;  2IHR 1;  2V86 A;  2KON A;  2EOO A;  4BMJ A;  2EMK A;  2DMI A;  2E72 A;  4NXN E;  4LF8 E;  2EMC A;  4MLQ A;  4DR3 E;  2ENA A;  3OML A;  2L6M A;  1I94 E;  2EOF A;  1GZ6 A;  1J26 A;  4B3S E;  3KZZ A;  4TUG A;  4BHB A;  1IMU A;  2HHH E;  2J7J A;  5T6J A;  3OTO E;  2D9H A;  1Z1B A;  1AH5 A;  1A1F A;  4JI3 E;  2KOU A;  4LTY A;  4F6M A;  2ADR A;  2ELZ A;  5IT9 C;  1N36 E;  4R2D A;  1P47 A;  2NUG A;  3JAM C;  4AQY E;  1T4N A;  1F2I G;  1KYQ A;  2HJJ A;  2EPK X;  4M2Z A;  2A25 A;  2WBT A;  3P1X A;  4J8Z A;  2B7T A;  5AC5 A;  1A1J A;  1PJS A;  1X48 A;  2MC5 A;  2LJU A;  4I8O A;  4L8N A;  2EP3 A;  4NHR A;  2JOB A;  1BBO A;  2G7H A;  2LE2 A;  1PJQ A;  2EPX A;  4YHH E;  1MEY C;  2ODR D;  1GTK A;  5AE1 A;  1PKP A;  2YTN A;  2JR1 A;  4DV4 E;  2M4I A;  2EMY A;  4BC7 A;  1XMO E;  1AAY A;  4F2J C;  2I9I A;  1YYO A;  1L4S A;  2DLQ A;  4DV2 E;  4R2P A;  4DV7 E;  1HNX E;  2L92 A;  3IWD A;  1N32 E;  1T38 A;  2EPC A;  4WXC A;  1A1H A;  4JI6 E;  5AC4 A;  4DR4 E;  4WPY A;  2YTO A;  4WFT A;  1DGC A;  2YPN A;  2LV2 A;  4LF4 E;  1YYW A;  5A6B A;  1PJT A;  2FV4 B;  1WXR A;  1YPN A;  2NUF A;  2LTR A;  2BB8 A;  2V89 A;  3IWB A;  4R2R A;  4LF9 E;  2WBS A;  2DSY A;  1YSA C;  2EOZ A;  4N4R B;  2L3J A;  4LF7 E;  2EOQ A;  1HNZ E;  5A6J A;  4JI7 E;  5TSE A;  1WHQ A;  1A1L A;  1PDA A;  2EN7 A;  2EN4 A;  2WCC 3;  5KL2 A;  2K4V A;  2ENC A;  1BBG A;  2CT1 A;  2Q8U A;  5ADZ A;  3VHT B;  4M9V C;  1A1I A;  2YTQ A;  2V88 A;  2JPA A;  1X49 A;  2JOX A;  2N3H A;  2YTJ A;  3C6M A;  2B3T B;  5AE3 A;  1IQS A;  2RSM A;  2EPO A;  2M9A A;  4DR7 E;  2FTX B;  2EOJ A;  2UU9 E;  2LTS A;  5IV8 B;  3LLH A;  1X47 A;  3MHS C;  1X6F A;  2LUQ A;  1NCS A;  2EMA A;  3DF6 A;  3IWC A;  1T4O A;  1UIL A;  1DQ3 A;  3AUZ A;  4JYA E;  4WYQ B;  4IS1 C;  3J81 C;  4Q35 B;  3T1Y E;  4K0K E;  2BBG A;  4Q28 A;  2EPR A;  2E1M A;  1ZAA C;  1EH8 A;  2N8X A;  3KZY A;  5LL6 R;  2ENH A;  2EN8 A;  2UUC E;  1XNR E;  1DI2 A;  2LO3 A;  4F54 A;  4R2C A;  2EMG A;  2MKN A;  1IBM E;  3K6Q A;  2RPC A;  3JU0 A;  1EKZ A;  2MDG A;  1LLM C;  2ZM6 E;  3EPH A;  3ADJ A;  3MHH C;  4GEQ B;  2VE7 C;  4BCA A;  2E5L E;  2V8Q B;  2FGG A;  2CSH A;  1N3G A;  1O0W A;  2YU5 A;  1KJK A;  1SR9 A;  4R03 A;  2EPP A;  4WXD A;  1ZBQ A;  5A2Q C;  2EM7 A;  4X66 E;  4O43 A;  4TUI A;  2L8T A;  3EQ1 A;  4R2E A;  4JI5 E;  2MC6 A;  5F3W A;  2EM2 A;  3BID A;  4NXM E;  4B3T E;  4O4K A;  1IQO A;  2YZT A;  2L2K B;  4LFC E;  2LRS A;  5A6B D;  3HPZ A;  4O5G A;  1HNW E;  2EM6 A;  3T1H E;  5LMN E;  2VQF E;  2EL4 A;  2RSI A;  4WX9 A;  3F6H A;  3QG5 C;  2EOS A;  2N3G A; 
#chains in the Genus database with same CATH homology
 2GHF A;  2EML A;  2EOZ A;  4FK5 C;  2EOQ A;  1BB8 A;  1RMD A;  2YTP A;  2EN2 A;  4IJD A;  1A1L A;  2EOI A;  2EN7 A;  2EN4 A;  2WCC 3;  1TN9 A;  2YTG A;  5KL2 A;  2ENC A;  2EQ0 A;  4F6N A;  2EMZ A;  2LT7 A;  2LCE A;  2CT1 A;  4M9V C;  2YRM A;  3VHT B;  5KL3 A;  2DRP A;  1A1I A;  2EMB A;  2YTQ A;  4R2S A;  2HGH A;  2JPA A;  2EOE A;  2EN3 A;  2PRT A;  2YTJ A;  2I13 A;  2EM3 A;  2EMX A;  1WJP A;  2M9A A;  2EOO A;  2EE8 A;  2EMK A;  2EOJ A;  2DMI A;  2E72 A;  1X5W A;  1JK1 A;  2EPZ A;  1UBD C;  3MHS C;  1X6F A;  2EMC A;  2EM5 A;  2EMI A;  2YTF A;  1ZR9 A;  1X6H A;  1NCS A;  2EMA A;  2EQ1 A;  2ENA A;  2WBS A;  2ELY A;  2EOF A;  1X6E A;  2YRK A;  4IS1 C;  4GZN C;  2EN1 A;  2EQ3 A;  5KL5 A;  2CTD A;  2J7J A;  1TF6 A;  2D9H A;  2EPR A;  5KL6 A;  2EJ4 A;  1X3C A;  1ZAA C;  1Z1B A;  2EMH A;  2EL5 A;  1A1F A;  2ENH A;  2EN8 A;  2YU8 A;  4F6M A;  2LO3 A;  2ADR A;  2EOR A;  2R1F A;  2EM0 A;  2YTE A;  2ELZ A;  2DLK A;  4R2D A;  4R2C A;  2EMG A;  1P47 A;  2MKN A;  4R2Q A;  2EOX A;  2EM8 A;  1F2I G;  2NAB A;  2RPC A;  4R2A A;  2A25 A;  2MDG A;  1LLM C;  2WBT A;  2EMF A;  3EPH A;  1A1J A;  3MHH C;  1G2D C;  3EPJ A;  2EP3 A;  2EL6 A;  1BBO A;  2EM9 A;  2EPX A;  2YSP A;  2CSH A;  1MEY C;  2EPU A;  2YTI A;  1YUI A;  2YRH A;  2YU5 A;  1B69 A;  1KJK A;  2YTN A;  1YUJ A;  2EPP A;  3UK3 C;  2EMY A;  2EPA A;  1AAY A;  4F2J C;  1UN6 B;  2VRD A;  3EPL A;  1A1K A;  5KL7 A;  1A1G A;  2EM7 A;  2YSO A;  2DLQ A;  3M99 B;  2EMW A;  4R2P A;  2LVH A;  1G2F C;  4R2E A;  2EOH A;  2EOM A;  2EM4 A;  3EPK A;  2EM2 A;  1JK2 A;  2EPC A;  1A1H A;  2MKD A;  2DGC A;  2YTD A;  2JP9 A;  2YTO A;  1TF3 A;  2EOY A;  4X9J A;  2EM6 A;  1DGC A;  5KL4 A;  1ZU1 A;  2LV2 A;  2EL4 A;  2RSI A;  2EN6 A;  2WBU A;  2GLI A;  2BB8 A;  4R2R A;  4WSG A;  2EOS A;  1YSA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...