1B69A

The solution structure of tn916 integrase n-terminal domain/dna complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
69
structure length
69
Chain Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDAISLREKIAELQKDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*AP*GP*TP*AP*GP*TP*AP*AP*AP*TP*TP*C)-3')
publication title NMR structure of the Tn916 integrase-DNA complex.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Integrase/dna
total genus 8
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 1b69A00
2EPUA 3EPHA 2EN3A 4IJDA 1A1HA 2ENAA 2EQ3A 2EMCA 2EORA 2EMWA 1NCSA 2LO3A 1JK2A 5KL5A 2EM6A 1BB8A 2YTNA 2EMLA 2EM7A 2EOZA 2HGHA 4R2PA 2JPAA 1X5WA 3MHHC 2EN4A 5KL3A 2EOOA 1YSAC 2DRPA 1ZR9A 4F6MA 2DGCA 2ADRA 2EPRA 1UN6B 2EMFA 2ENHA 1TF3A 2VRDA 1X3CA 5KL2A 2MDGA 2LVHA 2MKNA 2WBSA 2EE8A 2YTQA 2EMGA 2YRKA 2EMYA 2EMIA 2EMHA 1AAYA 1ZU1A 2EN1A 1WJPA 2ELYA 1KJKA 4R2QA 1P47A 1Z1BA 4F6NA 1JK1A 1YUIA 2EOHA 2EQ1A 2EM4A 2EN2A 2I13A 2DMIA 2JP9A 4R2SA 3MHSC 2EOFA 4R2EA 5KL6A 2LT7A 1A1IA 2EL5A 2EPPA 2EM3A 2YTFA 4R2CA 2EL4A 2YTDA 4X9JA 1MEYC 2J7JA 2EMXA 2YSOA 1G2FC 2GLIA 2EM2A 2YTJA 2WBTA 3UK3C 2YU8A 1A1KA 2EM0A 1UBDC 2EM9A 2EMAA 1X6FA 2CT1A 1LLMC 2LV2A 2M9AA 4R2RA 2EOJA 1DGCA 1YUJA 2EN7A 2ENCA 2YRHA 2EJ4A 2WCC3 2EPCA 4GZNC 4M9VC 2YTPA 2D9HA 2EM5A 2EMZA 2EOSA 2DLQA 4WSGA 2GHFA 2EQ0A 2RPCA 2EPAA 1X6EA 2EL6A 1BBOA 2PRTA 3M99B 4F2JC 2EOIA 2EN6A 2YTEA 1TF6A 2EPXA 2EOYA 2YU5A 2YSPA 1A1JA 2DLKA 2EPZA 1X6HA 2ELZA 4R2AA 2EOMA 3VHTB 2YTOA 2EMBA 2EOXA 3EPJA 2EN8A 4R2DA 1A1GA 2CSHA 3EPLA 2EOEA 1ZAAC 4IS1C 2WBUA 2BB8A 2MKDA 2CTDA 4FK5C 1A1LA 1RMDA 2EP3A 2YTGA 2YRMA 2LCEA 2A25A 1A1FA 2NABA 2YTIA 5KL7A 2R1FA 3EPKA 2RSIA 1F2IG 1TN9A 2E72A 2EM8A 2EOQA 1G2DC 1B69A 2EMKA 5KL4A
chains in the Genus database with same CATH superfamily
2UUCE 3BF2A 3JU0A 5A6KA 2E5LE 2EQ3A 2ZM6E 2NUGA 2EMCA 1JK2A 2EM6A 1BB8A 3HPSA 2YTNA 3ADJA 1HNWE 4WXDA 2UXDE 1GTKA 4HTGA 3MHHC 5LMNE 1SFEA 2EN4A 2H36X 4DR1E 4F6MA 2DGCA 1N33E 4LFAE 2VRDA 2YWQA 1FKAE 1T38A 2EE8A 4X64E 2EMGA 3BGHA 4BBYA 4MLQA 4K0KE 5DNYA 2RS7A 1QU6A 2ELYA 1Z1BA 4F6NA 2RQLA 2V85A 2EM4A 5A6BA 1XNRE 1PDAA 1IQSA 2JR1A 4OOGC 2LT7A 2L33A 4RHBB 2DMYA 4R2CA 2EL4A 3EQ1A 3BBGA 4M30A 3KWRA 2YU8A 3UK3C 2EM0A 1AH5A 4JI0E 4JI3E 2LV2A 5F3WA 2EN7A 2ENCA 4LTYA 1UHZA 2K7IA 2EJ4A 1IBLE 2YTPA 3DF6A 2UXBE 2F8BA 3C6MA 5IV8B 3ADLA 3HXLA 2NUEA 1X6EA 4P78A 4NHRA 4F2JC 2FTXB 1T4OA 3MSWA 2K4VA 4TUGA 4GKJE 2LTRA 3IWDA 4O43A 4O4KA 4LF9E 2EOYA 4ZYGA 2LUQA 2E1MA 3KZYA 3C6KA 4DR7E 4R2AA 2LBSB 2EMBA 4X65E 4IS1C 2MKDA 2YT4A 4FK5C 4ZYDA 2L8TA 1HNXE 1T39A 2LCEA 2A25A 2MC5A 2NABA 2YTIA 1BBGA 5FLXC 3HQ1A 4F9BB 4JI4E 1XNQE 5CFFE 4L8NA 1EKZA 2EPUA 4P7DA 1A1HA 3AUZA 1EH6A 2DSYA 2EMWA 5KL5A 4X66E 2F4VE 2EPKX 4BHCA 3DJWA 1X49A 2EOZA 2JPAA 1X5WA 2VF1A 2EPMX 3ADIA 2B7VA 2EPRA 1UN6B 1QNTA 2L3CA 2WBSA 1N32E 2L6MA 2YRKA 1DQ3A 1I94E 2CPNA 2NUFA 2EMIA 4DKKA 5A2QC 4JYAE 4YY3E 1AAYA 5ADZA 2V86A 1JK1A 2M7QA 2EQ1A 2DMIA 4B3SE 1YYKA 4LF7E 2FV4B 3L00A 2N8XA 4DR4E 4R2EA 2RTXA 4X8WA 2JVAA 1A1IA 2EL5A 2EPPA 5IWAE 2EM3A 2V87A 4F9CB 3VYYA 1HR0E 1MEYC 2EMXA 1G2FC 2GLIA 4LFBE 4HEIA 3HTXA 1YUJA 2EOJA 4OX9E 3OTOE 1EH7A 3ECRA 2WCC3 4DUYE 2EMZA 2UUAE 2RSMA 1XMOE 2LJUA 4AQYE 4BCAA 3VK6A 2EPAA 3IWCA 3THNA 4JI1E 4LFCE 4O24A 1UILA 2WZOA 1PJSA 2ODRC 4DV2E 4DV5E 3T1YE 2YTOA 4ZYHA 4R2DA 3LMLA 1A1GA 1J26A 5A6JA 3QG5C 4GKKE 2BB8A 2CTDA 2LTSA 1IBME 1EH8A 3IWBA 4WFTA 5A6AA 2EP3A 1A1LA 3C4TA 4NXNE 1PKPA 2LE2A 1F2IG 1GZ6A 5LLQA 1TN9A 2EOQA 4DR2E 2JWOA 2L3JA 1B69A 4Q35B 3JTZA 3VYXA 3EPHA 4IJDA 4DR6E 4WX9A 2ENAA 2RS6A 2EZ6A 1N3GA 2EORA 1ZBQA 3FIGA 2EMLA 2HGHA 3ADGA 4R2PA 5KL3A 2EOOA 1YSAC 2V8QB 2HHHE 2DRPA 2ADRA 2MDRA 5AE2A 2ENHA 1TF3A 5AE3A 1X3CA 5KL2A 2MDGA 2LVHA 2MKNA 2EPOA 4BS9A 3J7Yp 2EWLA 4KZSA 4L5NC 4YHHE 2IHR1 2JY9A 2EN1A 1KJKA 4R2QA 1YUIA 4ZYEA 3TQMA 2JP9A 3ZOQB 4R2SA 3MHSC 2EOFA 2EPLX 2M4IA 2N3GA 5KL6A 1PJTA 3HPZA 4JV5E 2M1SA 2YTFA 2HJJA 5AE1A 4R8OA 1WHQA 4X9JA 2J7JA 4F54A 2LUPB 2EM2A 2LJHA 3J80C 2LMZA 2WBTA 4JI8E 5AC4A 1A1KA 1GQEA 2EM9A 2CT1A 2M9AA 4R2RA 4M2ZA 4WSPA 2EPCA 4N4RB 1X47A 5A6BD 4GZNC 2UUBE 4LF4E 5IXMB 4M9VC 2D9HA 2EM5A 4WYQB 4I8OA 2EOSA 2DLQA 4WSGA 1SR9A 2GHFA 5LMUE 1J5EE 2EQ0A 4O5GA 4BC9A 1XMQE 1MGTA 2L92A 2B3TB 2VQFE 1BBOA 2PRTA 3LLHA 4DV0E 4DR5E 4B3RE 1YPNA 1TF6A 2DIXA 2EPXA 4DR3E 1WRJA 2KONA 1L4SA 4LF8E 2YSPA 4R03A 4DV4E 2G7HA 5IT9C 2VE7C 2EOMA 4LU9A 3EPJA 1IBKE 4DV3E 2CSHA 2R76A 1YYOA 1T4NA 1YZ9A 2MC6A 1KYQA 1RMDA 1DI2A 1A1FA 4X62E 2R1FA 2GPIA 1X48A 4B3TE 3K6QA 1IMUA 4J8ZA 1G2DC 4RH8A 2EMKA 2HC5A 3THOB 5KL4A 3P1XA 3JAMC 5BR8E 2EN3A 2V83A 1FJGE 4LF5E 2VQEE 5A69A 4DUZE 3T1HE 1RC7A 2B7TA 1NCSA 2LO3A 5AASA 4DV7E 2EM7A 2DB2A 4WPYA 2NA2A 5T6JA 3AV0A 1ZR9A 5AC5A 4NXME 4Q28A 4KWYA 2EMFA 1IQOA 2ODRD 2V88A 4DMIA 4B3ME 3OMLA 1WHNA 2YTQA 1HNZE 4LF6E 2EMYA 3J81C 2EMHA 2B9DA 4TUIA 1ZU1A 1WJPA 1P47A 3F6HA 5LL6R 2EOHA 1T4LB 2EN2A 2I13A 2YPNA 2JOXA 4DV1E 1RQ0A 2L2KB 1YFHA 4JI6E 3H09A 2YTDA 2JYAA 2YSOA 3J7AG 2I9IA 1PJQA 2YTJA 2UU9E 2L2MA 1UBDC 2EMAA 1YYWA 1X6FA 1LLMC 1DGCA 2YRHA 3F6GA 2LRSA 1WXRA 1STUA 4JI7E 2KHXA 2V89A 4BMJA 4JI2E 2RPCA 4NZVA 2EL6A 4GEQB 3M99B 2EOIA 2EPNA 2YZTA 2EN6A 3C4BA 4F9AB 2YTEA 3KZZA 2N3HA 2Q8UA 2YU5A 1A1JA 2BBGA 2DLKA 2EPZA 1NEIA 1X6HA 2ELZA 4JI5E 4KHPE 1O0WA 3VHTB 2EOXA 4DV6E 2EN8A 1ZAAC 3EPLA 2EOEA 5TSEA 2WBUA 4M0VA 1N36E 1ZBTA 2L2NA 4MLVA 2JOBA 2YTGA 2YRMA 4BHBA 2FGGA 5KL7A 3EPKA 2RSIA 1N34E 3RMPA 2E72A 2EM8A 2UXCE 2JXPA 3BIDA 2KOUA 4WXCA 4BC7A
chains in the Genus database with same CATH topology
2EPUA 3EPHA 2EN3A 4IJDA 1A1HA 2ENAA 2EQ3A 2EMCA 2EORA 2EMWA 1NCSA 2LO3A 1JK2A 5KL5A 2EM6A 1BB8A 2YTNA 2EMLA 2EM7A 2EOZA 2HGHA 4R2PA 2JPAA 1X5WA 3MHHC 2EN4A 5KL3A 2EOOA 1YSAC 2DRPA 1ZR9A 4F6MA 2DGCA 2ADRA 2EPRA 1UN6B 2EMFA 2ENHA 1TF3A 2VRDA 1X3CA 5KL2A 2MDGA 2LVHA 2MKNA 2WBSA 2EE8A 2YTQA 2EMGA 2YRKA 2EMYA 2EMIA 2EMHA 1AAYA 1ZU1A 2EN1A 1WJPA 2ELYA 1KJKA 4R2QA 1P47A 1Z1BA 4F6NA 1JK1A 1YUIA 2EOHA 2EQ1A 2EM4A 2EN2A 2I13A 2DMIA 2JP9A 4R2SA 3MHSC 2EOFA 4R2EA 5KL6A 2LT7A 1A1IA 2EL5A 2EPPA 2EM3A 2YTFA 4R2CA 2EL4A 2YTDA 4X9JA 1MEYC 2J7JA 2EMXA 2YSOA 1G2FC 2GLIA 2EM2A 2YTJA 2WBTA 3UK3C 2YU8A 1A1KA 2EM0A 1UBDC 2EM9A 2EMAA 1X6FA 2CT1A 1LLMC 2LV2A 2M9AA 4R2RA 2EOJA 1DGCA 1YUJA 2EN7A 2ENCA 2YRHA 2EJ4A 2WCC3 2EPCA 4GZNC 4M9VC 2YTPA 2D9HA 2EM5A 2EMZA 2EOSA 2DLQA 4WSGA 2GHFA 2EQ0A 2RPCA 2EPAA 1X6EA 2EL6A 1BBOA 2PRTA 3M99B 4F2JC 2EOIA 2EN6A 2YTEA 1TF6A 2EPXA 2EOYA 2YU5A 2YSPA 1A1JA 2DLKA 2EPZA 1X6HA 2ELZA 4R2AA 2EOMA 3VHTB 2YTOA 2EMBA 2EOXA 3EPJA 2EN8A 4R2DA 1A1GA 2CSHA 3EPLA 2EOEA 1ZAAC 4IS1C 2WBUA 2BB8A 2MKDA 2CTDA 4FK5C 1A1LA 1RMDA 2EP3A 2YTGA 2YRMA 2LCEA 2A25A 1A1FA 2NABA 2YTIA 5KL7A 2R1FA 3EPKA 2RSIA 1F2IG 1TN9A 2E72A 2EM8A 2EOQA 1G2DC 1B69A 2EMKA 5KL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPU A;  3EPH A;  2EN3 A;  4IJD A;  1A1H A;  2ENA A;  2EQ3 A;  2EMC A;  2EOR A;  2EMW A;  1NCS A;  2LO3 A;  1JK2 A;  5KL5 A;  2EM6 A;  1BB8 A;  2YTN A;  2EML A;  2EM7 A;  2EOZ A;  2HGH A;  4R2P A;  2JPA A;  1X5W A;  3MHH C;  2EN4 A;  5KL3 A;  2EOO A;  1YSA C;  2DRP A;  1ZR9 A;  4F6M A;  2DGC A;  2ADR A;  2EPR A;  1UN6 B;  2EMF A;  2ENH A;  1TF3 A;  2VRD A;  1X3C A;  5KL2 A;  2MDG A;  2LVH A;  2MKN A;  2WBS A;  2EE8 A;  2YTQ A;  2EMG A;  2YRK A;  2EMY A;  2EMI A;  2EMH A;  1AAY A;  1ZU1 A;  2EN1 A;  1WJP A;  2ELY A;  1KJK A;  4R2Q A;  1P47 A;  1Z1B A;  4F6N A;  1JK1 A;  1YUI A;  2EOH A;  2EQ1 A;  2EM4 A;  2EN2 A;  2I13 A;  2DMI A;  2JP9 A;  4R2S A;  3MHS C;  2EOF A;  4R2E A;  5KL6 A;  2LT7 A;  1A1I A;  2EL5 A;  2EPP A;  2EM3 A;  2YTF A;  4R2C A;  2EL4 A;  2YTD A;  4X9J A;  1MEY C;  2J7J A;  2EMX A;  2YSO A;  1G2F C;  2GLI A;  2EM2 A;  2YTJ A;  2WBT A;  3UK3 C;  2YU8 A;  1A1K A;  2EM0 A;  1UBD C;  2EM9 A;  2EMA A;  1X6F A;  2CT1 A;  1LLM C;  2LV2 A;  2M9A A;  4R2R A;  2EOJ A;  1DGC A;  1YUJ A;  2EN7 A;  2ENC A;  2YRH A;  2EJ4 A;  2WCC 3;  2EPC A;  4GZN C;  4M9V C;  2YTP A;  2D9H A;  2EM5 A;  2EMZ A;  2EOS A;  2DLQ A;  4WSG A;  2GHF A;  2EQ0 A;  2RPC A;  2EPA A;  1X6E A;  2EL6 A;  1BBO A;  2PRT A;  3M99 B;  4F2J C;  2EOI A;  2EN6 A;  2YTE A;  1TF6 A;  2EPX A;  2EOY A;  2YU5 A;  2YSP A;  1A1J A;  2DLK A;  2EPZ A;  1X6H A;  2ELZ A;  4R2A A;  2EOM A;  3VHT B;  2YTO A;  2EMB A;  2EOX A;  3EPJ A;  2EN8 A;  4R2D A;  1A1G A;  2CSH A;  3EPL A;  2EOE A;  1ZAA C;  4IS1 C;  2WBU A;  2BB8 A;  2MKD A;  2CTD A;  4FK5 C;  1A1L A;  1RMD A;  2EP3 A;  2YTG A;  2YRM A;  2LCE A;  2A25 A;  1A1F A;  2NAB A;  2YTI A;  5KL7 A;  2R1F A;  3EPK A;  2RSI A;  1F2I G;  1TN9 A;  2E72 A;  2EM8 A;  2EOQ A;  1G2D C;  1B69 A;  2EMK A;  5KL4 A; 
#chains in the Genus database with same CATH topology
 2UUC E;  3BF2 A;  3JU0 A;  5A6K A;  2E5L E;  2EQ3 A;  2ZM6 E;  2NUG A;  2EMC A;  1JK2 A;  2EM6 A;  1BB8 A;  3HPS A;  2YTN A;  3ADJ A;  1HNW E;  4WXD A;  2UXD E;  1GTK A;  4HTG A;  3MHH C;  5LMN E;  1SFE A;  2EN4 A;  2H36 X;  4DR1 E;  4F6M A;  2DGC A;  1N33 E;  4LFA E;  2VRD A;  2YWQ A;  1FKA E;  1T38 A;  2EE8 A;  4X64 E;  2EMG A;  3BGH A;  4BBY A;  4MLQ A;  4K0K E;  5DNY A;  2RS7 A;  1QU6 A;  2ELY A;  1Z1B A;  4F6N A;  2RQL A;  2V85 A;  2EM4 A;  5A6B A;  1XNR E;  1PDA A;  1IQS A;  2JR1 A;  4OOG C;  2LT7 A;  2L33 A;  4RHB B;  2DMY A;  4R2C A;  2EL4 A;  3EQ1 A;  3BBG A;  4M30 A;  3KWR A;  2YU8 A;  3UK3 C;  2EM0 A;  1AH5 A;  4JI0 E;  4JI3 E;  2LV2 A;  5F3W A;  2EN7 A;  2ENC A;  4LTY A;  1UHZ A;  2K7I A;  2EJ4 A;  1IBL E;  2YTP A;  3DF6 A;  2UXB E;  2F8B A;  3C6M A;  5IV8 B;  3ADL A;  3HXL A;  2NUE A;  1X6E A;  4P78 A;  4NHR A;  4F2J C;  2FTX B;  1T4O A;  3MSW A;  2K4V A;  4TUG A;  4GKJ E;  2LTR A;  3IWD A;  4O43 A;  4O4K A;  4LF9 E;  2EOY A;  4ZYG A;  2LUQ A;  2E1M A;  3KZY A;  3C6K A;  4DR7 E;  4R2A A;  2LBS B;  2EMB A;  4X65 E;  4IS1 C;  2MKD A;  2YT4 A;  4FK5 C;  4ZYD A;  2L8T A;  1HNX E;  1T39 A;  2LCE A;  2A25 A;  2MC5 A;  2NAB A;  2YTI A;  1BBG A;  5FLX C;  3HQ1 A;  4F9B B;  4JI4 E;  1XNQ E;  5CFF E;  4L8N A;  1EKZ A;  2EPU A;  4P7D A;  1A1H A;  3AUZ A;  1EH6 A;  2DSY A;  2EMW A;  5KL5 A;  4X66 E;  2F4V E;  2EPK X;  4BHC A;  3DJW A;  1X49 A;  2EOZ A;  2JPA A;  1X5W A;  2VF1 A;  2EPM X;  3ADI A;  2B7V A;  2EPR A;  1UN6 B;  1QNT A;  2L3C A;  2WBS A;  1N32 E;  2L6M A;  2YRK A;  1DQ3 A;  1I94 E;  2CPN A;  2NUF A;  2EMI A;  4DKK A;  5A2Q C;  4JYA E;  4YY3 E;  1AAY A;  5ADZ A;  2V86 A;  1JK1 A;  2M7Q A;  2EQ1 A;  2DMI A;  4B3S E;  1YYK A;  4LF7 E;  2FV4 B;  3L00 A;  2N8X A;  4DR4 E;  4R2E A;  2RTX A;  4X8W A;  2JVA A;  1A1I A;  2EL5 A;  2EPP A;  5IWA E;  2EM3 A;  2V87 A;  4F9C B;  3VYY A;  1HR0 E;  1MEY C;  2EMX A;  1G2F C;  2GLI A;  4LFB E;  4HEI A;  3HTX A;  1YUJ A;  2EOJ A;  4OX9 E;  3OTO E;  1EH7 A;  3ECR A;  2WCC 3;  4DUY E;  2EMZ A;  2UUA E;  2RSM A;  1XMO E;  2LJU A;  4AQY E;  4BCA A;  3VK6 A;  2EPA A;  3IWC A;  3THN A;  4JI1 E;  4LFC E;  4O24 A;  1UIL A;  2WZO A;  1PJS A;  2ODR C;  4DV2 E;  4DV5 E;  3T1Y E;  2YTO A;  4ZYH A;  4R2D A;  3LML A;  1A1G A;  1J26 A;  5A6J A;  3QG5 C;  4GKK E;  2BB8 A;  2CTD A;  2LTS A;  1IBM E;  1EH8 A;  3IWB A;  4WFT A;  5A6A A;  2EP3 A;  1A1L A;  3C4T A;  4NXN E;  1PKP A;  2LE2 A;  1F2I G;  1GZ6 A;  5LLQ A;  1TN9 A;  2EOQ A;  4DR2 E;  2JWO A;  2L3J A;  1B69 A;  4Q35 B;  3JTZ A;  3VYX A;  3EPH A;  4IJD A;  4DR6 E;  4WX9 A;  2ENA A;  2RS6 A;  2EZ6 A;  1N3G A;  2EOR A;  1ZBQ A;  3FIG A;  2EML A;  2HGH A;  3ADG A;  4R2P A;  5KL3 A;  2EOO A;  1YSA C;  2V8Q B;  2HHH E;  2DRP A;  2ADR A;  2MDR A;  5AE2 A;  2ENH A;  1TF3 A;  5AE3 A;  1X3C A;  5KL2 A;  2MDG A;  2LVH A;  2MKN A;  2EPO A;  4BS9 A;  3J7Y p;  2EWL A;  4KZS A;  4L5N C;  4YHH E;  2IHR 1;  2JY9 A;  2EN1 A;  1KJK A;  4R2Q A;  1YUI A;  4ZYE A;  3TQM A;  2JP9 A;  3ZOQ B;  4R2S A;  3MHS C;  2EOF A;  2EPL X;  2M4I A;  2N3G A;  5KL6 A;  1PJT A;  3HPZ A;  4JV5 E;  2M1S A;  2YTF A;  2HJJ A;  5AE1 A;  4R8O A;  1WHQ A;  4X9J A;  2J7J A;  4F54 A;  2LUP B;  2EM2 A;  2LJH A;  3J80 C;  2LMZ A;  2WBT A;  4JI8 E;  5AC4 A;  1A1K A;  1GQE A;  2EM9 A;  2CT1 A;  2M9A A;  4R2R A;  4M2Z A;  4WSP A;  2EPC A;  4N4R B;  1X47 A;  5A6B D;  4GZN C;  2UUB E;  4LF4 E;  5IXM B;  4M9V C;  2D9H A;  2EM5 A;  4WYQ B;  4I8O A;  2EOS A;  2DLQ A;  4WSG A;  1SR9 A;  2GHF A;  5LMU E;  1J5E E;  2EQ0 A;  4O5G A;  4BC9 A;  1XMQ E;  1MGT A;  2L92 A;  2B3T B;  2VQF E;  1BBO A;  2PRT A;  3LLH A;  4DV0 E;  4DR5 E;  4B3R E;  1YPN A;  1TF6 A;  2DIX A;  2EPX A;  4DR3 E;  1WRJ A;  2KON A;  1L4S A;  4LF8 E;  2YSP A;  4R03 A;  4DV4 E;  2G7H A;  5IT9 C;  2VE7 C;  2EOM A;  4LU9 A;  3EPJ A;  1IBK E;  4DV3 E;  2CSH A;  2R76 A;  1YYO A;  1T4N A;  1YZ9 A;  2MC6 A;  1KYQ A;  1RMD A;  1DI2 A;  1A1F A;  4X62 E;  2R1F A;  2GPI A;  1X48 A;  4B3T E;  3K6Q A;  1IMU A;  4J8Z A;  1G2D C;  4RH8 A;  2EMK A;  2HC5 A;  3THO B;  5KL4 A;  3P1X A;  3JAM C;  5BR8 E;  2EN3 A;  2V83 A;  1FJG E;  4LF5 E;  2VQE E;  5A69 A;  4DUZ E;  3T1H E;  1RC7 A;  2B7T A;  1NCS A;  2LO3 A;  5AAS A;  4DV7 E;  2EM7 A;  2DB2 A;  4WPY A;  2NA2 A;  5T6J A;  3AV0 A;  1ZR9 A;  5AC5 A;  4NXM E;  4Q28 A;  4KWY A;  2EMF A;  1IQO A;  2ODR D;  2V88 A;  4DMI A;  4B3M E;  3OML A;  1WHN A;  2YTQ A;  1HNZ E;  4LF6 E;  2EMY A;  3J81 C;  2EMH A;  2B9D A;  4TUI A;  1ZU1 A;  1WJP A;  1P47 A;  3F6H A;  5LL6 R;  2EOH A;  1T4L B;  2EN2 A;  2I13 A;  2YPN A;  2JOX A;  4DV1 E;  1RQ0 A;  2L2K B;  1YFH A;  4JI6 E;  3H09 A;  2YTD A;  2JYA A;  2YSO A;  3J7A G;  2I9I A;  1PJQ A;  2YTJ A;  2UU9 E;  2L2M A;  1UBD C;  2EMA A;  1YYW A;  1X6F A;  1LLM C;  1DGC A;  2YRH A;  3F6G A;  2LRS A;  1WXR A;  1STU A;  4JI7 E;  2KHX A;  2V89 A;  4BMJ A;  4JI2 E;  2RPC A;  4NZV A;  2EL6 A;  4GEQ B;  3M99 B;  2EOI A;  2EPN A;  2YZT A;  2EN6 A;  3C4B A;  4F9A B;  2YTE A;  3KZZ A;  2N3H A;  2Q8U A;  2YU5 A;  1A1J A;  2BBG A;  2DLK A;  2EPZ A;  1NEI A;  1X6H A;  2ELZ A;  4JI5 E;  4KHP E;  1O0W A;  3VHT B;  2EOX A;  4DV6 E;  2EN8 A;  1ZAA C;  3EPL A;  2EOE A;  5TSE A;  2WBU A;  4M0V A;  1N36 E;  1ZBT A;  2L2N A;  4MLV A;  2JOB A;  2YTG A;  2YRM A;  4BHB A;  2FGG A;  5KL7 A;  3EPK A;  2RSI A;  1N34 E;  3RMP A;  2E72 A;  2EM8 A;  2UXC E;  2JXP A;  3BID A;  2KOU A;  4WXC A;  4BC7 A; 
#chains in the Genus database with same CATH homology
 2EPU A;  3EPH A;  2EN3 A;  4IJD A;  1A1H A;  2ENA A;  2EQ3 A;  2EMC A;  2EOR A;  2EMW A;  1NCS A;  2LO3 A;  1JK2 A;  5KL5 A;  2EM6 A;  1BB8 A;  2YTN A;  2EML A;  2EM7 A;  2EOZ A;  2HGH A;  4R2P A;  2JPA A;  1X5W A;  3MHH C;  2EN4 A;  5KL3 A;  2EOO A;  1YSA C;  2DRP A;  1ZR9 A;  4F6M A;  2DGC A;  2ADR A;  2EPR A;  1UN6 B;  2EMF A;  2ENH A;  1TF3 A;  2VRD A;  1X3C A;  5KL2 A;  2MDG A;  2LVH A;  2MKN A;  2WBS A;  2EE8 A;  2YTQ A;  2EMG A;  2YRK A;  2EMY A;  2EMI A;  2EMH A;  1AAY A;  1ZU1 A;  2EN1 A;  1WJP A;  2ELY A;  1KJK A;  4R2Q A;  1P47 A;  1Z1B A;  4F6N A;  1JK1 A;  1YUI A;  2EOH A;  2EQ1 A;  2EM4 A;  2EN2 A;  2I13 A;  2DMI A;  2JP9 A;  4R2S A;  3MHS C;  2EOF A;  4R2E A;  5KL6 A;  2LT7 A;  1A1I A;  2EL5 A;  2EPP A;  2EM3 A;  2YTF A;  4R2C A;  2EL4 A;  2YTD A;  4X9J A;  1MEY C;  2J7J A;  2EMX A;  2YSO A;  1G2F C;  2GLI A;  2EM2 A;  2YTJ A;  2WBT A;  3UK3 C;  2YU8 A;  1A1K A;  2EM0 A;  1UBD C;  2EM9 A;  2EMA A;  1X6F A;  2CT1 A;  1LLM C;  2LV2 A;  2M9A A;  4R2R A;  2EOJ A;  1DGC A;  1YUJ A;  2EN7 A;  2ENC A;  2YRH A;  2EJ4 A;  2WCC 3;  2EPC A;  4GZN C;  4M9V C;  2YTP A;  2D9H A;  2EM5 A;  2EMZ A;  2EOS A;  2DLQ A;  4WSG A;  2GHF A;  2EQ0 A;  2RPC A;  2EPA A;  1X6E A;  2EL6 A;  1BBO A;  2PRT A;  3M99 B;  4F2J C;  2EOI A;  2EN6 A;  2YTE A;  1TF6 A;  2EPX A;  2EOY A;  2YU5 A;  2YSP A;  1A1J A;  2DLK A;  2EPZ A;  1X6H A;  2ELZ A;  4R2A A;  2EOM A;  3VHT B;  2YTO A;  2EMB A;  2EOX A;  3EPJ A;  2EN8 A;  4R2D A;  1A1G A;  2CSH A;  3EPL A;  2EOE A;  1ZAA C;  4IS1 C;  2WBU A;  2BB8 A;  2MKD A;  2CTD A;  4FK5 C;  1A1L A;  1RMD A;  2EP3 A;  2YTG A;  2YRM A;  2LCE A;  2A25 A;  1A1F A;  2NAB A;  2YTI A;  5KL7 A;  2R1F A;  3EPK A;  2RSI A;  1F2I G;  1TN9 A;  2E72 A;  2EM8 A;  2EOQ A;  1G2D C;  1B69 A;  2EMK A;  5KL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...