1B6CA

Crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cytoplasmic domain of the type I TGF beta receptor in complex with FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/protein kinase)
molecule keywords FK506-BINDING PROTEIN
total genus 27
structure length 107
sequence length 107
chains with identical sequence C, E, G
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1b6cA00
3RFWA 4LAVA 5HWCA 1B6CA 1BKFA 1J4HA 4DZ2A 5DIVA 3FAPA 3TCZA 3NRKA 2UZ5A 2D9FA 2M1IA 2PBCA 4DRNA 2AWGA 1D6OA 3O5EA 4W9QA 2M08A 3UQBA 5HUAA 1M5YA 1KT1A 1J6YA 5HT1A 2ZQVA 3KACA 1Q6UA 3JYJA 4N19A 4ODQA 4JFJA 4IQCA 4DRHA 2RQSA 2XP7A 4DRMA 1FKIA 2MLXA 2FAPA 2LJ4A 2MPHA 3O5JA 3O5OA 4DZ3A 3O5PA 4LAXA 4MGVA 1ROUA 4JYSA 5DITA 1W26A 4JFKA 2DG3A 1FKJA 1D7HA 3JXVA 1FD9A 1J4RA 3O5IA 2MF9A 3UI5A 4FAPA 3KAHA 3NTPA 4TX0A 3NI6A 1D7IA 3H9RB 1FKFA 1Q6HA 3O5QA 4U84A 2M2AA 1FKTA 4U86A 4J4OA 4QT2A 1FKGA 1J4IA 4TW6A 4C02B 1FAPA 4DRPA 3IKGA 1NMWA 1ROTA 3KCEA 1EYMA 4DRKA 5HTGA 3B7XA 5GPGA 4JFLA 2FKEA 3UQIA 5HW6A 2KFWA 4G2PA 3IKDA 3PRDA 2XPBA 1PBKA 3TC5A 2IF4A 2MNTA 2VN1A 2XP3A 1N1AA 2ZR6A 3IHZA 4G50A 4IPXA 4O2TA 4QT3A 4DROA 3UQAA 3GPKA 1YW5A 1PINA 3IK8A 1Q6IA 2Q5AA 5BXJA 2PPPA 3KZ7A 4DIPA 2XPAA 1YATA 1BL4A 3O5RA 4JFMA 1TCOC 2RUDA 2Y78A 4ODRA 2KI3A 3CGNA 3LUOA 2VCDA 4ITZA 1FKHA 3I6CA 3RGCA 4DRJA 4DRQA 3CGMA 1JVWA 5J6EA 2F21A 2OFNA 2K8IA 3O5FA 1F8AB 1FKLA 2F2DA 2ZR5A 4MSPA 2RURA 1QPFA 2KO7A 2KE0A 3KADA 1ZK6A 4QIBA 1JNSA 2XP9A 4ODOA 2LGOA 4TW7A 1HXVA 1T11A 2ZQUA 3O5DA 4LAWA 4IQ2A 2DG4A 3KAGA 4TNSA 4DH0A 1A7XA 2XP6A 3KAIA 3PRBA 1FKKA 1F40A 4LAYA 2ZQSA 2ITKA 3UI6A 5HW8A 2RUCA 4U85A 1FKRA 1Q1CA 1QPLA 4TW8A 4DT4A 5HWBA 2XP5A 1EQ3A 1NSGA 2RSEA 1FKDA 5D75A 3O5KA 4ODKA 1QZ2A 2LPVA 4FN2A 3VAWA 3KAFA 2KGJA 1Y0OA 2PV2A 2L2SA 3MDYB 2PV1A 3O5LA 4NNRA 4W9PA 1NMVA 3UF8A 4ODNA 1FKSA 3O5MA 2PV3A 2JZVA 2KR7A 1D7JA 4R0XA 3OOBA 4GGQA 4ODLA 1L1PA 3WH0A 1FKBA 1ZCNA 1JNTA 3EY6A 3ODKA 3O5GA 3JYMA 4TYOA 4BF8A 2RUQA 3PA7A 1R9HA 5DIUA 4DRIA 2F4EA 2LKNA 4ODPA 4JFIA 5B8IC 5I98A 2XP8A 4ODMA 2MLZA 2XP4A 2ZQTA 4W9OA 5HKGA 1KT0A 1U79A 4GIVA 2DG9A 5HW7A 3KABA 2MLYA 1C9HA 2N87A 2PPNA 2ZR4A 2PPOA 3UI4A 3TDBA 4J4NA 1FJDA 1P5QA
chains in the Genus database with same CATH superfamily
1NWUA 1BKFA 3B9AA 3FAPA 3RMEA 1FFRA 5HUAA 1M5YA 1KT1A 3WD4A 5HT1A 2ZQVA 1J6YA 1LQ0A 2FAPA 1EHNA 4IT4A 2MPHA 4Z2IA 4MAVA 5DITA 1W1VA 1LL4A 1J4RA 2MF9A 1O6IA 2A3BA 1ZBCA 1H0IA 1LG2A 1Q6HA 1H0GA 3O5QA 1FKGA 1J4IA 3WL1A 1NH6A 3FXYA 4ZPVR 1ZBWA 2FKEA 3UQIA 3ARVA 4G2PA 2XPBA 2F23A 2IF4A 4XAKA 2MNTA 4O2TA 4MNMA 4ZS6A 3W4RA 3GPKA 2DPEA 3WQWA 5BXJA 1JCHB 2WLYA 2XPAA 2DSUA 3O5RA 2DSVA 1TCOC 3LUOA 2VCDA 5HBFA 4DRJA 1ZBKA 4Z2KA 3AS3A 2F2DA 4HBEA 2RURA 1QPFA 1OGGA 2KO7A 4QIBA 2XP9A 2G41A 4ODOA 4TW7A 4IQ2A 2DG4A 4DH0A 1HKJA 4S3KA 3WD2A 2B31A 1F40A 4NSBA 2ZQSA 3WQVA 2ITKA 4U85A 3ARZA 3ARPA 2XP5A 1FKDA 3VAWA 1ZL1A 3KAFA 1Y0OA 2PV2A 4Z2GA 3MDYB 4R0XA 2PV3A 2KR7A 3AS0A 3OOBA 4PTMA 3WH0A 3EY6A 4Q7NA 4BF8A 3PRAA 1SYTA 1W9UA 2ZQTA 1KT0A 2A3AA 5HW7A 3KABA 3G6MA 4NZCA 2N87A 2PPNA 5DEZA 1K9TA 4J4NA 3TDBA 1P5QA 5HWCA 1GOIA 1HJWA 1J4HA 4R5EA 2UZ5A 2M1IA 1HKKA 2PBCA 3O5EA 3ALGA 4MNLA 1Q6UA 4IQCA 4DRHA 2RQSA 1IX5A 1FKIA 1UR8A 2MLXA 3AS1A 5DO2A 3O5OA 4MPKA 4DZ3A 3O5PA 4WIWA 1ROUA 4WKHA 1W26A 3JXVA 1FD9A 4FAPA 3G6LA 3NI6A 1D7IA 1LL6A 2DSWA 2M2AA 1W1TA 1E44A 1ROTA 4WK9A 3WIJA 3WD1A 5HW6A 1EDQA 3IKDA 3PRDA 1PBKA 3CH9A 4KR0B 1HJVA 1N1AA 4S3JA 3IHZA 3ARTA 1E6RA 3UQAA 2A3EA 2QF8A 4HBOA 1YW5A 4UDMA 2WLZA 4DIPA 1BL4A 2WM0A 1HKIA 2RUDA 2Y78A 3CGNA 4P8UA 3I6CA 4DRQA 3CGMA 4DWSA 2A3CA 1UR9A 2OFNA 3BMBA 1F8AB 1W1PA 3KADA 3WD0A 2DT3A 4KQZA 1HXVA 4LAWA 1ZU8A 4TNSA 1A7XA 3KAIA 1FKKA 4L3NA 1ZB5A 4DWSC 1SR0A 3UI6A 3FY1A 1JNEA 1HJXA 2RUCA 2DSZA 4LGXA 1WAWA 4DT4A 2RSEA 3AQUA 4P8XA 3OA5A 1ZBVA 2LPVA 2KGJA 4W9PA 4NNRA 1W9VA 3RM8A 2ETNA 1ZCNA 3ODKA 3GU0A 3JYMA 2RUQA 3PA7A 2LKNA 2XP8A 4ODMA 4W9OA 2AOSA 2DG9A 2MLYA 1C9HA 1FJDA 2G8ZA 3B9DA 5JH8A 4LAVA 3ALFA 3RM4A 4DZ2A 5DIVA 1NWRA 3NRKA 1E15A 2AWGA 1D6OA 4W9QA 3KACA 2PN0A 4N19A 4Z2HA 2YBTA 3ARUA 1OGBA 1LJYA 4DRMA 2P4VA 2LJ4A 3O5JA 3CZ8A 4IT6A 4MGVA 4JYSA 2DG3A 4ZPTR 1FKJA 3QOKA 1VF8A 3NTPA 4TX0A 3ARYA 1FKFA 3ARQA 4ZPWR 4U84A 4U86A 1FKTA 4J4OA 4C02B 1FAPA 3IKGA 4DRKA 3KCEA 1EYMA 2EULA 3B7XA 3RM9A 4Z2JA 1E6NA 2OLHA 3TC5A 4WKAA 2ZR6A 2XP3A 4QT3A 1X6NA 4HARA 2DT2A 5GQBA 1GPFA 1Q6IA 2Q5AA 2PPPA 4MTVA 4Q22A 3AROA 1YATA 4JFMA 1FFQA 2KI3A 1HKMA 4ITZA 2K8IA 3O5FA 1FKLA 3WL0A 1WB0A 4ML4A 3ARSA 2KE0A 1ZK6A 1WNOA 1JNSA 2LGOA 3ARWA 1T11A 2ZQUA 3AS2A 3O5DA 5DF0A 2XP6A 3PRBA 1GUVA 1NWSA 1FKRA 3CHFA 3WKZA 1QPLA 2DT0A 4DWSB 5HWBA 1EQ3A 1QZ2A 5GPRA 4QZVB 3CHCA 4P8VA 2PV1A 3CHDA 3UF8A 1FKSA 3B8SA 2JZVA 1L1PA 1D7JA 1OWQA 1XHGA 3WD3A 3O5GA 5DIUA 2F4EA 4JFIA 5B8IC 2MLZA 2XP4A 5HKGA 4DWSD 1U79A 4GIVA 3GTYX 2PPOA 4TW8A 1E6PA 3RFWA 4L72B 1B6CA 3TCZA 1LG1A 2D9FA 4DRNA 3UQBA 2M08A 4W5UA 1TFVA 1JNDA 3JYJA 4ODQA 4JFJA 2XP7A 1X6LA 3BXWA 4LAXA 4JFKA 1D7HA 3O5IA 3UI5A 1W1YA 3KAHA 4MNKA 3H9RB 1NWTA 4MNJA 4QT2A 4TW6A 4DRPA 1NMWA 1XRVA 5HTGA 2DT1A 5GPGA 4JFLA 1KFWA 2O92A 1ITXA 2KFWA 3ARXA 2VN1A 1LL7A 4G50A 4IPXA 2FDMA 4DROA 1EIBA 1PINA 3IK8A 2O9OA 3KZ7A 3EIPA 1W9PA 1CTNA 4ODRA 1RD6A 1FKHA 3CHEA 3RGCA 1JVWA 5J6EA 2F21A 4WKFA 2ZR5A 4URIA 4MSPA 4P8WA 4WJXA 3ARRA 3KAGA 1D2KA 1E9LA 3B9EA 4LAYA 5HW8A 3PR9A 1Q1CA 2PI6A 1NSGA 5D75A 2IUZA 3O5KA 4ODKA 4FN2A 2B5UB 2YBUA 2ESCA 2WK2A 2L2SA 3O5LA 1NMVA 1E6ZA 4ODNA 3O5MA 4GGQA 4ODLA 1FKBA 1JNTA 4TYOA 4DRIA 1R9HA 1GRJA 4ODPA 4AY1A 5I98A 4Z2LA 2ZR4A 3UI4A
chains in the Genus database with same CATH topology
1NWUA 1BKFA 3B9AA 3FAPA 3RMEA 1FFRA 5HUAA 1M5YA 1KT1A 3WD4A 5HT1A 2ZQVA 1J6YA 1LQ0A 2FAPA 1EHNA 4IT4A 2MPHA 4Z2IA 4MAVA 5DITA 1W1VA 1LL4A 1J4RA 2MF9A 1O6IA 2A3BA 1ZBCA 1H0IA 1LG2A 1Q6HA 1H0GA 3O5QA 1FKGA 1J4IA 3WL1A 1NH6A 3FXYA 4ZPVR 1ZBWA 2FKEA 3UQIA 3ARVA 4G2PA 2XPBA 2IF4A 4XAKA 2MNTA 4O2TA 4MNMA 4ZS6A 3W4RA 3GPKA 2DPEA 3WQWA 5BXJA 2WLYA 2XPAA 2DSUA 3O5RA 2DSVA 1TCOC 3LUOA 2VCDA 5HBFA 4DRJA 1ZBKA 4Z2KA 3AS3A 2F2DA 4HBEA 2RURA 1QPFA 1OGGA 2KO7A 4QIBA 2XP9A 2G41A 4ODOA 4TW7A 4IQ2A 2DG4A 4DH0A 1HKJA 4S3KA 3WD2A 2B31A 1F40A 4NSBA 2ZQSA 3WQVA 2ITKA 4U85A 3ARZA 3ARPA 2XP5A 1FKDA 3VAWA 1ZL1A 3KAFA 1Y0OA 2PV2A 4Z2GA 3MDYB 4R0XA 2PV3A 2KR7A 3AS0A 3OOBA 4PTMA 3WH0A 3EY6A 4Q7NA 4BF8A 3PRAA 1SYTA 1W9UA 2ZQTA 1KT0A 2A3AA 5HW7A 3KABA 3G6MA 4NZCA 2N87A 2PPNA 5DEZA 1K9TA 4J4NA 3TDBA 1P5QA 5HWCA 1GOIA 1HJWA 1J4HA 4R5EA 2UZ5A 2M1IA 1HKKA 2PBCA 3O5EA 3ALGA 4MNLA 1Q6UA 4IQCA 4DRHA 2RQSA 1IX5A 1FKIA 1UR8A 2MLXA 3AS1A 5DO2A 3O5OA 4MPKA 4DZ3A 3O5PA 4WIWA 1ROUA 4WKHA 1W26A 3JXVA 1FD9A 4FAPA 3G6LA 3NI6A 1D7IA 1LL6A 2DSWA 2M2AA 1W1TA 1ROTA 4WK9A 3WIJA 3WD1A 5HW6A 1EDQA 3IKDA 3PRDA 1PBKA 3CH9A 4KR0B 1HJVA 1N1AA 4S3JA 3IHZA 3ARTA 1E6RA 3UQAA 2A3EA 2QF8A 4HBOA 1YW5A 2WLZA 4DIPA 1BL4A 2WM0A 1HKIA 2RUDA 2Y78A 3CGNA 4P8UA 3I6CA 4DRQA 3CGMA 4DWSA 2A3CA 1UR9A 2OFNA 1F8AB 1W1PA 3KADA 3WD0A 2DT3A 4KQZA 1HXVA 4LAWA 1ZU8A 4TNSA 1A7XA 3KAIA 1FKKA 4L3NA 1ZB5A 4DWSC 1SR0A 3UI6A 3FY1A 1JNEA 1HJXA 2RUCA 2DSZA 4LGXA 1WAWA 4DT4A 2RSEA 3AQUA 4P8XA 3OA5A 1ZBVA 2LPVA 2KGJA 4W9PA 4NNRA 1W9VA 3RM8A 1ZCNA 3ODKA 3JYMA 2RUQA 3PA7A 2LKNA 2XP8A 4ODMA 4W9OA 2AOSA 2DG9A 2MLYA 1C9HA 1FJDA 2G8ZA 3B9DA 5JH8A 4LAVA 3ALFA 3RM4A 4DZ2A 5DIVA 1NWRA 3NRKA 1E15A 2AWGA 1D6OA 4W9QA 3KACA 4N19A 4Z2HA 2YBTA 3ARUA 1OGBA 1LJYA 4DRMA 2LJ4A 3O5JA 3CZ8A 4IT6A 4MGVA 4JYSA 2DG3A 4ZPTR 1FKJA 3QOKA 1VF8A 3NTPA 4TX0A 3ARYA 1FKFA 3ARQA 4ZPWR 4U84A 4U86A 1FKTA 4J4OA 4C02B 1FAPA 3IKGA 4DRKA 3KCEA 1EYMA 3B7XA 3RM9A 4Z2JA 1E6NA 2OLHA 3TC5A 4WKAA 2ZR6A 2XP3A 4QT3A 1X6NA 4HARA 2DT2A 5GQBA 1GPFA 1Q6IA 2Q5AA 2PPPA 4MTVA 4Q22A 3AROA 1YATA 4JFMA 1FFQA 2KI3A 4ITZA 1HKMA 2K8IA 3O5FA 1FKLA 3WL0A 1WB0A 4ML4A 3ARSA 2KE0A 1ZK6A 1WNOA 1JNSA 2LGOA 3ARWA 1T11A 2ZQUA 3AS2A 3O5DA 5DF0A 2XP6A 3PRBA 1GUVA 1NWSA 1FKRA 3CHFA 3WKZA 1QPLA 2DT0A 4DWSB 5HWBA 1EQ3A 1QZ2A 5GPRA 4QZVB 3CHCA 4P8VA 2PV1A 3CHDA 3UF8A 1FKSA 3B8SA 2JZVA 1L1PA 1D7JA 1OWQA 1XHGA 3WD3A 3O5GA 5DIUA 2F4EA 4JFIA 5B8IC 2MLZA 2XP4A 5HKGA 4DWSD 1U79A 4GIVA 2PPOA 4TW8A 1E6PA 3RFWA 4L72B 1B6CA 3TCZA 1LG1A 2D9FA 4DRNA 3UQBA 2M08A 4W5UA 1TFVA 1JNDA 3JYJA 4ODQA 4JFJA 2XP7A 1X6LA 3BXWA 4LAXA 4JFKA 1D7HA 3O5IA 3UI5A 1W1YA 3KAHA 4MNKA 3H9RB 1NWTA 4MNJA 4QT2A 4TW6A 4DRPA 1NMWA 1XRVA 5HTGA 2DT1A 5GPGA 4JFLA 1KFWA 2O92A 1ITXA 2KFWA 3ARXA 2VN1A 1LL7A 4G50A 4IPXA 2FDMA 4DROA 1EIBA 1PINA 3IK8A 2O9OA 3KZ7A 1W9PA 1CTNA 4ODRA 1RD6A 1FKHA 3CHEA 3RGCA 1JVWA 5J6EA 2F21A 4WKFA 2ZR5A 4URIA 4MSPA 4P8WA 4WJXA 3ARRA 3KAGA 1D2KA 1E9LA 3B9EA 4LAYA 5HW8A 3PR9A 1Q1CA 2PI6A 1NSGA 5D75A 2IUZA 3O5KA 4ODKA 4FN2A 2YBUA 2ESCA 2WK2A 2L2SA 3O5LA 1NMVA 1E6ZA 4ODNA 3O5MA 4GGQA 4ODLA 1FKBA 1JNTA 4TYOA 4DRIA 1R9HA 4ODPA 4AY1A 5I98A 4Z2LA 2ZR4A 3UI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RFW A;  4LAV A;  5HWC A;  1B6C A;  1BKF A;  1J4H A;  4DZ2 A;  5DIV A;  3FAP A;  3TCZ A;  3NRK A;  2UZ5 A;  2D9F A;  2M1I A;  2PBC A;  4DRN A;  2AWG A;  1D6O A;  3O5E A;  4W9Q A;  2M08 A;  3UQB A;  5HUA A;  1M5Y A;  1KT1 A;  1J6Y A;  5HT1 A;  2ZQV A;  3KAC A;  1Q6U A;  3JYJ A;  4N19 A;  4ODQ A;  4JFJ A;  4IQC A;  4DRH A;  2RQS A;  2XP7 A;  4DRM A;  1FKI A;  2MLX A;  2FAP A;  2LJ4 A;  2MPH A;  3O5J A;  3O5O A;  4DZ3 A;  3O5P A;  4LAX A;  4MGV A;  1ROU A;  4JYS A;  5DIT A;  1W26 A;  4JFK A;  2DG3 A;  1FKJ A;  1D7H A;  3JXV A;  1FD9 A;  1J4R A;  3O5I A;  2MF9 A;  3UI5 A;  4FAP A;  3KAH A;  3NTP A;  4TX0 A;  3NI6 A;  1D7I A;  3H9R B;  1FKF A;  1Q6H A;  3O5Q A;  4U84 A;  2M2A A;  1FKT A;  4U86 A;  4J4O A;  4QT2 A;  1FKG A;  1J4I A;  4TW6 A;  4C02 B;  1FAP A;  4DRP A;  3IKG A;  1NMW A;  1ROT A;  3KCE A;  1EYM A;  4DRK A;  5HTG A;  3B7X A;  5GPG A;  4JFL A;  2FKE A;  3UQI A;  5HW6 A;  2KFW A;  4G2P A;  3IKD A;  3PRD A;  2XPB A;  1PBK A;  3TC5 A;  2IF4 A;  2MNT A;  2VN1 A;  2XP3 A;  1N1A A;  2ZR6 A;  3IHZ A;  4G50 A;  4IPX A;  4O2T A;  4QT3 A;  4DRO A;  3UQA A;  3GPK A;  1YW5 A;  1PIN A;  3IK8 A;  1Q6I A;  2Q5A A;  5BXJ A;  2PPP A;  3KZ7 A;  4DIP A;  2XPA A;  1YAT A;  1BL4 A;  3O5R A;  4JFM A;  1TCO C;  2RUD A;  2Y78 A;  4ODR A;  2KI3 A;  3CGN A;  3LUO A;  2VCD A;  4ITZ A;  1FKH A;  3I6C A;  3RGC A;  4DRJ A;  4DRQ A;  3CGM A;  1JVW A;  5J6E A;  2F21 A;  2OFN A;  2K8I A;  3O5F A;  1F8A B;  1FKL A;  2F2D A;  2ZR5 A;  4MSP A;  2RUR A;  1QPF A;  2KO7 A;  2KE0 A;  3KAD A;  1ZK6 A;  4QIB A;  1JNS A;  2XP9 A;  4ODO A;  2LGO A;  4TW7 A;  1HXV A;  1T11 A;  2ZQU A;  3O5D A;  4LAW A;  4IQ2 A;  2DG4 A;  3KAG A;  4TNS A;  4DH0 A;  1A7X A;  2XP6 A;  3KAI A;  3PRB A;  1FKK A;  1F40 A;  4LAY A;  2ZQS A;  2ITK A;  3UI6 A;  5HW8 A;  2RUC A;  4U85 A;  1FKR A;  1Q1C A;  1QPL A;  4TW8 A;  4DT4 A;  5HWB A;  2XP5 A;  1EQ3 A;  1NSG A;  2RSE A;  1FKD A;  5D75 A;  3O5K A;  4ODK A;  1QZ2 A;  2LPV A;  4FN2 A;  3VAW A;  3KAF A;  2KGJ A;  1Y0O A;  2PV2 A;  2L2S A;  3MDY B;  2PV1 A;  3O5L A;  4NNR A;  4W9P A;  1NMV A;  3UF8 A;  4ODN A;  1FKS A;  3O5M A;  2PV3 A;  2JZV A;  2KR7 A;  1D7J A;  4R0X A;  3OOB A;  4GGQ A;  4ODL A;  1L1P A;  3WH0 A;  1FKB A;  1ZCN A;  1JNT A;  3EY6 A;  3ODK A;  3O5G A;  3JYM A;  4TYO A;  4BF8 A;  2RUQ A;  3PA7 A;  1R9H A;  5DIU A;  4DRI A;  2F4E A;  2LKN A;  4ODP A;  4JFI A;  5B8I C;  5I98 A;  2XP8 A;  4ODM A;  2MLZ A;  2XP4 A;  2ZQT A;  4W9O A;  5HKG A;  1KT0 A;  1U79 A;  4GIV A;  2DG9 A;  5HW7 A;  3KAB A;  2MLY A;  1C9H A;  2N87 A;  2PPN A;  2ZR4 A;  2PPO A;  3UI4 A;  3TDB A;  4J4N A;  1FJD A;  1P5Q A; 
#chains in the Genus database with same CATH topology
 1NWU A;  1BKF A;  3B9A A;  3FAP A;  3RME A;  1FFR A;  5HUA A;  1M5Y A;  1KT1 A;  3WD4 A;  5HT1 A;  2ZQV A;  1J6Y A;  1LQ0 A;  2FAP A;  1EHN A;  4IT4 A;  2MPH A;  4Z2I A;  4MAV A;  5DIT A;  1W1V A;  1LL4 A;  1J4R A;  2MF9 A;  1O6I A;  2A3B A;  1ZBC A;  1H0I A;  1LG2 A;  1Q6H A;  1H0G A;  3O5Q A;  1FKG A;  1J4I A;  3WL1 A;  1NH6 A;  3FXY A;  4ZPV R;  1ZBW A;  2FKE A;  3UQI A;  3ARV A;  4G2P A;  2XPB A;  2F23 A;  2IF4 A;  4XAK A;  2MNT A;  4O2T A;  4MNM A;  4ZS6 A;  3W4R A;  3GPK A;  2DPE A;  3WQW A;  5BXJ A;  1JCH B;  2WLY A;  2XPA A;  2DSU A;  3O5R A;  2DSV A;  1TCO C;  3LUO A;  2VCD A;  5HBF A;  4DRJ A;  1ZBK A;  4Z2K A;  3AS3 A;  2F2D A;  4HBE A;  2RUR A;  1QPF A;  1OGG A;  2KO7 A;  4QIB A;  2XP9 A;  2G41 A;  4ODO A;  4TW7 A;  4IQ2 A;  2DG4 A;  4DH0 A;  1HKJ A;  4S3K A;  3WD2 A;  2B31 A;  1F40 A;  4NSB A;  2ZQS A;  3WQV A;  2ITK A;  4U85 A;  3ARZ A;  3ARP A;  2XP5 A;  1FKD A;  3VAW A;  1ZL1 A;  3KAF A;  1Y0O A;  2PV2 A;  4Z2G A;  3MDY B;  4R0X A;  2PV3 A;  2KR7 A;  3AS0 A;  3OOB A;  4PTM A;  3WH0 A;  3EY6 A;  4Q7N A;  4BF8 A;  3PRA A;  1SYT A;  1W9U A;  2ZQT A;  1KT0 A;  2A3A A;  5HW7 A;  3KAB A;  3G6M A;  4NZC A;  2N87 A;  2PPN A;  5DEZ A;  1K9T A;  4J4N A;  3TDB A;  1P5Q A;  5HWC A;  1GOI A;  1HJW A;  1J4H A;  4R5E A;  2UZ5 A;  2M1I A;  1HKK A;  2PBC A;  3O5E A;  3ALG A;  4MNL A;  1Q6U A;  4IQC A;  4DRH A;  2RQS A;  1IX5 A;  1FKI A;  1UR8 A;  2MLX A;  3AS1 A;  5DO2 A;  3O5O A;  4MPK A;  4DZ3 A;  3O5P A;  4WIW A;  1ROU A;  4WKH A;  1W26 A;  3JXV A;  1FD9 A;  4FAP A;  3G6L A;  3NI6 A;  1D7I A;  1LL6 A;  2DSW A;  2M2A A;  1W1T A;  1E44 A;  1ROT A;  4WK9 A;  3WIJ A;  3WD1 A;  5HW6 A;  1EDQ A;  3IKD A;  3PRD A;  1PBK A;  3CH9 A;  4KR0 B;  1HJV A;  1N1A A;  4S3J A;  3IHZ A;  3ART A;  1E6R A;  3UQA A;  2A3E A;  2QF8 A;  4HBO A;  1YW5 A;  4UDM A;  2WLZ A;  4DIP A;  1BL4 A;  2WM0 A;  1HKI A;  2RUD A;  2Y78 A;  3CGN A;  4P8U A;  3I6C A;  4DRQ A;  3CGM A;  4DWS A;  2A3C A;  1UR9 A;  2OFN A;  3BMB A;  1F8A B;  1W1P A;  3KAD A;  3WD0 A;  2DT3 A;  4KQZ A;  1HXV A;  4LAW A;  1ZU8 A;  4TNS A;  1A7X A;  3KAI A;  1FKK A;  4L3N A;  1ZB5 A;  4DWS C;  1SR0 A;  3UI6 A;  3FY1 A;  1JNE A;  1HJX A;  2RUC A;  2DSZ A;  4LGX A;  1WAW A;  4DT4 A;  2RSE A;  3AQU A;  4P8X A;  3OA5 A;  1ZBV A;  2LPV A;  2KGJ A;  4W9P A;  4NNR A;  1W9V A;  3RM8 A;  2ETN A;  1ZCN A;  3ODK A;  3GU0 A;  3JYM A;  2RUQ A;  3PA7 A;  2LKN A;  2XP8 A;  4ODM A;  4W9O A;  2AOS A;  2DG9 A;  2MLY A;  1C9H A;  1FJD A;  2G8Z A;  3B9D A;  5JH8 A;  4LAV A;  3ALF A;  3RM4 A;  4DZ2 A;  5DIV A;  1NWR A;  3NRK A;  1E15 A;  2AWG A;  1D6O A;  4W9Q A;  3KAC A;  2PN0 A;  4N19 A;  4Z2H A;  2YBT A;  3ARU A;  1OGB A;  1LJY A;  4DRM A;  2P4V A;  2LJ4 A;  3O5J A;  3CZ8 A;  4IT6 A;  4MGV A;  4JYS A;  2DG3 A;  4ZPT R;  1FKJ A;  3QOK A;  1VF8 A;  3NTP A;  4TX0 A;  3ARY A;  1FKF A;  3ARQ A;  4ZPW R;  4U84 A;  4U86 A;  1FKT A;  4J4O A;  4C02 B;  1FAP A;  3IKG A;  4DRK A;  3KCE A;  1EYM A;  2EUL A;  3B7X A;  3RM9 A;  4Z2J A;  1E6N A;  2OLH A;  3TC5 A;  4WKA A;  2ZR6 A;  2XP3 A;  4QT3 A;  1X6N A;  4HAR A;  2DT2 A;  5GQB A;  1GPF A;  1Q6I A;  2Q5A A;  2PPP A;  4MTV A;  4Q22 A;  3ARO A;  1YAT A;  4JFM A;  1FFQ A;  2KI3 A;  1HKM A;  4ITZ A;  2K8I A;  3O5F A;  1FKL A;  3WL0 A;  1WB0 A;  4ML4 A;  3ARS A;  2KE0 A;  1ZK6 A;  1WNO A;  1JNS A;  2LGO A;  3ARW A;  1T11 A;  2ZQU A;  3AS2 A;  3O5D A;  5DF0 A;  2XP6 A;  3PRB A;  1GUV A;  1NWS A;  1FKR A;  3CHF A;  3WKZ A;  1QPL A;  2DT0 A;  4DWS B;  5HWB A;  1EQ3 A;  1QZ2 A;  5GPR A;  4QZV B;  3CHC A;  4P8V A;  2PV1 A;  3CHD A;  3UF8 A;  1FKS A;  3B8S A;  2JZV A;  1L1P A;  1D7J A;  1OWQ A;  1XHG A;  3WD3 A;  3O5G A;  5DIU A;  2F4E A;  4JFI A;  5B8I C;  2MLZ A;  2XP4 A;  5HKG A;  4DWS D;  1U79 A;  4GIV A;  3GTY X;  2PPO A;  4TW8 A;  1E6P A;  3RFW A;  4L72 B;  1B6C A;  3TCZ A;  1LG1 A;  2D9F A;  4DRN A;  3UQB A;  2M08 A;  4W5U A;  1TFV A;  1JND A;  3JYJ A;  4ODQ A;  4JFJ A;  2XP7 A;  1X6L A;  3BXW A;  4LAX A;  4JFK A;  1D7H A;  3O5I A;  3UI5 A;  1W1Y A;  3KAH A;  4MNK A;  3H9R B;  1NWT A;  4MNJ A;  4QT2 A;  4TW6 A;  4DRP A;  1NMW A;  1XRV A;  5HTG A;  2DT1 A;  5GPG A;  4JFL A;  1KFW A;  2O92 A;  1ITX A;  2KFW A;  3ARX A;  2VN1 A;  1LL7 A;  4G50 A;  4IPX A;  2FDM A;  4DRO A;  1EIB A;  1PIN A;  3IK8 A;  2O9O A;  3KZ7 A;  3EIP A;  1W9P A;  1CTN A;  4ODR A;  1RD6 A;  1FKH A;  3CHE A;  3RGC A;  1JVW A;  5J6E A;  2F21 A;  4WKF A;  2ZR5 A;  4URI A;  4MSP A;  4P8W A;  4WJX A;  3ARR A;  3KAG A;  1D2K A;  1E9L A;  3B9E A;  4LAY A;  5HW8 A;  3PR9 A;  1Q1C A;  2PI6 A;  1NSG A;  5D75 A;  2IUZ A;  3O5K A;  4ODK A;  4FN2 A;  2B5U B;  2YBU A;  2ESC A;  2WK2 A;  2L2S A;  3O5L A;  1NMV A;  1E6Z A;  4ODN A;  3O5M A;  4GGQ A;  4ODL A;  1FKB A;  1JNT A;  4TYO A;  4DRI A;  1R9H A;  1GRJ A;  4ODP A;  4AY1 A;  5I98 A;  4Z2L A;  2ZR4 A;  3UI4 A; 
#chains in the Genus database with same CATH homology
 1NWU A;  1BKF A;  3B9A A;  3FAP A;  3RME A;  1FFR A;  5HUA A;  1M5Y A;  1KT1 A;  3WD4 A;  5HT1 A;  2ZQV A;  1J6Y A;  1LQ0 A;  2FAP A;  1EHN A;  4IT4 A;  2MPH A;  4Z2I A;  4MAV A;  5DIT A;  1W1V A;  1LL4 A;  1J4R A;  2MF9 A;  1O6I A;  2A3B A;  1ZBC A;  1H0I A;  1LG2 A;  1Q6H A;  1H0G A;  3O5Q A;  1FKG A;  1J4I A;  3WL1 A;  1NH6 A;  3FXY A;  4ZPV R;  1ZBW A;  2FKE A;  3UQI A;  3ARV A;  4G2P A;  2XPB A;  2IF4 A;  4XAK A;  2MNT A;  4O2T A;  4MNM A;  4ZS6 A;  3W4R A;  3GPK A;  2DPE A;  3WQW A;  5BXJ A;  2WLY A;  2XPA A;  2DSU A;  3O5R A;  2DSV A;  1TCO C;  3LUO A;  2VCD A;  5HBF A;  4DRJ A;  1ZBK A;  4Z2K A;  3AS3 A;  2F2D A;  4HBE A;  2RUR A;  1QPF A;  1OGG A;  2KO7 A;  4QIB A;  2XP9 A;  2G41 A;  4ODO A;  4TW7 A;  4IQ2 A;  2DG4 A;  4DH0 A;  1HKJ A;  4S3K A;  3WD2 A;  2B31 A;  1F40 A;  4NSB A;  2ZQS A;  3WQV A;  2ITK A;  4U85 A;  3ARZ A;  3ARP A;  2XP5 A;  1FKD A;  3VAW A;  1ZL1 A;  3KAF A;  1Y0O A;  2PV2 A;  4Z2G A;  3MDY B;  4R0X A;  2PV3 A;  2KR7 A;  3AS0 A;  3OOB A;  4PTM A;  3WH0 A;  3EY6 A;  4Q7N A;  4BF8 A;  3PRA A;  1SYT A;  1W9U A;  2ZQT A;  1KT0 A;  2A3A A;  5HW7 A;  3KAB A;  3G6M A;  4NZC A;  2N87 A;  2PPN A;  5DEZ A;  1K9T A;  4J4N A;  3TDB A;  1P5Q A;  5HWC A;  1GOI A;  1HJW A;  1J4H A;  4R5E A;  2UZ5 A;  2M1I A;  1HKK A;  2PBC A;  3O5E A;  3ALG A;  4MNL A;  1Q6U A;  4IQC A;  4DRH A;  2RQS A;  1IX5 A;  1FKI A;  1UR8 A;  2MLX A;  3AS1 A;  5DO2 A;  3O5O A;  4MPK A;  4DZ3 A;  3O5P A;  4WIW A;  1ROU A;  4WKH A;  1W26 A;  3JXV A;  1FD9 A;  4FAP A;  3G6L A;  3NI6 A;  1D7I A;  1LL6 A;  2DSW A;  2M2A A;  1W1T A;  1ROT A;  4WK9 A;  3WIJ A;  3WD1 A;  5HW6 A;  1EDQ A;  3IKD A;  3PRD A;  1PBK A;  3CH9 A;  4KR0 B;  1HJV A;  1N1A A;  4S3J A;  3IHZ A;  3ART A;  1E6R A;  3UQA A;  2A3E A;  2QF8 A;  4HBO A;  1YW5 A;  2WLZ A;  4DIP A;  1BL4 A;  2WM0 A;  1HKI A;  2RUD A;  2Y78 A;  3CGN A;  4P8U A;  3I6C A;  4DRQ A;  3CGM A;  4DWS A;  2A3C A;  1UR9 A;  2OFN A;  1F8A B;  1W1P A;  3KAD A;  3WD0 A;  2DT3 A;  4KQZ A;  1HXV A;  4LAW A;  1ZU8 A;  4TNS A;  1A7X A;  3KAI A;  1FKK A;  4L3N A;  1ZB5 A;  4DWS C;  1SR0 A;  3UI6 A;  3FY1 A;  1JNE A;  1HJX A;  2RUC A;  2DSZ A;  4LGX A;  1WAW A;  4DT4 A;  2RSE A;  3AQU A;  4P8X A;  3OA5 A;  1ZBV A;  2LPV A;  2KGJ A;  4W9P A;  4NNR A;  1W9V A;  3RM8 A;  1ZCN A;  3ODK A;  3JYM A;  2RUQ A;  3PA7 A;  2LKN A;  2XP8 A;  4ODM A;  4W9O A;  2AOS A;  2DG9 A;  2MLY A;  1C9H A;  1FJD A;  2G8Z A;  3B9D A;  5JH8 A;  4LAV A;  3ALF A;  3RM4 A;  4DZ2 A;  5DIV A;  1NWR A;  3NRK A;  1E15 A;  2AWG A;  1D6O A;  4W9Q A;  3KAC A;  4N19 A;  4Z2H A;  2YBT A;  3ARU A;  1OGB A;  1LJY A;  4DRM A;  2LJ4 A;  3O5J A;  3CZ8 A;  4IT6 A;  4MGV A;  4JYS A;  2DG3 A;  4ZPT R;  1FKJ A;  3QOK A;  1VF8 A;  3NTP A;  4TX0 A;  3ARY A;  1FKF A;  3ARQ A;  4ZPW R;  4U84 A;  4U86 A;  1FKT A;  4J4O A;  4C02 B;  1FAP A;  3IKG A;  4DRK A;  3KCE A;  1EYM A;  3B7X A;  3RM9 A;  4Z2J A;  1E6N A;  2OLH A;  3TC5 A;  4WKA A;  2ZR6 A;  2XP3 A;  4QT3 A;  1X6N A;  4HAR A;  2DT2 A;  5GQB A;  1GPF A;  1Q6I A;  2Q5A A;  2PPP A;  4MTV A;  4Q22 A;  3ARO A;  1YAT A;  4JFM A;  1FFQ A;  2KI3 A;  4ITZ A;  1HKM A;  2K8I A;  3O5F A;  1FKL A;  3WL0 A;  1WB0 A;  4ML4 A;  3ARS A;  2KE0 A;  1ZK6 A;  1WNO A;  1JNS A;  2LGO A;  3ARW A;  1T11 A;  2ZQU A;  3AS2 A;  3O5D A;  5DF0 A;  2XP6 A;  3PRB A;  1GUV A;  1NWS A;  1FKR A;  3CHF A;  3WKZ A;  1QPL A;  2DT0 A;  4DWS B;  5HWB A;  1EQ3 A;  1QZ2 A;  5GPR A;  4QZV B;  3CHC A;  4P8V A;  2PV1 A;  3CHD A;  3UF8 A;  1FKS A;  3B8S A;  2JZV A;  1L1P A;  1D7J A;  1OWQ A;  1XHG A;  3WD3 A;  3O5G A;  5DIU A;  2F4E A;  4JFI A;  5B8I C;  2MLZ A;  2XP4 A;  5HKG A;  4DWS D;  1U79 A;  4GIV A;  2PPO A;  4TW8 A;  1E6P A;  3RFW A;  4L72 B;  1B6C A;  3TCZ A;  1LG1 A;  2D9F A;  4DRN A;  3UQB A;  2M08 A;  4W5U A;  1TFV A;  1JND A;  3JYJ A;  4ODQ A;  4JFJ A;  2XP7 A;  1X6L A;  3BXW A;  4LAX A;  4JFK A;  1D7H A;  3O5I A;  3UI5 A;  1W1Y A;  3KAH A;  4MNK A;  3H9R B;  1NWT A;  4MNJ A;  4QT2 A;  4TW6 A;  4DRP A;  1NMW A;  1XRV A;  5HTG A;  2DT1 A;  5GPG A;  4JFL A;  1KFW A;  2O92 A;  1ITX A;  2KFW A;  3ARX A;  2VN1 A;  1LL7 A;  4G50 A;  4IPX A;  2FDM A;  4DRO A;  1EIB A;  1PIN A;  3IK8 A;  2O9O A;  3KZ7 A;  1W9P A;  1CTN A;  4ODR A;  1RD6 A;  1FKH A;  3CHE A;  3RGC A;  1JVW A;  5J6E A;  2F21 A;  4WKF A;  2ZR5 A;  4URI A;  4MSP A;  4P8W A;  4WJX A;  3ARR A;  3KAG A;  1D2K A;  1E9L A;  3B9E A;  4LAY A;  5HW8 A;  3PR9 A;  1Q1C A;  2PI6 A;  1NSG A;  5D75 A;  2IUZ A;  3O5K A;  4ODK A;  4FN2 A;  2YBU A;  2ESC A;  2WK2 A;  2L2S A;  3O5L A;  1NMV A;  1E6Z A;  4ODN A;  3O5M A;  4GGQ A;  4ODL A;  1FKB A;  1JNT A;  4TYO A;  4DRI A;  1R9H A;  4ODP A;  4AY1 A;  5I98 A;  4Z2L A;  2ZR4 A;  3UI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...