1B6CA

Crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cytoplasmic domain of the type I TGF beta receptor in complex with FKBP12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (isomerase/protein kinase)
molecule keywords FK506-BINDING PROTEIN
total genus 27
structure length 107
sequence length 107
chains with identical sequence C, E, G
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1b6cA00
1YW5A 1FKDA 2KE0A 4ODKA 3RFWA 4U85A 1J6YA 1FKKA 3IHZA 2PPNA 2AWGA 1R9HA 2XP8A 2IF4A 5BXJA 3PA7A 4W9OA 4DRNA 1FD9A 3O5GA 2RUDA 3OOBA 3B7XA 2KGJA 1NMVA 2VN1A 3MDYB 4DZ2A 5HUAA 1P5QA 3UQAA 2ZR6A 2RURA 2XP3A 4DRJA 2UZ5A 4LAVA 4TW8A 1FKFA 4LAXA 4W9PA 5HW7A 1D7JA 4ITZA 4MGVA 1T11A 4DRHA 1JNSA 3O5FA 1FKGA 4TX0A 3KAIA 3O5PA 1U79A 5HTGA 2RUQA 2ZR5A 2MLZA 4ODOA 3KABA 4ODQA 2LPVA 2LGOA 1D7HA 2XPAA 1J4HA 1JVWA 1EYMA 1Q6UA 3KCEA 3I6CA 3NI6A 4JFIA 3UF8A 1C9HA 2FKEA 1BL4A 1QZ2A 4GGQA 5DIVA 2XP6A 2MF9A 2VCDA 1PBKA 1EQ3A 2PV3A 5HT1A 2MLXA 1W26A 4DRIA 4QIBA 2LJ4A 3CGMA 5DITA 3JXVA 3O5LA 4MSPA 3KAHA 2XP5A 3UQIA 3PRDA 3O5EA 2Q5AA 1Q1CA 3UQBA 2KR7A 2XP9A 1M5YA 4DIPA 2DG4A 4J4OA 4NNRA 2ZQTA 2Y78A 1FKIA 4C02B 2F4EA 2KFWA 4JFLA 4DZ3A 2M08A 1Y0OA 2LKNA 3H9RB 1JNTA 2PV1A 4QT3A 2FAPA 4LAYA 2K8IA 1L1PA 2JZVA 2M2AA 3KACA 4GIVA 2F21A 4JFJA 4U84A 2MNTA 5DIUA 1B6CA 2KI3A 1Q6HA 2RUCA 4IQ2A 4ODPA 1QPLA 3VAWA 4U86A 4QT2A 1PINA 3GPKA 4TW7A 1A7XA 5GPGA 2ZQUA 3FAPA 4ODLA 2PPOA 4DRQA 4FAPA 1J4IA 4IQCA 3O5IA 2KO7A 1ROTA 5HKGA 4O2TA 3KZ7A 4TNSA 5HW6A 1Q6IA 2ITKA 2RSEA 4FN2A 3NRKA 3UI5A 4G50A 3UI6A 3WH0A 3JYJA 1FKBA 4N19A 4DRKA 5I98A 1QPFA 4G2PA 3JYMA 1FKRA 4DT4A 4JFMA 4DRPA 2PV2A 3IK8A 3KAFA 1D6OA 1FKSA 2PBCA 1ZCNA 4JYSA 2L2SA 4J4NA 5HWCA 1FKJA 2ZR4A 3LUOA 2XPBA 4W9QA 3UI4A 1FKHA 1FKTA 5B8IC 3O5KA 2XP4A 4R0XA 4DROA 3NTPA 3IKDA 3KADA 2PPPA 1N1AA 3TC5A 1J4RA 2M1IA 4DH0A 4ODNA 2OFNA 2MLYA 1YATA 4ODMA 2D9FA 1FAPA 3O5JA 2DG3A 2MPHA 3PRBA 3KAGA 3ODKA 4LAWA 5J6EA 3CGNA 4ODRA 3O5DA 2ZQSA 4JFKA 1HXVA 2F2DA 5HW8A 2DG9A 4TYOA 1FJDA 5HWBA 1NSGA 3O5OA 4IPXA 1F40A 1ROUA 2XP7A 3O5RA 1KT1A 1KT0A 1F8AB 1ZK6A 3EY6A 3IKGA 1BKFA 1NMWA 2ZQVA 3O5MA 5D75A 1FKLA 1D7IA 4TW6A 1TCOC 2RQSA 3O5QA 3RGCA 3TCZA 4BF8A 3TDBA 4DRMA 2N87A
chains in the Genus database with same CATH superfamily
1YW5A 4U85A 1FKKA 2IF4A 3O5GA 1XRVA 3OOBA 1E9LA 4ML4A 2KGJA 3UQAA 2ZR6A 4LAVA 3PR9A 4DWSD 4ITZA 5HW7A 4MGVA 3ARUA 1JNSA 3O5PA 1H0GA 2PI6A 2MLZA 4ODQA 2LGOA 4W9PA 4JFIA 3I6CA 1WB0A 1HKJA 1E6ZA 2XP6A 2B31A 2VCDA 1E6NA 1EQ3A 2PV3A 5JH8A 2A3CA 2LJ4A 4MPKA 1ZBKA 3O5LA 3WD2A 2DT1A 2XP9A 4DIPA 4NNRA 2ZQTA 4C02B 4IT6A 3OA5A 2M08A 4DWSC 4QT3A 2PV1A 2EULA 1GUVA 4L72B 2FDMA 3CHEA 3GPKA 5GPGA 3ARWA 4R5EA 3FAPA 2PPOA 3RM8A 2KO7A 1ROTA 1GPFA 1O6IA 1Q6IA 2RSEA 3BXWA 1HKIA 5DEZA 3JYJA 1FKBA 3ARSA 3WH0A 1GOIA 4DWSB 1W1TA 1ITXA 4DT4A 4JFMA 4DRPA 1KFWA 2PV2A 3IK8A 2PBCA 4W5UA 4JYSA 3FXYA 4W9QA 3UI4A 1FKHA 1FKTA 1ZBWA 3WIJA 2DSVA 3IKDA 3TC5A 1N1AA 3CHCA 4ODNA 3WQVA 2D9FA 4Z2GA 1WNOA 5GQBA 4P8VA 3AS1A 4TYOA 1FJDA 1NH6A 3ARZA 1KT1A 1F8AB 5D75A 3TCZA 1D7IA 4P8XA 2RQSA 2P4VA 4WJXA 4NSBA 1R9HA 2XP8A 3B9AA 3B9EA 2YBTA 4W9OA 1LJYA 1FD9A 3ARXA 1LG2A 3W4RA 1E6PA 1JCHB 4DZ2A 2UZ5A 2A3BA 1FKFA 4LAXA 1NWUA 4Q7NA 1EHNA 3O5FA 1FKGA 1UR8A 5HTGA 2RUQA 2ZR5A 4KQZA 4Z2LA 3B9DA 3WQWA 1BL4A 4MNKA 4GGQA 3ARPA 5DIVA 1LL6A 1W9PA 2G41A 2MF9A 4LGXA 3WD3A 5HT1A 1CTNA 3FY1A 1W26A 4QIBA 5DITA 3JXVA 1TFVA 1ZL1A 3B8SA 1HKMA 4S3KA 3UQIA 1Q1CA 3AROA 1M5YA 4PTMA 4J4OA 1W1VA 1HJWA 1Y0OA 3H9RB 2K8IA 2G8ZA 3CHDA 3KACA 4JFJA 3WD0A 4WK9A 1ZBCA 5DIUA 1B6CA 2KI3A 1Q6HA 4IQ2A 3WD4A 4TW7A 1A7XA 1J4IA 5HKGA 1GRJA 3UI6A 3AS2A 4DRKA 4G2PA 3JYMA 1FKRA 4HARA 2DSWA 1D6OA 1JNEA 1FKSA 4J4NA 1RD6A 5HWCA 3LUOA 2XPBA 5B8IC 1FFQA 3GTYX 3O5KA 4DROA 2PPPA 2M1IA 4DH0A 1W9VA 2OFNA 2MLYA 1YATA 4ODMA 1IX5A 1OGBA 2DG3A 2MPHA 2WLYA 3BMBA 2QF8A 1NSGA 3O5OA 4IPXA 1ROUA 1E6RA 3O5RA 1W1YA 1ZK6A 3EY6A 3WD1A 3RGCA 4TW6A 1TCOC 2F23A 3G6MA 1HJVA 1FKDA 2KE0A 4ODKA 3IHZA 2PPNA 2AWGA 3RM9A 3PA7A 2RUDA 4XAKA 3B7XA 3MDYB 1NMVA 4P8WA 1P5QA 4DRJA 3WL0A 4DRHA 4MNLA 1WAWA 4TX0A 3KAIA 4HBOA 1U79A 5HBFA 4S3JA 5GPRA 3KCEA 3NI6A 1JVWA 3UF8A 4P8UA 1ZU8A 1C9HA 2FKEA 1EDQA 1HJXA 1UR9A 4DRIA 3CGMA 2PN0A 1W1PA 3KAHA 3UQBA 2DT3A 1LL7A 4ZPVR 3ARRA 3RM4A 2Y78A 1FKIA 1SR0A 2F4EA 2KFWA 2DT0A 2LKNA 2IUZA 1JNTA 2FAPA 2M2AA 4Z2IA 4ODPA 2WK2A 2O92A 3VAWA 4U86A 1XHGA 4QT2A 2ZQUA 3ARVA 4ODLA 1LQ0A 4FAPA 4IQCA 4O2TA 4KR0B 4WKHA 3KZ7A 4TNSA 1H0IA 4NZCA 4FN2A 3UI5A 1E15A 4G50A 2ETNA 1OGGA 1LL4A 3QOKA 2DSUA 2L2SA 4URIA 2XP4A 4R0XA 4DWSA 1J4RA 1FFRA 1ZBVA 1FAPA 3O5JA 3KAGA 4LAWA 5J6EA 3CGNA 1ZB5A 3CZ8A 1HXVA 2F2DA 3G6LA 5HWBA 2XP7A 3ALGA 1HKKA 1KT0A 1BKFA 2ZQVA 1D2KA 3PRAA 4DRMA 3O5QA 2O9OA 4Z2JA 2N87A 2YBUA 3RFWA 1VF8A 3ARTA 1J6YA 5BXJA 4DRNA 1NWRA 1OWQA 2VN1A 4HBEA 5HUAA 2RURA 2XP3A 1NWTA 4TW8A 1EIBA 1D7JA 4WKFA 1T11A 4L3NA 2DT2A 4ODOA 2AOSA 3KABA 4WKAA 3CHFA 2LPVA 2XPAA 1D7HA 1J4HA 1EYMA 1Q6UA 3ARYA 1QZ2A 1PBKA 4Q22A 2MLXA 4ZPWR 3WL1A 4QZVB 3ARQA 4MSPA 2B5UB 2XP5A 3PRDA 3O5EA 2Q5AA 4Z2KA 2KR7A 4MNMA 5DO2A 3CH9A 2DG4A 3AQUA 4JFLA 4DZ3A 1L1PA 4LAYA 2JZVA 4GIVA 4U84A 2F21A 2OLHA 1X6LA 2MNTA 4Z2HA 2RUCA 1QPLA 2DPEA 1PINA 4DRQA 2WM0A 4WIWA 3O5IA 2A3AA 5HW6A 2ITKA 4UDMA 3NRKA 2DSZA 4N19A 5I98A 1QPFA 4ZS6A 3KAFA 1SYTA 1ZCNA 4MTVA 1X6NA 4AY1A 2WLZA 1FKJA 2ZR4A 4MNJA 2A3EA 3WKZA 4MAVA 3NTPA 3KADA 1E44A 3GU0A 3AS3A 3AS0A 5DF0A 2ESCA 1W9UA 4IT4A 3PRBA 3ODKA 1JNDA 4ODRA 3O5DA 2ZQSA 4JFKA 5HW8A 2DG9A 1K9TA 1F40A 3EIPA 3ALFA 3IKGA 1NMWA 1LG1A 3O5MA 4ZPTR 1FKLA 4BF8A 1NWSA 3TDBA 3RMEA
chains in the Genus database with same CATH topology
1YW5A 4U85A 1FKKA 2IF4A 3O5GA 1XRVA 3OOBA 1E9LA 4ML4A 2KGJA 3UQAA 2ZR6A 4LAVA 3PR9A 4DWSD 4ITZA 5HW7A 4MGVA 3ARUA 1JNSA 3O5PA 1H0GA 2PI6A 2MLZA 4ODQA 2LGOA 4W9PA 4JFIA 3I6CA 1WB0A 1HKJA 1E6ZA 2XP6A 2B31A 2VCDA 1E6NA 1EQ3A 2PV3A 5JH8A 2A3CA 2LJ4A 4MPKA 1ZBKA 3O5LA 3WD2A 2DT1A 2XP9A 4DIPA 4NNRA 2ZQTA 4C02B 4IT6A 3OA5A 2M08A 4DWSC 4QT3A 2PV1A 1GUVA 4L72B 2FDMA 3CHEA 3GPKA 5GPGA 3ARWA 4R5EA 3FAPA 2PPOA 3RM8A 2KO7A 1ROTA 1GPFA 1O6IA 1Q6IA 2RSEA 3BXWA 1HKIA 5DEZA 3JYJA 1FKBA 3ARSA 3WH0A 1GOIA 4DWSB 1W1TA 1ITXA 4DT4A 4JFMA 4DRPA 1KFWA 2PV2A 3IK8A 2PBCA 4W5UA 4JYSA 3FXYA 4W9QA 3UI4A 1FKHA 1FKTA 1ZBWA 3WIJA 2DSVA 3IKDA 3TC5A 1N1AA 3CHCA 4ODNA 3WQVA 2D9FA 4Z2GA 1WNOA 5GQBA 4P8VA 3AS1A 4TYOA 1FJDA 1NH6A 3ARZA 1KT1A 1F8AB 5D75A 3TCZA 1D7IA 4P8XA 2RQSA 4WJXA 4NSBA 1R9HA 2XP8A 3B9AA 3B9EA 2YBTA 4W9OA 1LJYA 1FD9A 3ARXA 1LG2A 3W4RA 1E6PA 4DZ2A 2UZ5A 2A3BA 1FKFA 4LAXA 1NWUA 4Q7NA 1EHNA 3O5FA 1FKGA 1UR8A 5HTGA 2RUQA 2ZR5A 4KQZA 4Z2LA 3B9DA 3WQWA 1BL4A 4MNKA 4GGQA 3ARPA 5DIVA 1LL6A 1W9PA 2G41A 2MF9A 4LGXA 3WD3A 5HT1A 1CTNA 3FY1A 1W26A 4QIBA 5DITA 3JXVA 1TFVA 1ZL1A 3B8SA 1HKMA 4S3KA 3UQIA 1Q1CA 3AROA 1M5YA 4PTMA 4J4OA 1W1VA 1HJWA 1Y0OA 3H9RB 2K8IA 2G8ZA 3CHDA 3KACA 4JFJA 3WD0A 4WK9A 1ZBCA 5DIUA 1B6CA 2KI3A 1Q6HA 4IQ2A 3WD4A 4TW7A 1A7XA 1J4IA 5HKGA 3UI6A 3AS2A 4DRKA 4G2PA 3JYMA 1FKRA 4HARA 2DSWA 1D6OA 1JNEA 1FKSA 4J4NA 1RD6A 5HWCA 3LUOA 2XPBA 5B8IC 1FFQA 3O5KA 4DROA 2PPPA 2M1IA 4DH0A 1W9VA 2OFNA 2MLYA 1YATA 4ODMA 1IX5A 1OGBA 2DG3A 2MPHA 2WLYA 2QF8A 1NSGA 3O5OA 4IPXA 1ROUA 1E6RA 3O5RA 1W1YA 1ZK6A 3EY6A 3WD1A 3RGCA 4TW6A 1TCOC 3G6MA 1HJVA 1FKDA 2KE0A 4ODKA 3IHZA 2PPNA 2AWGA 3RM9A 3PA7A 2RUDA 4XAKA 3B7XA 3MDYB 1NMVA 4P8WA 1P5QA 4DRJA 3WL0A 4DRHA 4MNLA 1WAWA 4TX0A 3KAIA 4HBOA 1U79A 5HBFA 4S3JA 5GPRA 3KCEA 3NI6A 1JVWA 3UF8A 4P8UA 1ZU8A 1C9HA 2FKEA 1EDQA 1HJXA 1UR9A 4DRIA 3CGMA 1W1PA 3KAHA 3UQBA 2DT3A 1LL7A 4ZPVR 3ARRA 3RM4A 2Y78A 1FKIA 1SR0A 2F4EA 2KFWA 2DT0A 2LKNA 2IUZA 1JNTA 2FAPA 2M2AA 4Z2IA 4ODPA 2WK2A 2O92A 3VAWA 4U86A 1XHGA 4QT2A 2ZQUA 3ARVA 4ODLA 1LQ0A 4FAPA 4IQCA 4O2TA 4KR0B 4WKHA 3KZ7A 4TNSA 1H0IA 4NZCA 4FN2A 3UI5A 1E15A 4G50A 1OGGA 1LL4A 3QOKA 2DSUA 2L2SA 4URIA 2XP4A 4R0XA 4DWSA 1J4RA 1FFRA 1ZBVA 1FAPA 3O5JA 3KAGA 4LAWA 5J6EA 3CGNA 1ZB5A 3CZ8A 1HXVA 2F2DA 3G6LA 5HWBA 2XP7A 3ALGA 1HKKA 1KT0A 1BKFA 2ZQVA 1D2KA 3PRAA 4DRMA 3O5QA 2O9OA 4Z2JA 2N87A 2YBUA 3RFWA 1VF8A 3ARTA 1J6YA 5BXJA 4DRNA 1NWRA 1OWQA 2VN1A 4HBEA 5HUAA 2RURA 2XP3A 1NWTA 4TW8A 1EIBA 1D7JA 4WKFA 1T11A 4L3NA 2DT2A 4ODOA 2AOSA 3KABA 4WKAA 3CHFA 2LPVA 2XPAA 1D7HA 1J4HA 1EYMA 1Q6UA 3ARYA 1QZ2A 1PBKA 4Q22A 2MLXA 4ZPWR 3WL1A 4QZVB 3ARQA 4MSPA 2XP5A 3PRDA 3O5EA 2Q5AA 4Z2KA 2KR7A 4MNMA 5DO2A 3CH9A 2DG4A 3AQUA 4JFLA 4DZ3A 1L1PA 4LAYA 2JZVA 4GIVA 4U84A 2F21A 2OLHA 1X6LA 2MNTA 4Z2HA 2RUCA 1QPLA 2DPEA 1PINA 4DRQA 2WM0A 4WIWA 3O5IA 2A3AA 5HW6A 2ITKA 3NRKA 2DSZA 4N19A 5I98A 1QPFA 4ZS6A 3KAFA 1SYTA 1ZCNA 4MTVA 1X6NA 4AY1A 2WLZA 1FKJA 2ZR4A 4MNJA 2A3EA 3WKZA 4MAVA 3NTPA 3KADA 3AS3A 3AS0A 5DF0A 2ESCA 1W9UA 4IT4A 3PRBA 3ODKA 1JNDA 4ODRA 3O5DA 2ZQSA 4JFKA 5HW8A 2DG9A 1K9TA 1F40A 3ALFA 3IKGA 1NMWA 1LG1A 3O5MA 4ZPTR 1FKLA 4BF8A 1NWSA 3TDBA 3RMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW5 A;  1FKD A;  2KE0 A;  4ODK A;  3RFW A;  4U85 A;  1J6Y A;  1FKK A;  3IHZ A;  2PPN A;  2AWG A;  1R9H A;  2XP8 A;  2IF4 A;  5BXJ A;  3PA7 A;  4W9O A;  4DRN A;  1FD9 A;  3O5G A;  2RUD A;  3OOB A;  3B7X A;  2KGJ A;  1NMV A;  2VN1 A;  3MDY B;  4DZ2 A;  5HUA A;  1P5Q A;  3UQA A;  2ZR6 A;  2RUR A;  2XP3 A;  4DRJ A;  2UZ5 A;  4LAV A;  4TW8 A;  1FKF A;  4LAX A;  4W9P A;  5HW7 A;  1D7J A;  4ITZ A;  4MGV A;  1T11 A;  4DRH A;  1JNS A;  3O5F A;  1FKG A;  4TX0 A;  3KAI A;  3O5P A;  1U79 A;  5HTG A;  2RUQ A;  2ZR5 A;  2MLZ A;  4ODO A;  3KAB A;  4ODQ A;  2LPV A;  2LGO A;  1D7H A;  2XPA A;  1J4H A;  1JVW A;  1EYM A;  1Q6U A;  3KCE A;  3I6C A;  3NI6 A;  4JFI A;  3UF8 A;  1C9H A;  2FKE A;  1BL4 A;  1QZ2 A;  4GGQ A;  5DIV A;  2XP6 A;  2MF9 A;  2VCD A;  1PBK A;  1EQ3 A;  2PV3 A;  5HT1 A;  2MLX A;  1W26 A;  4DRI A;  4QIB A;  2LJ4 A;  3CGM A;  5DIT A;  3JXV A;  3O5L A;  4MSP A;  3KAH A;  2XP5 A;  3UQI A;  3PRD A;  3O5E A;  2Q5A A;  1Q1C A;  3UQB A;  2KR7 A;  2XP9 A;  1M5Y A;  4DIP A;  2DG4 A;  4J4O A;  4NNR A;  2ZQT A;  2Y78 A;  1FKI A;  4C02 B;  2F4E A;  2KFW A;  4JFL A;  4DZ3 A;  2M08 A;  1Y0O A;  2LKN A;  3H9R B;  1JNT A;  2PV1 A;  4QT3 A;  2FAP A;  4LAY A;  2K8I A;  1L1P A;  2JZV A;  2M2A A;  3KAC A;  4GIV A;  2F21 A;  4JFJ A;  4U84 A;  2MNT A;  5DIU A;  1B6C A;  2KI3 A;  1Q6H A;  2RUC A;  4IQ2 A;  4ODP A;  1QPL A;  3VAW A;  4U86 A;  4QT2 A;  1PIN A;  3GPK A;  4TW7 A;  1A7X A;  5GPG A;  2ZQU A;  3FAP A;  4ODL A;  2PPO A;  4DRQ A;  4FAP A;  1J4I A;  4IQC A;  3O5I A;  2KO7 A;  1ROT A;  5HKG A;  4O2T A;  3KZ7 A;  4TNS A;  5HW6 A;  1Q6I A;  2ITK A;  2RSE A;  4FN2 A;  3NRK A;  3UI5 A;  4G50 A;  3UI6 A;  3WH0 A;  3JYJ A;  1FKB A;  4N19 A;  4DRK A;  5I98 A;  1QPF A;  4G2P A;  3JYM A;  1FKR A;  4DT4 A;  4JFM A;  4DRP A;  2PV2 A;  3IK8 A;  3KAF A;  1D6O A;  1FKS A;  2PBC A;  1ZCN A;  4JYS A;  2L2S A;  4J4N A;  5HWC A;  1FKJ A;  2ZR4 A;  3LUO A;  2XPB A;  4W9Q A;  3UI4 A;  1FKH A;  1FKT A;  5B8I C;  3O5K A;  2XP4 A;  4R0X A;  4DRO A;  3NTP A;  3IKD A;  3KAD A;  2PPP A;  1N1A A;  3TC5 A;  1J4R A;  2M1I A;  4DH0 A;  4ODN A;  2OFN A;  2MLY A;  1YAT A;  4ODM A;  2D9F A;  1FAP A;  3O5J A;  2DG3 A;  2MPH A;  3PRB A;  3KAG A;  3ODK A;  4LAW A;  5J6E A;  3CGN A;  4ODR A;  3O5D A;  2ZQS A;  4JFK A;  1HXV A;  2F2D A;  5HW8 A;  2DG9 A;  4TYO A;  1FJD A;  5HWB A;  1NSG A;  3O5O A;  4IPX A;  1F40 A;  1ROU A;  2XP7 A;  3O5R A;  1KT1 A;  1KT0 A;  1F8A B;  1ZK6 A;  3EY6 A;  3IKG A;  1BKF A;  1NMW A;  2ZQV A;  3O5M A;  5D75 A;  1FKL A;  1D7I A;  4TW6 A;  1TCO C;  2RQS A;  3O5Q A;  3RGC A;  3TCZ A;  4BF8 A;  3TDB A;  4DRM A;  2N87 A; 
#chains in the Genus database with same CATH topology
 1YW5 A;  4U85 A;  1FKK A;  2IF4 A;  3O5G A;  1XRV A;  3OOB A;  1E9L A;  4ML4 A;  2KGJ A;  3UQA A;  2ZR6 A;  4LAV A;  3PR9 A;  4DWS D;  4ITZ A;  5HW7 A;  4MGV A;  3ARU A;  1JNS A;  3O5P A;  1H0G A;  2PI6 A;  2MLZ A;  4ODQ A;  2LGO A;  4W9P A;  4JFI A;  3I6C A;  1WB0 A;  1HKJ A;  1E6Z A;  2XP6 A;  2B31 A;  2VCD A;  1E6N A;  1EQ3 A;  2PV3 A;  5JH8 A;  2A3C A;  2LJ4 A;  4MPK A;  1ZBK A;  3O5L A;  3WD2 A;  2DT1 A;  2XP9 A;  4DIP A;  4NNR A;  2ZQT A;  4C02 B;  4IT6 A;  3OA5 A;  2M08 A;  4DWS C;  4QT3 A;  2PV1 A;  2EUL A;  1GUV A;  4L72 B;  2FDM A;  3CHE A;  3GPK A;  5GPG A;  3ARW A;  4R5E A;  3FAP A;  2PPO A;  3RM8 A;  2KO7 A;  1ROT A;  1GPF A;  1O6I A;  1Q6I A;  2RSE A;  3BXW A;  1HKI A;  5DEZ A;  3JYJ A;  1FKB A;  3ARS A;  3WH0 A;  1GOI A;  4DWS B;  1W1T A;  1ITX A;  4DT4 A;  4JFM A;  4DRP A;  1KFW A;  2PV2 A;  3IK8 A;  2PBC A;  4W5U A;  4JYS A;  3FXY A;  4W9Q A;  3UI4 A;  1FKH A;  1FKT A;  1ZBW A;  3WIJ A;  2DSV A;  3IKD A;  3TC5 A;  1N1A A;  3CHC A;  4ODN A;  3WQV A;  2D9F A;  4Z2G A;  1WNO A;  5GQB A;  4P8V A;  3AS1 A;  4TYO A;  1FJD A;  1NH6 A;  3ARZ A;  1KT1 A;  1F8A B;  5D75 A;  3TCZ A;  1D7I A;  4P8X A;  2RQS A;  2P4V A;  4WJX A;  4NSB A;  1R9H A;  2XP8 A;  3B9A A;  3B9E A;  2YBT A;  4W9O A;  1LJY A;  1FD9 A;  3ARX A;  1LG2 A;  3W4R A;  1E6P A;  1JCH B;  4DZ2 A;  2UZ5 A;  2A3B A;  1FKF A;  4LAX A;  1NWU A;  4Q7N A;  1EHN A;  3O5F A;  1FKG A;  1UR8 A;  5HTG A;  2RUQ A;  2ZR5 A;  4KQZ A;  4Z2L A;  3B9D A;  3WQW A;  1BL4 A;  4MNK A;  4GGQ A;  3ARP A;  5DIV A;  1LL6 A;  1W9P A;  2G41 A;  2MF9 A;  4LGX A;  3WD3 A;  5HT1 A;  1CTN A;  3FY1 A;  1W26 A;  4QIB A;  5DIT A;  3JXV A;  1TFV A;  1ZL1 A;  3B8S A;  1HKM A;  4S3K A;  3UQI A;  1Q1C A;  3ARO A;  1M5Y A;  4PTM A;  4J4O A;  1W1V A;  1HJW A;  1Y0O A;  3H9R B;  2K8I A;  2G8Z A;  3CHD A;  3KAC A;  4JFJ A;  3WD0 A;  4WK9 A;  1ZBC A;  5DIU A;  1B6C A;  2KI3 A;  1Q6H A;  4IQ2 A;  3WD4 A;  4TW7 A;  1A7X A;  1J4I A;  5HKG A;  1GRJ A;  3UI6 A;  3AS2 A;  4DRK A;  4G2P A;  3JYM A;  1FKR A;  4HAR A;  2DSW A;  1D6O A;  1JNE A;  1FKS A;  4J4N A;  1RD6 A;  5HWC A;  3LUO A;  2XPB A;  5B8I C;  1FFQ A;  3GTY X;  3O5K A;  4DRO A;  2PPP A;  2M1I A;  4DH0 A;  1W9V A;  2OFN A;  2MLY A;  1YAT A;  4ODM A;  1IX5 A;  1OGB A;  2DG3 A;  2MPH A;  2WLY A;  3BMB A;  2QF8 A;  1NSG A;  3O5O A;  4IPX A;  1ROU A;  1E6R A;  3O5R A;  1W1Y A;  1ZK6 A;  3EY6 A;  3WD1 A;  3RGC A;  4TW6 A;  1TCO C;  2F23 A;  3G6M A;  1HJV A;  1FKD A;  2KE0 A;  4ODK A;  3IHZ A;  2PPN A;  2AWG A;  3RM9 A;  3PA7 A;  2RUD A;  4XAK A;  3B7X A;  3MDY B;  1NMV A;  4P8W A;  1P5Q A;  4DRJ A;  3WL0 A;  4DRH A;  4MNL A;  1WAW A;  4TX0 A;  3KAI A;  4HBO A;  1U79 A;  5HBF A;  4S3J A;  5GPR A;  3KCE A;  3NI6 A;  1JVW A;  3UF8 A;  4P8U A;  1ZU8 A;  1C9H A;  2FKE A;  1EDQ A;  1HJX A;  1UR9 A;  4DRI A;  3CGM A;  2PN0 A;  1W1P A;  3KAH A;  3UQB A;  2DT3 A;  1LL7 A;  4ZPV R;  3ARR A;  3RM4 A;  2Y78 A;  1FKI A;  1SR0 A;  2F4E A;  2KFW A;  2DT0 A;  2LKN A;  2IUZ A;  1JNT A;  2FAP A;  2M2A A;  4Z2I A;  4ODP A;  2WK2 A;  2O92 A;  3VAW A;  4U86 A;  1XHG A;  4QT2 A;  2ZQU A;  3ARV A;  4ODL A;  1LQ0 A;  4FAP A;  4IQC A;  4O2T A;  4KR0 B;  4WKH A;  3KZ7 A;  4TNS A;  1H0I A;  4NZC A;  4FN2 A;  3UI5 A;  1E15 A;  4G50 A;  2ETN A;  1OGG A;  1LL4 A;  3QOK A;  2DSU A;  2L2S A;  4URI A;  2XP4 A;  4R0X A;  4DWS A;  1J4R A;  1FFR A;  1ZBV A;  1FAP A;  3O5J A;  3KAG A;  4LAW A;  5J6E A;  3CGN A;  1ZB5 A;  3CZ8 A;  1HXV A;  2F2D A;  3G6L A;  5HWB A;  2XP7 A;  3ALG A;  1HKK A;  1KT0 A;  1BKF A;  2ZQV A;  1D2K A;  3PRA A;  4DRM A;  3O5Q A;  2O9O A;  4Z2J A;  2N87 A;  2YBU A;  3RFW A;  1VF8 A;  3ART A;  1J6Y A;  5BXJ A;  4DRN A;  1NWR A;  1OWQ A;  2VN1 A;  4HBE A;  5HUA A;  2RUR A;  2XP3 A;  1NWT A;  4TW8 A;  1EIB A;  1D7J A;  4WKF A;  1T11 A;  4L3N A;  2DT2 A;  4ODO A;  2AOS A;  3KAB A;  4WKA A;  3CHF A;  2LPV A;  2XPA A;  1D7H A;  1J4H A;  1EYM A;  1Q6U A;  3ARY A;  1QZ2 A;  1PBK A;  4Q22 A;  2MLX A;  4ZPW R;  3WL1 A;  4QZV B;  3ARQ A;  4MSP A;  2B5U B;  2XP5 A;  3PRD A;  3O5E A;  2Q5A A;  4Z2K A;  2KR7 A;  4MNM A;  5DO2 A;  3CH9 A;  2DG4 A;  3AQU A;  4JFL A;  4DZ3 A;  1L1P A;  4LAY A;  2JZV A;  4GIV A;  4U84 A;  2F21 A;  2OLH A;  1X6L A;  2MNT A;  4Z2H A;  2RUC A;  1QPL A;  2DPE A;  1PIN A;  4DRQ A;  2WM0 A;  4WIW A;  3O5I A;  2A3A A;  5HW6 A;  2ITK A;  4UDM A;  3NRK A;  2DSZ A;  4N19 A;  5I98 A;  1QPF A;  4ZS6 A;  3KAF A;  1SYT A;  1ZCN A;  4MTV A;  1X6N A;  4AY1 A;  2WLZ A;  1FKJ A;  2ZR4 A;  4MNJ A;  2A3E A;  3WKZ A;  4MAV A;  3NTP A;  3KAD A;  1E44 A;  3GU0 A;  3AS3 A;  3AS0 A;  5DF0 A;  2ESC A;  1W9U A;  4IT4 A;  3PRB A;  3ODK A;  1JND A;  4ODR A;  3O5D A;  2ZQS A;  4JFK A;  5HW8 A;  2DG9 A;  1K9T A;  1F40 A;  3EIP A;  3ALF A;  3IKG A;  1NMW A;  1LG1 A;  3O5M A;  4ZPT R;  1FKL A;  4BF8 A;  1NWS A;  3TDB A;  3RME A; 
#chains in the Genus database with same CATH homology
 1YW5 A;  4U85 A;  1FKK A;  2IF4 A;  3O5G A;  1XRV A;  3OOB A;  1E9L A;  4ML4 A;  2KGJ A;  3UQA A;  2ZR6 A;  4LAV A;  3PR9 A;  4DWS D;  4ITZ A;  5HW7 A;  4MGV A;  3ARU A;  1JNS A;  3O5P A;  1H0G A;  2PI6 A;  2MLZ A;  4ODQ A;  2LGO A;  4W9P A;  4JFI A;  3I6C A;  1WB0 A;  1HKJ A;  1E6Z A;  2XP6 A;  2B31 A;  2VCD A;  1E6N A;  1EQ3 A;  2PV3 A;  5JH8 A;  2A3C A;  2LJ4 A;  4MPK A;  1ZBK A;  3O5L A;  3WD2 A;  2DT1 A;  2XP9 A;  4DIP A;  4NNR A;  2ZQT A;  4C02 B;  4IT6 A;  3OA5 A;  2M08 A;  4DWS C;  4QT3 A;  2PV1 A;  1GUV A;  4L72 B;  2FDM A;  3CHE A;  3GPK A;  5GPG A;  3ARW A;  4R5E A;  3FAP A;  2PPO A;  3RM8 A;  2KO7 A;  1ROT A;  1GPF A;  1O6I A;  1Q6I A;  2RSE A;  3BXW A;  1HKI A;  5DEZ A;  3JYJ A;  1FKB A;  3ARS A;  3WH0 A;  1GOI A;  4DWS B;  1W1T A;  1ITX A;  4DT4 A;  4JFM A;  4DRP A;  1KFW A;  2PV2 A;  3IK8 A;  2PBC A;  4W5U A;  4JYS A;  3FXY A;  4W9Q A;  3UI4 A;  1FKH A;  1FKT A;  1ZBW A;  3WIJ A;  2DSV A;  3IKD A;  3TC5 A;  1N1A A;  3CHC A;  4ODN A;  3WQV A;  2D9F A;  4Z2G A;  1WNO A;  5GQB A;  4P8V A;  3AS1 A;  4TYO A;  1FJD A;  1NH6 A;  3ARZ A;  1KT1 A;  1F8A B;  5D75 A;  3TCZ A;  1D7I A;  4P8X A;  2RQS A;  4WJX A;  4NSB A;  1R9H A;  2XP8 A;  3B9A A;  3B9E A;  2YBT A;  4W9O A;  1LJY A;  1FD9 A;  3ARX A;  1LG2 A;  3W4R A;  1E6P A;  4DZ2 A;  2UZ5 A;  2A3B A;  1FKF A;  4LAX A;  1NWU A;  4Q7N A;  1EHN A;  3O5F A;  1FKG A;  1UR8 A;  5HTG A;  2RUQ A;  2ZR5 A;  4KQZ A;  4Z2L A;  3B9D A;  3WQW A;  1BL4 A;  4MNK A;  4GGQ A;  3ARP A;  5DIV A;  1LL6 A;  1W9P A;  2G41 A;  2MF9 A;  4LGX A;  3WD3 A;  5HT1 A;  1CTN A;  3FY1 A;  1W26 A;  4QIB A;  5DIT A;  3JXV A;  1TFV A;  1ZL1 A;  3B8S A;  1HKM A;  4S3K A;  3UQI A;  1Q1C A;  3ARO A;  1M5Y A;  4PTM A;  4J4O A;  1W1V A;  1HJW A;  1Y0O A;  3H9R B;  2K8I A;  2G8Z A;  3CHD A;  3KAC A;  4JFJ A;  3WD0 A;  4WK9 A;  1ZBC A;  5DIU A;  1B6C A;  2KI3 A;  1Q6H A;  4IQ2 A;  3WD4 A;  4TW7 A;  1A7X A;  1J4I A;  5HKG A;  3UI6 A;  3AS2 A;  4DRK A;  4G2P A;  3JYM A;  1FKR A;  4HAR A;  2DSW A;  1D6O A;  1JNE A;  1FKS A;  4J4N A;  1RD6 A;  5HWC A;  3LUO A;  2XPB A;  5B8I C;  1FFQ A;  3O5K A;  4DRO A;  2PPP A;  2M1I A;  4DH0 A;  1W9V A;  2OFN A;  2MLY A;  1YAT A;  4ODM A;  1IX5 A;  1OGB A;  2DG3 A;  2MPH A;  2WLY A;  2QF8 A;  1NSG A;  3O5O A;  4IPX A;  1ROU A;  1E6R A;  3O5R A;  1W1Y A;  1ZK6 A;  3EY6 A;  3WD1 A;  3RGC A;  4TW6 A;  1TCO C;  3G6M A;  1HJV A;  1FKD A;  2KE0 A;  4ODK A;  3IHZ A;  2PPN A;  2AWG A;  3RM9 A;  3PA7 A;  2RUD A;  4XAK A;  3B7X A;  3MDY B;  1NMV A;  4P8W A;  1P5Q A;  4DRJ A;  3WL0 A;  4DRH A;  4MNL A;  1WAW A;  4TX0 A;  3KAI A;  4HBO A;  1U79 A;  5HBF A;  4S3J A;  5GPR A;  3KCE A;  3NI6 A;  1JVW A;  3UF8 A;  4P8U A;  1ZU8 A;  1C9H A;  2FKE A;  1EDQ A;  1HJX A;  1UR9 A;  4DRI A;  3CGM A;  1W1P A;  3KAH A;  3UQB A;  2DT3 A;  1LL7 A;  4ZPV R;  3ARR A;  3RM4 A;  2Y78 A;  1FKI A;  1SR0 A;  2F4E A;  2KFW A;  2DT0 A;  2LKN A;  2IUZ A;  1JNT A;  2FAP A;  2M2A A;  4Z2I A;  4ODP A;  2WK2 A;  2O92 A;  3VAW A;  4U86 A;  1XHG A;  4QT2 A;  2ZQU A;  3ARV A;  4ODL A;  1LQ0 A;  4FAP A;  4IQC A;  4O2T A;  4KR0 B;  4WKH A;  3KZ7 A;  4TNS A;  1H0I A;  4NZC A;  4FN2 A;  3UI5 A;  1E15 A;  4G50 A;  1OGG A;  1LL4 A;  3QOK A;  2DSU A;  2L2S A;  4URI A;  2XP4 A;  4R0X A;  4DWS A;  1J4R A;  1FFR A;  1ZBV A;  1FAP A;  3O5J A;  3KAG A;  4LAW A;  5J6E A;  3CGN A;  1ZB5 A;  3CZ8 A;  1HXV A;  2F2D A;  3G6L A;  5HWB A;  2XP7 A;  3ALG A;  1HKK A;  1KT0 A;  1BKF A;  2ZQV A;  1D2K A;  3PRA A;  4DRM A;  3O5Q A;  2O9O A;  4Z2J A;  2N87 A;  2YBU A;  3RFW A;  1VF8 A;  3ART A;  1J6Y A;  5BXJ A;  4DRN A;  1NWR A;  1OWQ A;  2VN1 A;  4HBE A;  5HUA A;  2RUR A;  2XP3 A;  1NWT A;  4TW8 A;  1EIB A;  1D7J A;  4WKF A;  1T11 A;  4L3N A;  2DT2 A;  4ODO A;  2AOS A;  3KAB A;  4WKA A;  3CHF A;  2LPV A;  2XPA A;  1D7H A;  1J4H A;  1EYM A;  1Q6U A;  3ARY A;  1QZ2 A;  1PBK A;  4Q22 A;  2MLX A;  4ZPW R;  3WL1 A;  4QZV B;  3ARQ A;  4MSP A;  2XP5 A;  3PRD A;  3O5E A;  2Q5A A;  4Z2K A;  2KR7 A;  4MNM A;  5DO2 A;  3CH9 A;  2DG4 A;  3AQU A;  4JFL A;  4DZ3 A;  1L1P A;  4LAY A;  2JZV A;  4GIV A;  4U84 A;  2F21 A;  2OLH A;  1X6L A;  2MNT A;  4Z2H A;  2RUC A;  1QPL A;  2DPE A;  1PIN A;  4DRQ A;  2WM0 A;  4WIW A;  3O5I A;  2A3A A;  5HW6 A;  2ITK A;  3NRK A;  2DSZ A;  4N19 A;  5I98 A;  1QPF A;  4ZS6 A;  3KAF A;  1SYT A;  1ZCN A;  4MTV A;  1X6N A;  4AY1 A;  2WLZ A;  1FKJ A;  2ZR4 A;  4MNJ A;  2A3E A;  3WKZ A;  4MAV A;  3NTP A;  3KAD A;  3AS3 A;  3AS0 A;  5DF0 A;  2ESC A;  1W9U A;  4IT4 A;  3PRB A;  3ODK A;  1JND A;  4ODR A;  3O5D A;  2ZQS A;  4JFK A;  5HW8 A;  2DG9 A;  1K9T A;  1F40 A;  3ALF A;  3IKG A;  1NMW A;  1LG1 A;  3O5M A;  4ZPT R;  1FKL A;  4BF8 A;  1NWS A;  3TDB A;  3RME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...