1B6SA

Structure of n5-carboxyaminoimidazole ribonucleotide synthetase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
355
structure length
351
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of N5-carboxyaminoimidazole ribonucleotide synthetase: a member of the ATP grasp protein superfamily.
pubmed doi rcsb
molecule tags Lyase
molecule keywords PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE SYNTHETASE)
total genus 105
structure length 351
sequence length 355
chains with identical sequence B, C, D
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 1999-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1b6sA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1b6sA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b6sA01
1C30A 4GGMX 3R5HA 1KJQA 3AW8A 4O4LF 3MWDA 4M9CA 5CA0F 2XCLA 5BPHA 2I87A 3WO1A 2ZDGA 1CQJB 2NU8B 2GPSA 5JH7F 1GSHA 4EG0A 1VKZA 2P0AA 4J6EA 1T36A 4DIMA 1A48A 3R23A 3JZFA 3RFCA 5BPFA 3G8DA 2YS7A 3HO8A 5FNVF 3RUPA 2W70A 1CS0A 4I50F 1E4EA 3E5NA 2QF7A 3N8DA 5HV6A 2FB9A 4MV1A 3DF7A 3ORRA 2NU7B 4I4TF 4MA0A 1KBLA 1M0WA 2R85A 4FU0A 4MA5A 5C1PA 3WNZA 3RV3A 3UFXB 3SE7A 1OBDA 2YS6A 5LXTF 4HQ6A 2R7KA 2YW2A 3RV4A 4TUYF 3BFPA 3ETHA 2DZDA 1GGOA 3WO0A 5I47A 1B6RA 4M99A 2YL2A 5HBRB 3MJFA 4IWXA 2C00A 4FFNA 2R87A 1BNCA 1KC7A 1ULZA 4O81A 1KJ9A 4WD3A 4MV6A 4YAKB 3LP8A 3BSSA 1KJJA 2PN1A 5LA6F 2FPIB 2YZMA 2VHEA 3BG5A 3V4ZA 2W6OA 4EGQA 3VPDA 1E4EB 4FFPA 4YJ2F 2DWCA 1AUXA 2YZGA 2I80A 2R7MA 4C5AA 3TINA 2R84A 3OUUA 3HBLA 4O4IF 1EZ1A 4IIJF 3K5HA 4YAJB 1WR2A 2YZNA 1EUCB 2CNVA 4O4JF 4YB8B 4ZQIA 1PX2A 4C5BA 4O2BF 4O7RA 4EABA 4XYLB 3JZIA 4O7NA 2W6QA 4IWYA 3K5IA 2GQRA 4EGJA 1JLLB 1JKJB 1PK8A 1GLVA 3NUAA 4XX0B 5KKNB 2W6MA 2W6PA 1VBGA 4HNVA 4ZI7F 1IOWA 2Z04A 2YWVA 4MV8A 3HB9A 5LP6F 2FPGB 1DIKA 1W93A 4I55F 3KAKA 5DMXA 3JRWA 2PBZA 3QFFA 4C5CA 4HR7A 3ORQA 4O86A 1DV2A 1BXRA 4FFLA 4NYEA 4EA8A 3U9TA 2NU6B 1KJIA 2YRXA 3TQTA 2WYOA 3KALA 3N6RA 3VA7A 2OLSA 2CZGA 5D8DA 4EA9A 4QSHA 5GONF 5LYJF 1CQIB 1VBHA 3BSYA 4FE2A 5JVLA 4TV8F 1AUVA 3U54A 2NUAB 5K2MA 5LOVF 1GSOA 4O2AF 2R7NA 3VPBA 4O7YA 5J2UF 2CNUA 4O7SA 3GIDA 1KJ8A 4MAMA 3JRXA 2GPWA 3U55A 1IOVA 2HJWA 5IYZF 1EHIA 3VOTA 2ZDQA 2NPOA 2GLTA 2IP4A 2YYAA 3OUZA 2YRWA 4ME6A 3TW6A 1Z2OX 4ZOLF 2I8CA 1GSAA 2FP4B 3LWBA 1JDBB 4MV3A 3R5XA 4O7TA 4M9UA 5BMVF 4O7ZA 3K3PA 3R9RA 3VPCA 1CE8A 2XD4A 1KEEA 4FFOA 4L1KA 2R6FA 1UC8A 2DLNA 2W6NA 2YZLA 2VR1A 3AX6A 5JVDF 5H80A 3VMMA 4FFMA 4E4TA 2HGSA 4O7VA 5C1OA 1Z2PX 1SCUB 3U9SA 4O7LA 4ZHQF 3R5FA 1I7LA 2CQYA 4WBNF 3G8CA 4O84A 2NU9B 1DV1A 2V58A 2V59A 2VPQA 4O4HF 5CB4F 1Z2NX 1B6SA 5J2TF 3TIGA 4HNTA 2QK4A 1I7NA 4M98A 4FGRA 5KX5F 5JQWA 4XYMB 3KAJA 5CAEB 2ZDHA 4MV4A 2PVPA 2SCUB 2W71A 5C8YF 4EA7A 2Z02A 4EAAA 2DIKA 3ETJA 2CNQA 5EZYF 3BSWA 2W6ZA 3MWEA 1EUDB 4DLKA 5CA1F 1M6VA 2R86A 1A9XA 2X0SA 4IZOA 2J9GA 1EYZA 3GLKA 4XZ3B 4O83A 3TIIA 1UC9A 4O7WA 1OBGA 3Q1KA 2R82A 4O82A 3KREA 4MV7A 2R7LA 2VQDA 3Q2OA 2V5AA 2GQSA 4RZQA 1JDEA 1M0TA 3V4SA 5JQGF 4IHJF 4YJ3F 4Y8VB 1C3OA 4TV9F 4MV9A 4YBZB 4FFRA 1KUTA 2FPPB 4HNUA 3I12A 1W96A
chains in the Genus database with same CATH superfamily
1JA1A 1M2KA 1V8DA 3QMVA 4GGMX 5AVRA 3OCYA 5HZMA 4G0UA 3WJAA 1XZNA 3OCJA 1SG0A 2QZSA 2AJDA 2D3WA 1KSHA 3DHWC 5HJEA 2CC2A 4WN9A 3KNZA 5FQOA 1XMQH 2EFCB 2CVOA 3WGYA 3J7TA 4QICA 2JIQA 5KQLA 3GIKA 4KOAA 3I4LA 2P2ZA 3I01M 2QTNA 2OXRA 3BMCA 4ZCQA 3R8CA 1BS9A 1LGYA 5J2TB 3FKSD 1D7OA 4U7CA 3CEMA 3LFUA 4B1FA 3A04A 2XB6A 2DBYA 1ZQ1A 2B98A 1P3DA 2WDPA 4L8GA 1HYEA 5IC4A 3H6HA 2PMBA 3OT4A 2JGMA 2PQ2A 5E8JA 5L51A 5IASA 2JCYA 4N4AA 5K0GA 4ARCA 2G1PA 3UOWA 2O59A 2IELA 1FXWA 2FZEA 2DVMA 2FH5B 5K01A 2PX5A 4JKIA 4HKTA 4NH0A 3G2HA 4ADSG 3ESAA 2GYUA 1L7MA 3TEKA 3CH5A 1LBEA 2W70A 2JATA 3EUWA 3PPIA 4G0VA 4J3JA 2F9MA 3Q8KA 4BO1A 1UMDA 1J0DA 3AUXA 5B1SA 3GK3A 2JFYA 1X19A 3GZTB 3NWOA 3NXKA 5ICMA 1BVUA 1ZOLA 1RC8A 4GL2A 2GTPA 1JG3A 2H17A 1RBYA 2Q6KA 3NEJA 3ZIDA 2N1BA 2R4TA 3AF1A 4N8EA 4NS1A 3L1HA 2ZSJA 1PQWA 3DAHA 2WSSD 3ZHBA 2QTHA 2X58A 4J7AA 4B4DA 1FNSA 2CL7X 1JYSA 2NN3C 5BR4A 1HMYA 2Z4TA 5CDTA 3QX8A 1ZC3A 4HLUA 4B8YA 5LLTA 3D64A 1KAQA 1MD9A 1OBDA 2WTNA 1BA2A 4JK3A 5LFAA 2Z43A 4AKEA 2IHJA 3O83A 4K8RB 1H1LA 2W43A 3V5NA 2R1TA 5AXAA 2XE4A 2YYZA 4F71A 3L7OA 2HVRA 2IZ5A 2GTIA 3UF0A 2H1HA 5AI8A 1OXMA 4EF4A 4ZVVA 3NI2A 1Y8AA 4H7HA 4QE3A 1UT5A 4BXXG 3KYDA 1FVXA 3J81k 1W4LA 1Z4NA 3GLFA 3V33A 1K2VN 1IYZA 1L7DA 1KU0A 5ECYA 1H2XA 2RHHA 2WD8A 2EP7A 3P0FA 4IX9A 4OGGA 5BO5A 1ZZEA 1EKFA 2GN6A 3W9UA 2X40A 1F4VA 1NPYA 16PKA 2QTVB 1JHMA 1LJLA 3HUFA 1IWOA 2Y92A 4NU6A 4ER0A 2HSDA 3P9SA 1C0IA 3OU7A 2ZYHA 5BNWA 4YCBA 5GOTA 3EVZA 1DZIA 5JADA 2ZT5A 5AW2A 1HOTA 1ABBA 4IGEA 1IPHA 2P9GA 2Q2QA 4JIMA 3CEHA 3S2GA 1ZVJA 3VYWA 1EWRA 3FLAA 1F48A 4V0LA 3U7GA 1YCGA 2OHFA 4Q02A 2BJHA 3E70C 2E21A 1O03A 3GLIA 1W73A 2KMLA 5E4FA 2IV2X 3K1AB 4F9GA 2ENUA 3U61B 2GNOA 1DRUA 2NZ2A 2OV1A 3U6BA 3W5SA 3X3HA 1GHTA 5GY7A 4YLYA 1M7JA 1RYZA 4QO8A 4J2OA 4HQRA 3EWSA 1V9SA 4E6NA 1G3RA 4LMPA 1CNEA 3SFTA 4B3SB 3DL4A 5KS2A 5KFKA 3L8MA 4PZ9A 4NCHA 1Z2CA 2NNLD 3EZXA 3MJ4A 3ZYCA 4POOA 5AUNB 1EVIA 4WZBE 2QUBA 4F1JA 4H6PA 2C4MA 1SKUA 3VAAA 3VKVA 4RPHA 3WISA 1I6UA 1RAGA 2GK6A 4MWEA 3S4YA 3WWJA 2BCJQ 3BVPA 4DHWA 3UQYS 5K03A 2PH1A 5BY2A 2CMHA 3T3MB 3RVOA 5LN1A 2HO5A 5CLJA 1DCTA 3NOXA 1E4EB 2VCEA 2ZTHA 2G70A 5HF9A 3ZY3A 2BGWA 3E9CA 1S9FA 4MUFA 3TSWA 4P2BA 3BWBA 3NBMA 5FADA 3GZNA 4PYOA 2WAMA 3H4BA 3HZZA 4MVJH 1JQ3A 1CKOA 1YRAA 2W8LA 4M8IA 1XK7A 5I4KA 1R2QA 1U2SA 3WMFA 4JU9A 3REOA 3KQHA 4EJ0A 2ZYGA 2AF3C 4MR8B 4BVGA 2R11A 3EF3A 3PUXA 3X2FA 3K0AA 1P39A 5LCXA 1JHVA 3BFJA 1EKPA 4I55B 2FWJA 3FI9A 1E3EA 4FM9A 1IBSA 4CKEA 1BMQA 1U5CA 1NNSA 1V1RB 1TUBB 1W47A 3QZ7A 1PNTA 2GA9A 3OM0A 5I7SA 1F6DA 1WR2A 1UPTA 2ATLA 2H9AA 1XVIA 4V3BA 1IBMH 1RBMA 4CMHA 1ZCAA 5AM4A 3JSNA 3DMYA 1B16A 3T12A 4GBJA 4RTOA 1N7IA 1S10A 5DTMA 3T95A 3P2MA 3ENZA 4N18A 3SHWA 3SXUA 2A59A 4EBFA 2ABWA 3WG9A 5JFGA 3JZIA 2OP1A 1TQDA 4R9UC 2GM4A 1UPXA 4BCDA 1G3MA 1O8BA 2PSDA 5HKKA 1QHIA 2OQRA 1JHRA 5I9SA 1SUIA 3AU9A 3NHFA 4IKEA 4E5MA 2JFHA 1U8EA 4LS3A 4ZVNA 2P7HA 3RRJA 1OI2A 3PDUA 5DHAA 1F4PA 3H84A 2PQ0A 3HY3A 3TL2A 4AQ7A 2L82A 4CLRB 4UNRA 1NPTO 2AB0A 1RPTA 2PQMA 2VAPA 1J8VA 1WXQA 2E4XA 4HOYA 4LSWA 4Q16A 1FMJA 4JJIA 1IDOA 4YB8A 2AOXA 3OG9A 1G5FA 3FUTA 2H18A 3H16A 1N0IA 2XT6A 3WLSA 2X6RA 4DA6A 3W8NA 4QWCA 1GTZA 1LK7A 2JA5A 2ROQA 2YDYA 2PH3A 1FX0B 4JB3A 3TEMA 2Y0SA 3ZTYA 4BZQA 4L5JA 4W8GA 1I1OA 3C3XA 4NPHA 3WHLA 4BCCA 3VH2A 3WGVA 4TS3A 1ESEA 3S2FA 4ZO9A 4Y2RA 4ID3A 1IN5A 1XVTA 1K3FA 5HZHA 1YRBA 2AG6A 2RB4A 4HGYA 5M2QA 3PZRA 1Z5VA 2F43A 3KQLA 1SVUA 3GJ0A 6REQA 5A7GA 4UZFA 2HV8A 4Q34A 2XDYA 1Q0PA 4MJXA 1O3YA 3FCXA 4LOIA 4OATA 2WE8A 5CT8A 1KI6B 1OXSC 2OVFA 5FF9A 3TRKA 5CDGA 1K88A 3O4HA 4BGUA 4FBTA 3O38A 2X3YA 2ZRGA 4RHEA 4AJNA 2Q4DA 3F2VA 3U48A 3UWOA 3P2EA 4G1EB 1I6WA 4WXRA 4URXR 6NULA 1J49A 4DV5H 1QO0A 2VDRB 1UKZA 4PF1A 3I09A 3S55A 1KH3A 1WDWB 3EXFA 3RF7A 2QD5A 4ZOAA 4MKFA 1IY0A 1DE0A 1PK7A 3LCUA 4RUAA 3RFVA 1CIPA 3ANLA 3W77A 3KJGA 2AN3A 2OCLA 1PRYA 1CULC 4LVNA 5TQ0A 4V3CA 4YCSA 1A77A 1S8NA 1E62A 3P0HA 4PYMA 4R7GA 4F0JA 3SM9A 2ZAMA 2C1ZA 4KREA 1B8VA 2Q45A 1Z56C 2EWWA 3DAFA 3RUHA 4JHLA 4Y9RA 1E9CA 4INAA 1SU4A 5JALA 2DUJA 1W4CA 1O4WA 2QX9A 2VZEA 1NP6A 1UWKA 4RPKA 5GAJA 4NEQA 4C9BA 4A3EG 3O8NA 1Y8ZA 1W29A 2BBTA 3HU2A 1R6XA 2OFFA 5KT4A 5C8ZA 1QCYA 3L8GA 1RKBA 1LNQA 2JHAA 2I9PA 3EH1A 3MCTA 4NPAA 4B45A 4Z7JA 3IEMA 1E2IA 1I24A 1LW6E 3IPLA 4UVIA 5DIZA 2IWHA 1TM7E 4BLSA 4Y6OA 3CIOA 1ZN9A 4D80A 1LLQA 1GN8A 3WLLA 1BMFD 5KYWB 4ZGBA 1TPYA 4ZJUA 1NYLA 1VIYA 2J7PA 4EYHB 2C2XA 1PK9A 2QRNA 3E8XA 3I92A 4Y7CA 4O7SA 3NC0B 1P33A 1PJSA 3U56A 5I8ZA 4IFIA 3Q9NA 5FLKA 3UANA 2YC2C 1Z6ZA 2B3TA 3HB5X 2UXCH 3GH1A 4EENA 4M76B 2JAUA 3RF6A 3CXUA 3QFCA 3GBPA 4GP9A 2PEZA 2VDQB 1BH6A 4HC4A 4F97A 1OXTA 3A4NA 2FLNA 1Q14A 5IK2A 1R00A 1MGPA 4OAPA 3T7JA 4JLPA 5C3MA 4WQMA 4AO7A 3X44A 4TTSA 4Q0YA 1G1AA 1WVIA 3HWX1 3ILXA 1QFSA 2GRJA 2PMDA 4O8CA 4DLLA 4YJFB 3PNPA 3VSCA 2OGWA 1IJEA 2COUA 1THMA 1W7AA 2YYAA 2YRWA 1Y5IA 2J7PD 2GLXA 1YUBA 5IAOA 1HE8B 3RSGA 1Q7CA 1XFDA 3IGFA 3GLHA 3ND5A 2ERXA 4HEHA 1QP4A 1GQOA 2CNLA 3BTVA 3WKCA 3PW2A 4RNCA 2IBTA 3KT8A 3GVCA 4Y1RB 3DAYA 2VXBA 5KTRA 4OI1A 4LKOA 3T5PA 1BGWA 1S0OA 3OIVA 4DCVA 3R5XA 4WOBA 5BNIA 1OVGA 1XJ5A 2SBTA 1IUPA 4FKZA 1Z06A 5BOSB 4YRNA 1UM9A 2SNIE 1VG0B 1YVRA 1GDDA 5M04A 1TQHA 1ZD4A 4LI3X 4D0GA 7ADHA 2MYPA 4Q9DA 4FFOA 2R6FA 5FJ8G 3OAAD 4KYTA 4D74A 3PA8A 2F2TA 3NM5A 5AVQA 2P3OA 3C5EA 1OWNA 5AVZA 3KVOA 4AQDA 4LJ4A 3BF8A 1NRIA 4BP8A 1EXNA 3N3BC 5AM5A 4MULA 4ZK2A 1L5RA 3LYAA 2JKZA 4WLEA 5L53A 3EGOA 3IERA 5HP4A 2IA6A 1YJXA 3KDAA 3BWXA 4JODA 3BHMA 4AZVA 2NU8A 4C78A 2P90A 2JGKA 5H80A 3C8ZA 3HWRA 4FFMA 3STTA 4UUNA 3SFVA 1A5SB 3NVMB 4QYIA 2JLSA 2YY5A 4AJPA 3DDWA 4I4LA 5JVDB 4WZBA 4C22A 1HO3A 3SP1A 4ER7A 4DR2B 4KR6A 1TT5A 4JIGA 1TEXA 1UOPA 1EQAA 3I28A 3K0AB 2X13A 4GMKA 1Y7IA 3SYRA 4IICA 1ZVMA 1HQCA 1KZ1A 2J3IA 4O4LB 1NI5A 4XQEA 3TTTA 4E5KA 4OIFA 4Q21A 3HKBB 3G8CA 3KKOA 1Q7BA 3JQPA 3GBVA 2OHHA 3K3VA 3OJOA 3PGVA 3NIWA 2F62A 2GHIA 3OWXA 3Q8MA 2FR0A 5I4CA 2ADOA 3OPQA 3R3UA 1V51A 3FVTA 2VPQA 2B63A 1XOIA 2F1RA 1V39A 3RSOA 2Q2OA 3HVJA 4HQKA 4DR7H 1J4AA 4CMGA 5MN4A 2VATA 1DBPA 2WJIA 3HACA 1P2TA 3U4IA 3TRDA 5KFFA 3JQ6A 3QE3A 1FSPA 2H1LA 4BDSA 1D4AA 4RL6A 4CMEA 1HL7A 2J9ZB 3BWDD 3KKPA 1N5OX 3SVTA 3O9MA 3WDMA 1AVTA 2JGFA 3K9HA 5AM3A 3KAJA 2ZJ3A 4TQGA 1ZGHA 1F0PA 2NVWA 3S29A 3H40A 2K2QB 3UUFA 3VR4D 4MRMA 5BXYA 1M54A 2XRFA 2XCTB 1TWGA 1VJRA 2OAEA 2SCUB 1HY3A 1K7EB 2OP0A 1JJIA 4L27A 4D3YA 4Y6PA 3A36A 2PJZA 2UVUA 3DZDA 4R2JA 4FYVA 3GI1A 4RV5A 5I6DA 1WJGA 2Y8EA 4QNNA 2ODWA 4FCWA 3ETJA 5LYJB 5KFSA 1DC5A 3PR4A 1AK2A 3SVLA 2GNAA 3UT5A 1KAHA 3ZGLA 1N9ZA 4I8XA 2ZSAA 4UE2A 4Y98A 5E6UA 1KMHB 2W6ZA 1OLXA 4P58A 4ECQA 2BFOA 4NE9A 3RRNA 5MFZA 1LH0A 3LZCA 1Q0TA 3T06B 4BMZA 1VDMA 4XGRA 3H2HA 2BM9A 4H60A 3ZNNA 4EY5A 4IJUA 5IJAA 4FS2A 3SM3A 4B4OA 3WK4A 2H57A 3QHQA 4A2PA 4J9KA 2D13A 4AMVA 3MBIA 4HD8A 4DJFC 5JSHA 1HLPA 2PRIA 5LZ4A 3NDPA 3V1LA 4J03A 4ECTA 1FDTA 1K9SA 3A1DA 3TIIA 4WY2A 4QJ4A 4P53A 1FNNA 5FUYA 5TF4A 4ALMA 3KXYT 1N5JA 1TAQA 1NMQA 1A9QA 3JATB 4B3MB 1SC4A 2JS7A 4YAJA 3Q1KA 2R82A 2NV0A 1ISHA 2W2LA 1IIRA 2ZJOA 5DGDA 3S7TA 3X2EA 4AN0A 4D79A 3H3XA 4F2GA 1CDOA 1ZITA 1KY5A 4UCSA 1GZHB 2IEGA 3DLAA 4C3ZA 1QK5A 1RKQA 5J2TA 2JFNA 4H7DA 4OXXA 4A7PA 2E4UA 1X2BA 2V5AA 2G6TA 2XADA 3DNMA 1SB8A 4N7JA 3IA2A 4L8FA 4RKRA 2Y4OA 5C44G 1ST2A 4CGZA 3EMDA 2QVLA 4TTJA 3SXPA 4WKPA 1TEVA 5B7GA 1FFHA 1NUTA 3BHJA 1H2RS 3IXLA 2Y0BA 1TRHA 4RYDA 1RYBA 5P21A 5HUQA 1WPXA 4V0QA 1QYVA 2II6A 2ZROA 1JHZA 1W0JD 3I23A 3S0JA 3C3MA 3NPAA 4TWAA 2FI1A 4PZDA 1C30B 1T3LA 1K3UB 4HS4A 4V0ME 1AB6A 1F9AA 3VR5H 4MI3A 1N6OA 3AF5A 5EJ4A 4U4AA 3BDVA 2YBEA 3IT2A 4DA8A 2H1WA 3K05A 1SBCA 4HGNA 4M86A 3H7IA 4P8RA 1GFSA 3F4LA 5A71A 3UW3A 4EI2A 4KXQA 4NYMQ 4QG3A 1I4EB 4MPRA 1WCV1 2BT4A 3OT1A 3OY7A 3KB6A 4B17A 3VX3A 3QK7A 4KFRA 2ARKA 5ALJA 3AW8A 2JEJA 1E20A 2UAGA 3HDQA 2HWKA 4K05A 1MEJA 3F5MA 4FE3A 4GNKA 4RB0A 1DKLA 3O4RA 4M22A 4EPWA 5CA0F 3DAAA 3CQ9A 3PFKA 4O2AA 4PBSA 3A1UA 3D2AA 4RLSA 2PL9A 4FP9A 1QIEA 3HMKA 4BNIA 1J9GA 3JQRA 3N2KA 3F5SA 3GOQA 5H59A 2VOEA 4XSGA 4BMXA 1O95D 4QNMA 1PT5A 4YCMA 3ZDYB 2OTCA 1NX6A 4BBJA 1ZYUA 4EMBA 4JD5A 2CUKA 2XOXA 2G77B 4D6PA 3WQHA 2RC6A 4DMLA 2PT5A 4ZDKA 4JSRA 2EBUA 2V03A 1HDEA 4GECA 3UJ8A 2CJPA 1C9MA 1ZOIA 2HA5A 1OLSA 1BJRE 3LLVA 3ND8A 2G08A 1LXCA 4L9AA 1E89A 5KDLA 2RIPA 2IDMA 3TBFA 2P3SA 4YP3A 4HYTA 1Z4QA 2YS7A 3HO8A 4V03A 1SU7A 5CYGA 4WZ6A 4RMNA 1RAIA 4EPXA 2C07A 1SG9A 3ML1A 2WJYA 1UM9B 1OZGA 2JZOA 4L2IA 2NVUB 1QIKA 1P9OA 3UPDA 4D98A 4HTFB 2O8CB 3PNQA 1C0EA 4HX9A 1EVJA 2HF9A 2J67A 3NH6A 1QGDA 5HV6A 2P6UA 2H2IA 3EXHB 3FKJA 5F35A 1LSJA 2DBZA 4H9GA 4B6PA 3QFSA 5AVKA 2A14A 3GLFE 3B5EA 1XU4A 3NKLA 4YAIA 1AQ6A 4F4JA 2X1LA 1NQOA 2QD4A 3KUXA 4GKAA 2GCPA 3FYUA 2J09A 1SIBE 2X22A 3LDFA 4OJTA 1ZUHA 3IMCA 1U6IA 4PAOA 1CKNA 1PQ4A 3MEQA 5TQ2B 1KYQA 2FSVA 1XXHB 5H16A 5JEDA 2JAQA 3OO0A 5LXTB 5CG1A 3MJEA 4EKYA 1LF0A 1UJ2A 2G4LA 1VL8A 1LDMA 1I50A 1XYYA 2PS3A 3L2OB 1Z36A 4HDKA 4P4UA 4B7ZA 3CVYA 4C05A 1WP9A 4LGCA 3U1TA 5EINA 2NP7A 2CLKB 3RS4A 3GGSA 4Q8FA 3TZ6A 3F49S 1MO3A 4J9PA 2RAVA 2ZIXB 3PXEA 4MS3B 4K87A 2EZTA 1W2WB 1LU9A 3LV8A 3O1HB 3EZLA 2EVWX 4JROA 3S2IA 4AZ3A 5HUHA 4ITUA 3SEFA 3C87A 1M7GA 3C97A 2EKBA 3OZCA 1E4VA 3EB9A 2C2DA 3NHBA 4HAOA 1YT5A 2FFBA 2OBFA 2WSSA 3P5BA 3X1YA 5DV9A 1YZQA 2CF6A 5FNVB 3BTOA 3LLSA 4BRSA 3L4JA 2GR9A 1J5XA 2F3RA 5DFAA 2XHEA 1ZCBA 2FQ1A 1WB9A 4XD7D 1MB3A 1R0ZA 3AUTA 1CEQA 1RR6A 3LBAA 5A2QW 3N0WA 2NNWB 3FHOA 5G0VA 4DSNA 3C41J 4S1WA 1BCSB 1ONPA 2YL2A 5LQJA 3ET4A 2JEFA 1JAXA 2GAAA 4MCJA 5E4JA 3MWMA 4W5QA 4BO2A 1KI9A 4ZT7A 4UM9D 4LE2A 1GZDA 5KFXA 2QY6A 4PTYA 1U94A 3QEMB 3UK7A 8OHMA 2O2ZA 1KC7A 1KJ9A 5CB0A 2Z9DA 1I14A 4WESA 5IJ9B 1Y6GA 3KETA 3M4XA 1J0XO 3IIMA 1JQEA 5DLQC 3CEPB 5JRZA 2CDCA 5I7WA 1D2NA 1PHPA 4F5WA 2DEUA 5GJCA 3KDPA 1PWHA 5AKXA 1XMJA 3A05A 1EJ6A 1DTEA 5LA6F 4DQDA 1XL1A 3QVXA 4AY4A 1EB9A 4UFNA 1C80A 2SKDA 4TOIA 4YJHB 1SN7A 3N2IA 2BRUC 4AJOA 4C2AA 1QF7A 5AVJA 1DFGA 1ODFA 1KVSA 4GX5A 2BMDA 4E07A 2GX6A 4R7RA 4GW3A 4II2A 4B35A 4AC9A 4PG8A 1OREA 1IPFA 4FGZA 4EGFA 2L2QA 3CF2A 2GN0A 2OUKA 2JJ2D 4C3OB 2AIRA 4TSFD 4YUYA 4XGIA 3GLVA 3I01A 4KPYA 3S8EA 1H8ED 5DISC 1XD2B 3OKCA 2UUAH 1XTPA 2OZLB 4EZIA 1GT6A 2NUBA 4JA0A 1G7CA 4QHYA 3IV7A 4JI3H 3NM4A 1L3IA 2RBKA 1QF6A 3FTNA 2Z57A 5H9VA 4RANA 3A6GA 4UM9B 5HM8A 1Z39A 3GWZA 1GUZA 4LMBA 4FXPA 4OL0A 3PR5B 4G8JA 1PFWA 3TWOA 2PLAA 2O23A 3EEQA 3LD9A 4WOPA 3QEOA 2BLLA 1QAOA 1UXOA 1Y7TA 3N5CA 3PFCA 4HUQA 4MS1A 4UMEA 4Z0HO 5FDFA 3W5VA 3K70C 2YZNA 1KEPA 1P7CA 3R3JA 3UK0A 3OA2A 4AU1A 3AVTA 1E3DA 3FCYA 5I51A 3R4CA 2B1GA 3TLAA 3AVXA 1L7AA 1Y1WG 1OU4A 1PWXA 4JZYA 2JHCA 3V4VB 4ZQIA 3C0KA 3H11B 2F4NA 4Q05A 1ZEMA 1PX2A 4B46A 3VNNA 4Q9HA 3R3SA 4BNGA 1P17A 3WL6A 5HGJA 4PG6A 3ROXA 3GDFA 1NHWA 3GFGA 2EFYA 1P91A 4X3PA 3USES 3IE1A 1IN6A 3CUVA 3TJMA 2R1VA 5D3QA 5L95A 2FXVA 2VNKA 3GFFA 1QYDA 2GBLC 3I1JA 1A5BB 3OE5A 1I3OA 2FWPA 2GWRA 3SJZA 4BV8A 1V8FA 4EHDA 1KA9H 1G5PA 3DEAA 5KKCA 3IUMA 4GZ5A 4Z53A 1ILWA 1DAPA 2X9GA 1V41E 2RG7A 3KFLA 2KYRA 5LB4A 1R10A 4PAQA 4ENSA 1XNQH 2W2OA 2X8BA 4XX0B 5LVAA 3HL4A 4AYBA 1CCWA 2W6MA 3UJHA 3O8DA 4FYJA 1EJ2A 1RQGA 3KG2A 2Y0CA 1E2MA 1T8UA 3T94A 3PLRA 1ZGAA 3ZCRA 5U4XA 1Z6YA 2YOHA 1U8ZA 5JCOA 3RJZA 3MTEA 2GBGA 3MT7A 1NBIA 3LX6A 5F5XA 1QPBA 4EBCA 2R1UA 3ZY6A 4ZYXA 1QDEA 3TFOA 4MXDA 3P45A 3GGGA 4JHXA 3NV7A 1ZH6A 3PZPA 4C0QC 2IOYA 2GJSA 4HLQB 1UUFA 3TQIA 5KOJA 1U9ZA 3VOSA 4PO8A 3WX0A 1WSWA 4DCMA 2QA5A 1C9YA 3BMQB 4LRSB 4WVFA 521PA 1C8BA 4FE7A 2A84A 5L3RA 3ROGA 3QE2A 3LCVB 4NZZA 3X43A 4Z3DA 2WSIA 4EDHA 3B5JA 3AB8A 4YRMA 1YK1A 2F90A 2JEZA 2JIBA 4GM0A 4M1WA 4YAEA 3V2GA 2KBEA 3A28A 4JXXA 2ZYTX 1MRZA 3HB7A 3LQ4A 4ZVLA 3RTDA 1VKHA 4Q9KA 3O4JA 1QNFA 1QVRA 4DSTA 4HVCA 4MVJP 1RXWA 2Y66A 4XB1A 1U99A 4ITVA 1PL0A 4BAUA 3BORA 4B3SH 4KYVA 4ETIA 3FR8A 5DNEA 3KB8A 2G88A 2V8OA 1LV7A 4ECYA 1ORDA 1XMOH 3EGEA 2ES4A 2I2WA 4MDHA 3DZ8A 1LLCA 4TTTS 4DLXA 5EQDA 3T7DA 4U00A 2WHPB 4KQJA 1OC4A 3RU2A 3K9BA 4MI1A 4J90A 4QTZA 1Z6AA 3W9BA 1E58A 2OCIA 3SI7A 5A62A 4C4AA 4D42A 1NW9B 1V9CA 1B0PA 3L4EA 3GCWA 3LOPA 2FCAA 3MMXA 4UUPA 3U54A 2MSDB 1CV2A 3KBOA 4KE8A 3ZU6A 4E2WA 2EZ8A 2RH4A 4PSAA 2OK8A 4HX2A 2G7MC 1A4UA 1GTG1 4N5LA 3SYMA 4YQYA 4ZICA 2UXBB 3Q6IA 3TSYA 2CXSA 4QLAA 2JLWA 1SCUA 3PVXA 4PZPA 1G21A 2V6GA 1JH8A 1LPMA 1OWLA 1M5TA 2VA8A 3PD0A 1RLOA 1UKCA 4IOLA 4G9GA 1M6VB 4XJSA 3H42B 3ZDRA 4AFNA 4BMPB 1GTVA 3A06A 3KKQA 3HGQA 2CN1A 3P2KA 4ZAVA 2PTGA 3OIWA 2BEJA 1G2WA 3FPCA 2KW5A 5BYJA 4RDXA 4J0KA 1FUIA 2QU8A 3H0CA 3HKCA 5K6AA 1H1DA 5EP1A 3OIFA 1O77A 3D3JA 2Q28A 3IE0A 3ZN2A 3KV1A 4Y7DA 1FW8A 1UP7A 2GETA 3F98A 4X0EA 1N2BA 4DMRA 5JRJA 4F93B 4ZQBA 1WPQA 1KR2A 1NXPA 1W35A 2QUIA 5KFYA 1U7ZA 4MIYA 4XYMA 3NGLA 3CF6R 1N1EA 1JTFA 4H4CA 2C5EA 2GPBA 2WFMA 3I5YA 1OZHA 3T61A 4R3NA 3RC3A 4N7RA 3WIEA 1I7DA 1DJNA 3HB4X 2MYUA 1PV2A 2VFAA 1JFFA 2ZRMA 4WVLA 3SHOA 1T9CA 1QRDA 2G5PA 1X8JA 1G8HA 2C04A 3Q0IA 4AICA 1Z0JA 1TA8A 1V3TA 4N9QA 3RU7A 4IINA 2JFOA 3ZGVA 1WSDA 2P0EA 1AA6A 3KC2A 4ZOLF 1KU6A 5KOHA 3N53A 3WHPA 4G4JA 4DCOA 3LGXA 2YQ5A 4FHDA 3G2NA 4R0MA 5DNUA 1SD1A 4MW2A 3V7WA 3ZE8A 3DE4X 3BABA 4IUBS 4EHHA 1TO2E 3C4QA 3FE2A 1A71A 3PA6A 4COOA 1H4QA 2ECKA 2FOLA 4GC5A 2IYUA 1KXZA 2JJYA 2ODPA 2Z2ZA 1KO7A 3NDIA 5LOVB 3EFBA 1HPLA 3AHJA 3VPCA 3UJDA 1Y4AE 3GXBA 4NIMA 2R751 2FSVC 3QTLA 1XU7A 1D0VA 4PFJA 4UDNA 5CGQB 3UH1A 1DKUA 1AX9A 1YB2A 5HF6A 1YHZA 3ITEA 5BV0A 3AFNA 2BRUA 1QLHA 3R3VA 4B80A 2PMWB 3EIXA 4RA9A 1SCQA 2ZS7A 4KZKA 2IXFA 3ZLUA 4AS1A 3GA0A 2UUCH 3ECCA 2WIDA 5HK8A 2H2GA 4A2AA 3BGOS 3GD5A 3QBDA 4H6VA 1LJUA 2QN6A 3EGIA 3TK1A 1YR3A 3DVAA 4CC5A 2HF7A 4AN4A 3DZFA 2JDIA 2PL1A 2D2FA 3CPEA 4HRYA 4N5IX 3TAUA 3AK4A 4D9KA 1WXDA 5M34A 4K2AA 3GW8A 4X66B 1CIJA 3GJ3A 5B64A 5F12A 3SLKA 2GVZC 1CZOA 2XYQA 4DV0H 1CFJA 3IODA 1GL7A 4MQMA 4TVBA 4X7MA 5D3MB 1NVVQ 1QOPB 2XB4A 4FSHA 3T3IA 3J81A 3F74A 2YZKA 4BUJA 2VF2A 1G5RA 1LA2A 1WQ1R 3D3NA 3JD2A 5TRTA 2NUTA 3D8TA 2FFHA 4IZ6A 4J6FA 3CLHA 3U3DA 4CIYA 4MCHA 3CNBA 1KAOA 2CMDA 4QYSA 4J7UA 3COJA 4G5QA 4I19A 3N05A 2J1LA 2V59A 4PPNA 5IF3A 2YFQA 2ZCUA 3H5AA 3QYPA 4JP1A 2P4EA 4BGVA 4KXMA 4CUZA 3K6SA 1JZTA 2BI8A 2XODA 1CUEA 4E15A 2G9ZA 2OD7A 3QI2A 2FP3A 2GF2A 3PRJA 2OM6A 2HQ1A 1NVDA 1WXHA 2QK4A 1UDBA 1Q20A 3K8OE 1OFHA 3M6WA 1LTKA 2PKQO 2JLBA 1OH7A 3DXZA 4UREA 5TVGA 4YCLA 3LVBA 5KQGA 4QELA 5KT7A 2D1YA 5J4YA 1EWQA 4GLXA 3UUEA 3WNBA 4BTVA 2VCHA 2AR0A 5K3WA 2QTGA 3SIWA 4BVEA 4EW3A 1C4KA 2PVPA 1ECGA 1S4MA 1Q84A 4MUEA 5LJLA 3CMCO 2W4MA 1FFDA 1EVZA 2X76A 3VNBA 1XVLA 5ES4B 1PS0A 2ZR0A 1ZAUA 2QGFA 5EYPB 4HGZA 5BSVA 2Q3LA 1L4LA 5I5EA 3Q15C 4AUNA 3SD7A 1PFUA 2R96A 4WK4B 1RRVA 2DCUA 5EFOA 4HWTA 1MOSA 1VLHA 5KYYA 1L5YA 2W6IA 4L8LA 1M83A 2H65A 1GV0A 3G5MA 2DKOA 3E2MA 3IAAA 3KYJB 3N5KA 2A5YB 4ED1A 4EI8A 2VK8A 4QPZA 3SGIA 3AESA 3TLCA 4F8YA 3NT2A 5EESA 5K5EA 1RXVA 1BH2A 3ND9A 2XYGA 3E9YA 3IVCA 1YR9A 2W11A 1EVLA 1I1HA 3LY5A 4PU0A 3ZNPA 4AMYA 3PXUA 1OHHD 2QLJA 4MYRA 4AP6A 2FRDC 4RZRA 1U63A 1ZIXA 4IZOA 3G9XA 2ZI4A 3FBWA 2BFFA 4FHCA 5AD1A 5KFLA 3ZQJA 1N6IA 2ZWIA 1N0WA 2YWHA 4FWIB 3I64A 3PC6A 1T0BA 4MUMA 4RK6A 1U02A 2RGUA 1MB4A 3I53A 2Z3VA 3C45A 3JALA 5JNVA 1CLEA 4K8OA 3ONVA 3I6MA 2OXEA 4AQYB 2CV2A 1SRRA 2A4MA 3QBEA 3WGLA 3GRRA 2HMVA 2IY7A 3L0SA 2VH2A 3L7BA 2FLWA 4FCVA 1U11A 1NOJA 1SELA 1MTZA 1NVUQ 2ONYA 2GD1O 5TSDA 1UC4B 4X8LA 4KQHA 1BMFA 2GBCA 1NUPA 5T4EA 3W05A 3BIXA 3ESZA 1C9EA 4B2PA 4RWZA 2J0VA 4BLTA 1M74A 3IL2A 1BGVA 3GNLA 3IOYA 2QYHA 3S1AA 4RDHA 4CRWB 1QK3A 5LSAA 3I9V1 1JMKC 1YA8A 3MWYW 2EGUA 4F91B 4DLBA 1G8FA 2J4DA 4YLGA 1CPYA 4EUNA 3IEPA 1Y33E 3KUDA 1N7GA 4M9RA 4HV4A 1F5SA 2JVJA 3I9NA 4QUBA 5AW8A 3AV0B 2Q8PA 4TT3D 5AJWA 5KNLA 3GX1A 2WW8A 3FOZA 1QQ5A 1HF3A 4CKBA 3VR4H 2HNAA 3VDNB 4HNUA 1UK9A 1DC6A 1II8B 1ZRSA 2DRIA 2QTBA 4G86A 4YIKA 1WB5A 5JBNA 5BN4A 1Z4JA 2HJRA 3IP8A 3L1VA 1EAYA 3E3OA 5EZ5A 3DF9A 5KHAA 5CD9A 2X2PA 4UEKA 2UZ3A 3K9WA 4P3XA 1X8LA 2MINA 4DR2H 1OIXA 2C82A 2GN1A 3DFIA 4NU5A 4OG2A 5FPQA 4DCPA 4O4LF 3N41B 3E6AA 4HB4A 2H51A 4INOA 2ZPTX 2AYXA 3MWDA 3OAAA 3E0XA 2CW7A 1JSRA 4XYGA 2V7QA 5FBZA 4ZDIA 4TYYA 3BXGA 2FGKA 4L57A 4WV3A 1T4DA 3OEED 4O4JA 1G9SA 4O1HA 3LTEA 4M7RA 4BMOB 5JT1A 2XWJI 4QUKA 4EW2A 3RSSA 5JYDA 1EI9A 2WYVA 4L3VA 3RWOA 5TIIA 4LDAA 1G6Q1 2GFQA 3PPWA 1FNMA 1OX4A 2QL9A 1CJCA 3I3SR 3N7TA 3PN1A 1PGOA 1U8YA 4WCFA 4BQSA 1MXFA 2TMGA 5F2NA 3OQNA 3JVDA 4KWEA 2X8AA 2DPMA 2OORC 1GPYA 2H2FA 3RFCA 3HFRA 4BKUA 2JFPA 5ALVA 2HLNA 1M2OB 2AEEA 2J6SA 1NJ6A 3V00A 5IDWA 4B85A 1AY0A 4RPLA 4NFSA 1ZGGA 4G1UC 2BJWA 3DFFA 3WGMA 3KX2A 2XITA 2NXNA 2VAVA 3IBSA 4BE4A 4BQQA 1LPSA 1LVGA 2HWXA 2VUHB 2FMAA 3TZKA 4M7WA 3GP8A 1GPMA 2X9QA 4GEGA 1H0HA 3PGA1 1EUQA 1E4EA 1UINA 2QVZX 1UEJA 2P1ZA 4JBXA 2R00A 1F0YA 1OXUA 1IBRA 2VSQA 4PX3A 3WOHA 3ZTWA 4F7WA 5KNDD 1ONNA 5L40A 2QEQA 1Z62A 3NDJA 3MPOA 4PNEA 3WLPA 3HBNA 2F59A 3PGJA 1O97D 3L77A 1RCTE 4R05A 3IESA 4MA5A 3VR5D 1FTYA 4B6EA 1DKMA 5ITZB 1RYRA 3ADKA 3PL5A 1GTL1 4DLAA 2JJ2A 1PV1A 3IAS1 3A1WA 4J8PA 4HZGA 2R3SA 5AFSA 4IIVA 2UXDH 1JR3D 1G7SA 3PO3G 2C54A 1Z37A 2GEUA 2IP2A 5CM2Z 5AW4A 5I8PA 3Q4GA 4F5YA 5DCLA 1TF5A 3PR1A 4JJ6A 4EYEA 1RD4A 1RSZA 5ES3A 5IJ0A 4ZHSA 2RAFA 4U7JA 4HTFA 2FG5A 4BFYA 4GI3A 4KV7A 4BQFA 1TD1A 3RV4A 1QVZA 2VVTA 2GESA 2PJDA 3ESDA 3Q7PA 3KJXA 3Q3GE 3GTJA 1FU4A 3CEBA 3ME5A 1JGTA 1WW8A 3ILHA 4IKPA 5G53C 3OCZA 4ESHA 2DPGA 3LG2A 4DJTA 4Z99A 1O0CA 2AGQA 1FFEA 1LFDB 3GTGA 3LNTA 4BB9A 2IA5A 3TI9A 2REXB 5CRIA 3R6DA 1ORWA 1PGJA 4UUMA 1D0SA 4QRHA 4KWCA 3OQJA 1TZBA 1B6RA 2LRHA 1U65A 3A1SA 1NBEA 1W9HA 3F8WA 4OBWA 5EHXA 5GONA 4DF3A 4JA2A 1JLMA 1EEHA 1JQLB 2VWPA 1SXHA 3KPWA 1RE1A 4JJFA 1AN7A 1E7SA 4E88A 1JHUA 4RUKA 1JUDA 5IWAH 3ZBTA 4I0WB 5UKDA 3JZDA 1M7BA 5E3IA 4F60A 1YGYA 2O0MA 1Z8DA 4WD3A 3BJEA 4IXTA 1OLSB 2YNMC 4G0PA 4KO2S 4OQMA 5CNKA 4ZDWA 2ODQA 4CL8A 2WJ6A 4NCJA 4JS0A 2VUMG 1HWYA 2BGKA 1JZSA 2RC5A 1FVHA 4NCKA 4EFMA 1S0UA 3KSDO 4DQUA 1CVIA 3CYFA 3VKUA 1T4GA 2JFFA 2JLZA 3VSEA 4LJ5A 3PO2G 1SPBS 4K3VA 4UCWA 4I4TA 1PKEA 4IDPA 1Z25A 1UODA 3KJFA 3ZXXA 2J6UA 4YJ2B 4YHHB 3REQA 3UHOA 3FAZA 3SR0A 1CYEA 3CR3C 1M2WA 1OTXA 3ABQB 2WNHA 3I4CA 1D4ZA 1BEUB 1A5AB 4D4JA 4YJ2F 3MTIA 4XDZA 1PNVA 1P19A 2DWCA 1NJ1A 3LLUA 1KFJB 1NTOA 2I4LA 1FMTA 2O2SA 4OP3A 2GYWA 5F1KA 2ZXUA 2UU9B 2V0GA 3E5MA 4ZI7B 2OQVA 1EZZA 1FY2A 2UUBB 1LVUA 1YR8A 1XCLA 4DR3H 1NFFA 1JVNA 2JBWA 2P78A 2C2GA 3B7PA 3MZ0A 3OX2A 3PJEA 2C58A 1BOOA 3ER6A 2HR1A 2FMFA 1DFHA 1DRWA 3ITNA 4XIJA 4FHGA 1S9DA 1ZJ6A 2XNJA 4ECZA 4GOJA 4WLNA 1EGHA 3O6VA 2Z6AA 2YXPX 1TTQB 1Y9ZA 3OPYA 4Z6KA 3MWJA 4PQGA 4O4JF 3AO0B 4HB3A 4R2MA 3EQZA 4IS3A 5CLHA 3SC2B 3UXHA 1XNRH 2OENG 3A9VA 5FEMA 1SBNE 1F6WA 4UCOA 4GP6A 1W0JA 2VBFA 1EUZA 3WRYA 3GNSA 4EJ6A 4HWGA 1SXPA 2AUMA 2XLBA 1P5ZB 1ISMA 2GD2A 2R79A 2HJSA 3EFEA 1WXIA 4H3SA 3N75A 3GLTA 2DQ4A 4Y6QA 3VHRA 2Y1LA 2PU7A 2VF4X 3L0DA 1Y63A 4R51A 5CFNA 5ICSA 2ZE5A 1II0A 3GFOA 1TFRA 3VDMA 1RWKA 2GPNA 4CEJA 3CNLA 1CTQA 3ZHXA 1IN8A 4I1OA 3SF8B 4N3GA 1WMEA 5I5VA 1CF2O 2GQRA 1A7JA 1YR6A 1R3UA 3LYUA 3NWBA 3MQ4A 4HDOB 3W8RA 4D4IA 5JAHA 4GYWA 1GGMA 4I8IA 5EPUA 1Z7WA 3G7UA 5J3JA 1WCIB 1WSCA 3N59A 4LJYA 2MCFA 1WCWA 2OBNA 3ETNA 3OCVA 4PWZA 2O7NA 1VE6A 2ECFA 1GWNA 1PEDA 4EO9A 1DWOA 1KC1A 1XYVA 3I83A 4DNPA 1CJVC 4BNDA 1GFIA 1NQTA 3OESA 1IHOA 1JG2A 4JI8H 1VB3A 2AFVA 7REQB 4MWZA 4RCVA 1I5EA 4DR3B 3EGWA 3QEAZ 5IP7G 2IOFA 4IJQA 3DJYA 2GAOA 4E2ZA 3MMNA 1W5FA 1QMGA 1XLTC 5EMNA 1AOXA 1CY7A 5ECWA 4YV0A 2DB3A 4HWOA 1JMYA 3PCXA 2R7AA 3IO3A 2DH6A 2VNSA 3TM5A 1EXMA 4JP8A 1Z2DA 4I81A 3C8DA 3NAQA 4U3JA 5I7VA 5CW1A 1FX0A 2WR8A 1CQXA 1HL3A 4HRVA 4W8HA 4BVHA 2EQ5A 2HMTA 1GVNB 5KYTA 4L85A 2GKOA 2H1OA 1MNAA 1ZIDA 4HFNA 4C20A 4EA8A 3GIMA 4C03A 3GR6A 7MHTA 4FNOA 1U2ZA 1ICEA 1KJIA 4LHXA 4GLLA 1LNSA 1YASA 2OLSA 3FR7A 1THTA 3GAZA 3RYTC 3VJLA 4JV0A 3I4NG 5JSKA 5L7TA 1RDFA 1QKIA 1SULA 3BD6A 1USIA 1V1JA 3FCEA 4IDNA 1Q7GA 5KT6A 2I54A 1CUXA 4RGQA 3WB1A 1OJ7A 1TCCA 2BFAA 4DQKA 4DV6B 2W8ZA 2KX7A 3LUDA 1LFAA 2XDWA 3QZ8A 4MQFA 3KSUA 3NORA 5EC8A 1OAOC 2WUFA 3A7EA 5IMBA 1Y1LA 2A3RA 4ML3A 1JHPA 5IUJC 1YZYA 4G81A 4KUEA 4OMCA 1RWOA 1M8GA 4UTOA 3L0YA 2P2DA 4UAUA 5DBEX 4BB6A 4NK4A 2CHGA 5A4JA 4M0UA 2HDOA 3W1BA 5I7AA 4DA9A 2O8FB 4QGSA 1RCFA 1ZM2A 1LLFA 4AG5A 3H5LA 2G82A 4BNDB 3OX1A 3K71B 3AFGA 5I01A 3NBZC 2ZJTA 2X1VA 3OZUA 2IBMA 3L8HA 4U6SA 4AY3A 2PUAA 4BX9A 3W3ZB 1XX6A 1VYVA 2PUCA 2N75A 1GTSA 3FWZA 3DEIA 2VWGA 4OXKA 4QDOA 1O4VA 1RAEA 3OOWA 1G60A 2GHQA 4KG7A 1A97A 4TS9A 1OH6A 1XNQB 2EV9A 2Y0DA 4N3NA 5JS2A 4EB6B 2OL4A 5JOQA 2Q3JA 3DTTA 3GTOA 4JMLA 2ACKA 1XCBA 2RCYA 4UD2A 2J6HA 4KPUB 1Y3IA 3R7SA 3ENVA 3VZRA 1FU7A 4B6SA 3NANA 3IUJA 4YECA 2PAAA 1FIUA 1DBRA 3RVJA 4DZTA 2DKNA 5L7YA 4A4DA 2HJWA 4QJ3A 1ZETA 1Z15A 4H7JA 4JI4B 5IYZF 3B6KA 1AGYA 1EHIA 1MPXA 4Z2YA 3I6BA 2AKYA 1YCDA 2ZDQA 4NXMH 1D6JA 3NBQA 4XFKA 2C7PA 1NG9A 2WYHA 4D3SA 1E5DA 121PA 2CJXA 3BMCB 4OCZA 4X9XA 1H5NA 1HA3A 3KQYA 3V2HA 4ZZIA 1QS0A 4EG8A 1BKDR 4CEIA 3T38A 3GFVA 5EWFA 3P9IA 1GRNA 1O5TA 4IJKA 3CB2A 4RLFA 3PR3A 4YMWA 3OQIA 4U0JA 3SC4A 3TW8B 2Q07A 2EJWA 1NN3A 3RT7A 1GJRA 4KOEC 1M6YA 1S02A 3O8QB 3UHPA 4JELA 1GSAA 4R3WA 5HWSA 5HIIA 1LI5A 3N87A 1YS1X 3QVJA 4ISBA 4KPFC 3W06A 2CHUA 1GQSA 1L3BA 2CFTA 2WHYA 2WM9B 2ZRNA 3M1LA 3QNMA 2F43B 5FBWB 4J3NA 4DNXA 3U31A 1E3LA 3AIOA 3R0VA 3TLXA 4IM7A 1U0RA 4IH9A 1Q22A 3JQAD 2E89A 1R8QA 1ZRHA 2R8RA 3Q7SA 2FN7A 1ZPDA 2EYUA 1KQPA 1V4YA 2DULA 1RHJA 3MTQA 1KI3A 1C4OA 4MPPA 1UC8A 1VHTA 1GUFA 1C9JA 3UMFA 3WL4A 1Z83A 1I94B 1QX3A 4JXZA 2ZATA 2EJCA 3KSMA 1FQOA 1P7WA 3AM5A 4GX1A 421PA 1F8UA 2CUNA 1SVKA 2FK8A 4NY1A 1YFLA 3ORYA 4JJEA 2WMYA 3FOEC 3IDQA 4WINA 1JVBA 1XZDA 3TOCA 2CDAA 2Z5FA 3IR5A 2I1QA 1XCMA 2C3YA 1NTRA 5HDBB 4BP9A 4ZGWA 1Y7PA 3AKZA 5KO2A 2ODBA 3U3JA 3BQMB 4DG8A 5BR7A 3EVAA 1U3WA 4KFSA 3N44B 1E6KA 1N2GA 5K45A 4DAOA 3JQ9C 3QF4A 3N6XA 1SHJA 3C5VA 3HU3A 3NYIA 3C3PA 2LCIA 1Z82A 1PD1A 1TLLA 1ZM3A 4MTDA 1UL1X 4LA4A 5GIPE 3REFA 1E1RD 2G36A 2QTLA 2WZDA 5PNTA 4O1IA 1Y8RA 1OXKB 3KOWA 3W9YA 1PR1A 3CZ9A 3KELA 5DOZA 3N43B 2DFDA 2ZG6A 3QXJA 4DQXA 4RF3A 2W2NA 1JFVA 3ILSA 5ARBA 3QFRA 4R2HA 1HNWH 3KWLA 3WB2A 1X7DA 4N7MA 3TLYA 4RMHA 1KYXA 2UYYA 5EJ2A 4C1NA 2W2KA 5DX8A 4E6PA 1LDEA 1P1KA 2BR3A 5CPFA 4F3RA 2VQEB 4R31A 4PC2A 2YWDA 3DEKA 1FDIA 4ED2A 1M5RA 4NBVA 4P98A 1D1PA 4TSKA 3RPEA 1I7NA 3RRBA 4HNAB 1X14A 3IDSA 4IF4A 5F2OA 4YR0A 1G5IA 3MOGA 5JQWA 3WMGA 3QXSA 2VHTA 5AJVB 3SSMA 5KNDH 4GRDA 1RC1A 1P1RA 5FI0B 1E6MA 2RHWA 2G6BA 2A9RA 2QZZA 1JJFA 4HEJA 1QO9A 2FPXA 4B3TH 4XCVA 2Y1OA 4KUHA 2Q3MA 2XEDA 5FOTA 1QGUB 2O2JA 1EP1B 2XTJA 1Z28A 2OSBA 3V46A 5I3ZA 1A82A 2R6CA 2FLPA 3G2IA 4IRKA 3PSHA 4QIHA 4YJFA 1BDHA 5F52A 5D1HA 2I8AA 1K5PA 4I4NA 1DI0A 3G89A 4G8BA 4EA7A 5IDXA 5AJXA 5CNMA 2E5FA 3PB3A 4O29A 3PXGA 1RYHA 1YH3A 2VG8A 5FRDA 1PBNA 3DVLA 5EHIA 1AF4A 3M81A 3FMOB 2E2IA 1G6HA 2C3MA 2FKLA 4V0KA 4WADA 2X5XA 1HTTA 1AQJA 5IZCC 3N1UA 2ZRLA 1RYSA 2KLBA 1M33A 3MWEA 2BF7A 4EGCB 1IWBB 4NBNA 5FTNA 3RRFA 4NNPA 2QORA 2EW2A 5BN4B 2XWSA 2NTNA 2WUVA 2OOKA 3ASYA 4XPIA 5D84A 2AGOA 1E59A 1WTCA 5DB4A 4BN5A 4EJSA 3JD1A 3S3TA 4JASB 2WAOA 3UWPA 5HK9A 3R6LA 3TKLA 4ZK6A 1A88A 3V42A 2B1IA 3IHLA 5LWHA 1GNSA 3PRKE 3LX8A 4IGFA 2ZAGA 1LQTA 2DWQA 2D06A 2GN9A 1EFRA 4GP7A 3VRHA 1U0NA 3B2EA 1K5HA 1KJNA 4RVNA 4TROA 3AFMA 1TMGE 5FI3A 4WDRA 3OLYA 3RYIA 2CUTA 1GRQA 4PC7A 3FFXA 5FFFA 1AGNA 4Y8VA 2FX5A 1PSDA 3IVAA 1MAHA 2VDKB 3TYXA 2C8VA 5ALEA 1TMYA 4WT7A 2Z95A 4HPXB 5I7HA 4KQFA 5KTNA 1T1EA 3D7SA 4TLMB 3M9OB 3WYAA 2VHYA 1W0CA 4INPA 1GNVA 2J31A 2FW6A 2XAUA 2ZUCA 3FPEA 3CLSC 2JIDA 2A2ZA 3PC2A 3LECA 2XVZA 1X7WA 2M6LA 4DBLC 3EEOA 4A3DG 1KPIA 4YO7A 4L02A 1YQEA 2XMPA 2ZSUA 3QKTA 1RQPA 2BKVA 5HE9A 4DT1B 2P7IA 1BHO1 1IFXA 2N47A 4GD3Q 4JBWA 4RJJA 4KACA 4ZVPA 4CM4B 4N3AA 5KTMA 2FZ4A 4IKOA 3BIWA 4PLGA 3SJCA 1ZI9A 3M5CA 3MRXA 4K03A 4K3UA 1PNOA 3QVTA 3QE0A 1K0UA 5ER9A 5FR1A 4ZVMA 2WTBA 2VSYA 3QLEA 3ICPA 3VHXA 3CE9A 3FF1A 1MJHA 1VE7A 1C30A 4MGEA 4DV0B 2XXJA 1PJ8A 4HRXA 2GM5A 1HDRA 2X8WA 4FFDA 3RIMA 3CZ5A 3KTFA 1RJWA 3ANSA 4IHAA 1UDRA 1N92A 3HADA 4G8DA 2HRRA 3QWHA 4Q7LA 5GP1A 2I7TA 2B0CA 4C76A 4DSAA 4YRBA 1Y6FA 4L16A 2O1EA 2ZCJA 3F7NA 4G5OA 1FC0A 2PX3A 4B87A 6REQB 1PZXA 1CUSA 2BSXA 2JD1A 4CKWB 4B75A 2Z8XA 2IH2A 1E1CB 4XJTA 5F78A 4HBZA 4IJWA 2GBLA 2JFXA 4MUGA 3V3KA 5JH7F 5C7OO 4F4WA 2VTEA 1K1QA 3MUFA 3DDZX 4YJKA 3QFHA 1MT3A 1VKZA 2VRWA 1T36A 6CHYA 3L1UA 3OJWA 4JC0A 2WRZA 3T5BA 2BCEA 5JJ5A 3TZCA 3THYA 2V7VA 2O1WA 2Z6UA 5FHQA 4E3ZA 1N34H 5KFBA 4ED0A 5DNAA 3QVGB 5E6UB 4MITA 4KFUA 2NXCA 2ZWOA 3KLNA 5SV2A 4G5RA 4CIDA 4ZFNA 3SWWA 4G37A 2A9VA 3MIZA 3WIOA 5KSYA 3BOSA 1D4FA 1R5BA 2ETVA 2WQZA 2J7KA 2NYUA 3DPSA 4RKYA 1TM4E 3W5OA 3KFXA 3RJ5A 5B2EA 1KQFA 3RUIA 4JLKA 2IT1A 4MA0A 1AH2A 2CVZA 3VNSA 3E58A 3L0CA 3LPNA 4TRMA 4YDSA 3VVCA 3HK2A 4ZQGA 1X80B 1RFLA 4RVSA 1Z29A 5FPPA 1I10A 3M5PA 3OOYA 4H0CA 1S1MA 2W00A 4A8HA 4B73A 3UFXB 1SQFA 1PR2A 2J07A 3Q9UA 3AI3A 3F6SA 4L5BA 4AIIA 1L9KA 1YQWA 2P9EA 2OD2A 3IHWA 5HEKA 5BR8B 2DERA 1E3MA 2VRCA 1UOEA 3AILA 5KU7A 5J4KA 1FXUA 4HWPA 3UBTA 2ZRFA 2YW2A 3H4DA 1ANKA 1HBJA 1XXHA 2E1RA 1IL0A 1Y81A 2HU2A 4HFMA 4HNQA 5DI9A 1MP0A 1LX6A 2HWUA 3ED5A 4JDPA 5LIPA 2C8KA 2VRBA 3CLRD 2VPYA 3H18A 1A2BA 2RGNA 1NF3A 4JJAA 1PEKE 2R6ZA 3ZVMA 4WIAA 1N2SA 4AWXA 3CRVA 1NIPA 4OM7A 4LXYA 1JDVA 4FIDA 4P3YA 2EP8A 2QZ9A 2AFIE 5BW4A 4KQEA 4Q45A 2PSEA 2IIQA 5IHPA 3B1YA 3H2KA 2P5TB 2ZRHA 3DMNA 2HRCA 2ZYSA 3DHVA 2NOAA 1JIVA 3KQSA 2QNBA 3JY6A 5DE3A 1Q92A 2F67A 1NV8A 1GA1A 1PR4A 2HTEA 1K4MA 3LF2A 1IQRA 4XX0A 4EW6A 2BISA 3ZDBA 2ASDA 2VPZA 2AE2A 2XNDD 1V5IA 3KJZA 3M3HA 2OCDA 4YCDA 1JXLA 3QXCA 3TZLA 1EVKA 4UUBA 1ESDA 4BGDA 4RD2A 2BDEA 1XZAA 2RKBA 3HZOA 4YROA 4KIWA 1WZNA 1YE5A 5DBFA 2ID8A 3K35A 2W0SA 2QZ4A 4NMXB 1WR8A 4U02A 3VR2A 3N39C 4MV6A 4YAKB 1D09A 3DE7X 3KZOA 4CL0A 5HCNA 2Y76A 3QVKA 4ZYTA 2BEUB 2KQUA 3U4CA 3O82A 3HMQA 2J3EA 3FZGA 1XMSA 3ORSA 3SXJA 3DL2A 3K8QA 3OSNA 1I9CA 2YXLA 5DLFA 3EGDA 2OB2A 2Q5IA 3PKZA 1O94A 1P80A 2QLNA 4UTRA 1CD5A 2NXEA 4DAEA 2V5UA 5CCDA 5DX1A 2YUIA 3V4ZA 2XXBA 3N7AA 3ABZA 4JFRA 2X0RA 2DHRA 4Q1DA 1XKLA 4ED7A 9MHTA 3NJ4A 2A4KA 2IUEA 2IIPA 4TS1A 1X13A 3C74A 2X5RA 4U2FA 2Q27A 2B5WA 3AR8A 3NCTA 5FD6A 2XRYA 4KHPH 9ATCA 4GI1A 2YZGA 2V1XA 1Z5WA 3DZIA 4UBNA 4AP5A 2FUEA 4DVJA 1U0OC 4CIWA 1F06A 4MP8A 5L9XA 1P29A 2AF4C 2X5JO 3VTAA 4DIDA 1NVTA 1YOVA 1ZIOA 1ZOSA 2COGA 3OMLA 5IBQA 1AO3A 5IDYA 1VCIA 4FYHA 4MUAA 3LXUX 3WYBA 3QVSA 1ZMRA 2WP0A 3COWA 1RJ9A 3A4LA 1N4AA 3EMBA 4NDAA 4WXHA 3TH5A 1NQWA 1OX4B 1YR7A 4L4UA 5JCPA 1OASA 4GAEA 4J0QA 4I2VA 2VAWA 3GHHA 4KL8S 4LF4B 3ADPA 2H8KA 5EWJB 3IQFA 3QWBA 1E0SA 4M0FA 1C9KA 3R3WA 3HDGA 2AI2A 2QXYA 1R0YA 1ZD9A 2M6KA 2B4AA 3CLUD 3WLRA 5IT9A 2IHYA 3NYQA 3DGEC 3GJ8A 2QQFA 3J80A 1XLTA 4MS1B 4R1NA 2Q8NA 1P45A 5ERYA 1IMJA 1A4RA 1REQB 1TYBE 2GF9A 3I45A 4IMIB 1YJ5A 4MMZB 5EAIA 2XRMA 4NR0A 3WJ7A 3WL7A 3JYHA 3IUQA 1WCXA 5JAOA 1ML4A 5ADVA 4NNOA 2HWYA 3U44B 3CY6A 2Y1DA 5LZ2A 5IBCA 4YMIA 4ZPXA 1TAHA 1DSSG 1PFYA 4WBNB 1RCUA 1J9EA 2QSYA 4NQZA 1CDZA 1TTHA 5BWNA 1QZTA 4GXQA 1Q7EA 1SB9A 5EIBD 5TQJA 2JHGA 1EUYA 4CG3A 1O5OA 2XTZA 4LK3A 4YV1A 1JPVA 2CBXA 5TEVA 3HM2A 4J0GA 4CMJA 1QRTA 4YJ3A 2ZB3A 5H68A 2C7RA 3OSZA 2QQEA 1P1FA 2RG1A 3IR7A 3A3NA 2OGZA 5FBQB 3HUDA 1N5IA 3VKWA 4CF6A 3C14C 3GC6A 5CEJA 4X6YA 5LQRA 4IGKA 3HLTA 2PGXA 2XGOA 3RSFA 2QX6A 3S8MA 5DG9A 2ZULA 1ADCA 5HSGA 2HA0A 2PX2A 3B20A 4TTQA 3TPFA 1PV4A 4W8OA 3R9WA 1A9PA 3JYOA 4E2XA 1PWZA 3BS4A 3HDTA 1VCNA 1HT0A 1J24A 2UDPA 3NBUA 3H8SA 1ELOA 2I3DA 2XA1A 4PAGA 1BXRA 1M34A 1AXEA 2O6HA 1SOAA 2X0FA 1X1EA 1R7RA 2P2YA 3VKGA 1F6BA 1Z16A 1SD2A 4N3CA 1H9AA 2HREA 3L46A 5CYFA 3UV3A 2JLQA 3V7NA 5T64A 3DYIA 4A2BA 3UZUA 4EITA 4DDKA 2ZZKA 5JCXA 3GARA 2HB6A 4Z7OB 1M6WA 4LF6B 3FW1A 5AM1A 5DH9A 4WLFA 1R0KA 5DGCA 1E66A 3D8UA 5E9JA 3TBHA 4EA9A 4C88A 5KX5A 1TA4A 4Q4CA 4LYJA 4RA9B 4KMMA 3E7DA 4MB6A 1AURA 5BSHA 2VPWA 1CQIB 4B2YA 4QQKA 1TKAA 1EDDA 1LZKA 1SVOA 4LW8A 2AZ4A 4IDGA 1YQXA 1VRWA 1ATIA 4G8CA 4WBNA 1FDSA 1NW5A 4QHSA 4PM4A 1J42A 2VLIA 1UBOS 2AJ8A 3ND7A 1QQBA 4TV8F 1XDDA 3QE4A 4JYAB 2O7VA 1WQ3A 1TL7C 2R9VA 2ZLBA 2ZAYA 3PNVA 4NJOA 4RK4A 4XJXA 4BO4A 2M6RA 4DR5B 1BCSA 5DN6D 1W4AA 4G26A 2NUAB 3O2SB 3FVQA 3HYTA 5DRTA 4U6PA 4DWOA 1FS4A 4WJKB 4EEYA 2OXFA 4KFCA 1R0XA 4HUTA 3JQAB 1VLVA 1XV5A 4CM8B 4D4KA 1H42A 2BP7A 5DLYA 1K66A 1W94A 2OB1A 2W2XA 4GI2A 3ZUGA 3PNLA 2PCJA 3AR9A 3DHYA 1U5BA 3GB8B 1NSFA 1U2RA 3ACDA 3AP2A 3HV2A 3V7FA 3CA8A 4H3HB 4CR8A 5JASA 5EQTA 3K8ZA 5TMDA 3ICQB 3ANNA 2C4WA 5TGDA 1ESMA 4B0OA 2YVUA 3T5LA 1W52X 2QROA 2DTXA 3EAQA 3O84A 4LSGA 5ALIA 4YT2A 2ZZNA 3QUSA 3IIIA 1P77A 5FTKA 3A14A 1A7KA 4BNHA 3NDBB 3EXG2 1KJYA 1EGMB 1T5HX 3AF0A 4YTEA 2GPWA 3CKYA 1IRXA 1DADA 2CWWA 3QZUA 2P5UA 4FMCF 1CRPA 1FXWF 4MB0A 2QU7A 4B7AA 3FMAA 1M8KA 1XDZA 1JU4A 2QMYA 2WABA 3D6NB 5AJTA 2OO3A 4F1KA 1XZMA 2P6NA 3MGCA 1VL0A 2IRWA 2OC4A 5HGXA 1SZDA 3QU2A 4C0KA 5LQNA 4R4JA 2ZP1A 4ESEA 4BU0A 4ABTA 5HJ5A 3MTAA 3ZG6A 3CRMA 5H83A 3R7WA 3GA7A 4EHLA 5CG2A 4WNYA 5BSMA 3TW6A 3S68A 1D1TA 1SAYA 4DL7A 1RU3A 5C8XA 4W9MC 2HCRA 1EDEA 2JI6A 3SIRA 3AZPA 1TJPB 3HFJA 4J0EA 3KZCA 2X7HA 4LFBH 1KOLA 4PNZA 4HUQB 1LRLA 2GEBA 4MV3A 4YDRA 1K8RA 2FF7A 3T7SA 5HKOA 3UPTA 2HYIC 2H2DA 3KYIB 3PW5A 3K3PA 1C1DB 2H4HA 4G23A 2AFHE 1RP1A 3U3MA 2F4VH 1ZJ4A 1OWPA 4K0KH 1BYUA 1QHHB 4TMTA 4LFCB 4D45A 2XIQA 4CHTA 4HNAA 1U3GA 4C4OA 4UCRA 1H22A 4INJA 2LGJA 2XYPA 2GM9A 4LXUA 3TL3A 2XMCA 1BQ3A 2XWBF 3NP7A 4NEGA 4PRLA 4NRDA 1SJ9A 3T9BA 2JJQA 2Z30A 3JARA 4H35A 4M4SA 4RY8A 3H1TA 3E5RA 4V24A 5T5QA 3HC7A 3VDXA 4ZYWA 4CIBA 1E2QA 5LZ9A 3W5DA 2YZLA 4UUGA 1M6HA 2ESRA 3PC3A 3WKBA 1KEEB 1P0PA 1L3CA 2XE7A 2BGRA 4RD1A 2XTNA 2YNMA 4NF2A 5JE8A 3UA4A 4BVLA 2NTYC 2POCA 4FXOA 5JBQA 1NE7A 2JD2A 1PX0A 2ZJ8A 3PQ7A 5DK6A 4XGQA 5B6JA 3BWVA 4L9WA 3UEOA 4DRYA 3WI7A 5EIXA 2CCJA 4FLMA 4KYUA 2Z5GA 1IZ8A 1SXJE 2FPUA 3QH4A 2ZI5A 3SOZA 3LL7A 3TLJA 3FGZA 4EMTA 4I50B 1Z2PX 4W7IA 1H9CA 5C3UA 1M6EX 1Z6QA 2VEOA 5KB3A 4JV1A 4XEHA 2WTXA 1PEYA 4ZHQF 1WXEA 3C6ZA 4UDOA 3CWCA 4X54A 3ZBQA 1P60A 1XCJA 3ZS9A 1G6KA 3SKYA 4BATA 1B26A 4KMSA 3DSRA 1C2YA 1A27A 3D1VA 4J16A 4MUXA 2ZETA 5B53A 2IEIA 2O7QA 2REQA 3NQ41 4LXQA 3RFFA 4G4GA 2ZT8A 3MR6A 2FPOA 4OV6B 5JZOA 3S8YA 1C3VA 1DZ3A 4X41A 1BEEA 3LIIA 4CLEA 1AC5A 1Y80A 1L5MA 4FQ8A 1NW6A 3MJVA 4YVFA 3O75A 3RLFA 1RP7A 1ZN8A 1C0KA 3OH8A 3QELA 1ZLXA 1YFKA 3TDKA 1VJGA 3OKFA 4K9PA 4FGRA 5H5JA 5KX5F 4LV6A 3VU3A 1YZTA 4F3NA 4N6GA 3W6ZA 2HLDA 1MO5A 3IJEB 3LC1O 3KHLA 2H92A 4YBZA 2IU4A 4XYMB 1M73E 4EHJA 1GL6A 1GPNA 1XPOA 4WW0A 2GDJA 3K1TA 1NSTA 1QMPA 3VGPA 2G9UA 3OE4A 5F9MA 2EEPA 5TVKA 1Z8FA 2GB4A 1JX6A 3HKDB 1LDNA 3N8KA 4FX5A 4OUDA 4Z4FA 1U6KA 1KZYC 3R0QA 1FF9A 2Y27A 2EX0A 3B36A 3JQFC 4DY6A 1L1QA 1G1MA 1G98A 3DZHA 3RB8A 2R5NA 2RF4A 3UMCA 4C6RA 4CFSA 1JJVA 1IPEA 2P9QA 3JTMA 1OBFO 4KQGA 5G0SA 5KMGB 3E9ZA 2JZCA 5JCZA 1P5HA 2G0NA 5LNK1 2A3NA 1KQGA 2YJ5A 4KAJA 1XEXA 4F6CA 4TVOA 4TYWA 3OPYI 1J0EA 1SZCA 1LLDA 1VE1A 2TS1A 5IYDG 3EGVA 3PYXA 4ER5A 5EXSA 4Z7NB 3SMVA 1M6VA 2FLKA 2XF8A 3BCHA 3EASA 3WQRA 4C6HA 2MR6A 5C81A 5JSYA 3T4PA 5E7MA 5I7EA 2C7VA 3M1IA 2PFSA 1KVUA 3NIBA 2XX3A 1D8AA 1JJAA 3U3KA 4KQIA 2ZVDA 1UBCA 3B1VA 4KU4A 4AP9A 1ZD5A 3V6MA 2F3UA 1PJTA 4KX3A 4OXYA 2GRAA 5A0VA 2PMEA 3GLUA 3EBOA 4HAYA 1AHPA 4B5KA 2CW5A 2Z4SA 2ZRJA 3MJTA 3EZ6A 5AW5A 2R7LA 4RADA 1QPZA 4IR9A 1UZAA 2NYRA 1T34A 3WIDA 5AVTA 1QHGA 4U7HA 1EFHA 1JW9B 1WHSA 3TCXB 3IQHX 1OXXK 3R0ZA 4R40A 2VQFB 2WIAA 5CFMA 4NECA 4AKSA 1X8KA 4D46A 1F2VA 1JDEA 1ZXLA 1M0TA 3DBRB 4QX6A 5JMWA 1DG9A 2FEWB 2IX9A 1IZYA 3DOCA 3FHLA 3KS9A 4ZQCB 5E1DA 4BX8A 4TYNA 3F3MA 3KR2A 3M0EA 5IVPA 3KSAC 3HDHA 3G9TA 1IK4A 4FHEA 4XLTA 1PJ4A 1W87A 3GT7A 2GASA 2BEKA 4YQZA 3HOZG 3WIVA 5AI4A 1TUIA 5KOHB 2CFIA 3GLHB 4J75A 3EZGA 1PZNA 1NY6A 2GK4A 5AOAA 1O75A 4N39A 4RFLA 4ZT3A 4OA5A 3TO5A 2G1AA 1N6KA 1LSOA 1RJFA 1SC9A 1YZGA 1ZD2P 3MA0A 2IXAA 4ZCSA 4Z1MA 4F3CA 4HDNA 3JVEA 3OZBA 5DGHA 2YV5A 1AMUA 1WUTA 1QIHA 2WYUA 3FPBA 2G0AA 2WWFA 4DDWA 2V45A 1V5GA 3O8RA 3DLIA 3T1HH 2V7EA 1MHPA 3RVPA 1EM8B 1S9HA 5MFPA 4N41A 1D9ZA 2ZBGA 3HA7A 1RVV1 2XGMA 1O1YA 2HN9A 4MIKA 5JO0A 1T8YA 1E8MA 1MW9X 1JIQA 4WKGA 1N9GA 3IPXA 4HH3C 5ECGC 2MSLA 1YAHA 4BIMA 5F7XA 5JAUA 3DLTA 5JLJA 1P31A 1SCJA 1VJ1A 2ZJ2A 2HJHA 4X60A 4FUQA 3G82C 3BACA 4A8JC 4DC9A 2B4TO 5KYXB 1ODLA 1VKNA 2JLRA 2ZAIA 4U2CA 3W5BA 1HNXB 2Q50A 2NU8B 3V8VA 4C2BA 3JWGA 4O2BA 1BKYA 2Z0MA 3CTPA 1M0SA 4FQ7A 1B6GA 4YC7A 2BBWA 5FQNA 4TVSA 4WBXC 3HI6A 2D59A 1Z0SA 4X6UA 2P0AA 1R6BX 3LKVA 2FRDA 4JLOA 3LUGA 4Q1FA 3ZDEA 3VHXB 4YYZA 4MVJD 4X1KA 2EZ9A 3JZFA 1ZK0A 3VNUA 3P5SA 1I3QA 2X3FA 3K8YA 1NVEA 4ID9A 4KI0A 4KVFA 2X0KA 2CE2X 2H0QA 4ZO6A 4CL2A 3SQWA 2QG6A 1QIFA 2HVQA 1K63A 5C9ZA 1P7YA 3ZW9A 1LBIA 5CVVA 4EELA 4K2HA 4CLOA 1BVRA 2B4QA 4EY3A 1JEQB 4QGBA 1G3UA 4IGIA 1NC3A 5CLIA 1JIJA 3NTVA 4OHBA 4BMYA 3GGOA 5KPDA 1IE3A 2G3YA 3A3OA 3OUTA 2FETA 4HSGA 1Q1GA 4JT9A 4NZYA 1XMOB 4F6LA 2G1JA 3U0GA 3ELWA 1L8XA 1D07A 1E0JA 1LK0A 1T25A 4RCYA 2IUSA 3U1VA 4L15A 4LTNA 4K9NA 2X14A 4AZWA 4CF4A 2FSPA 5TMEA 3S2UA 1KAGA 1NWCA 2PGIA 4E08A 1XTRA 2IZOA 4LECA 4AULA 2KSQA 2D1TA 4FDLA 3QPAA 4ECUA 2DAPA 5EJMA 1NKVA 4CEHB 3DJFA 3GRPA 2ZTMA 3DTGA 1UEIA 1VJTA 2NTJA 5C8YA 3T3PB 3CT6A 4HEA6 4MYHA 1WULS 4N40A 3G2JA 2R93A 4M1EA 3THSA 1Z2AA 2INGX 3TUJC 4B7CA 1JVSA 3NPMA 1P2FA 5EMJA 3O8OA 1OHHA 3TAHA 3LUBA 2NZWA 1E9RA 1U3UA 2EGHA 1QAMA 1PZHA 4JBYA 1GY8A 1A3CA 3KL4A 3QG5A 1TZMA 3I9KA 3GUHA 4CIVA 2O8EA 3VJRA 2HU5A 1DCMA 3P9PA 4C0WA 2HO4A 2JAPA 4AN1A 5FUQA 3PHJA 3RYIB 4BO8A 2XBUA 1Q0QA 4R1SA 4DL6A 2PZEA 3E82A 3OPMA 4V0SA 1T3TA 1Q0SA 1WOMA 2DTDA 2I6TA 5ARCA 1RYNA 2KSWA 2FGJA 2G71A 2GCOB 4FHFA 2PLRA 1U0SY 4UMDA 3OLVA 1DWPA 4FKBA 1NN0A 3LWZA 2EP5A 2ZUSA 3PDJA 2C2YA 4QRIA 1JE0A 1QB7A 2YASA 2YWGA 2JRCA 1XO1A 3TSCA 1R6AA 3W34A 5JD6A 2E4YA 2ANBA 2CVFA 3MERA 5EKXA 3WWZA 3X1DA 3FZNA 3FTFA 4TV9B 2QRHA 2FLVA 1W34A 1BW9B 4QDKA 2H2WA 3KQPA 3SKVA 4RB2C 1DXYA 1NOIA 4NV3A 5DHRA 3OPNA 4M6WB 4YMLA 2K7ZA 4DLUA 4LY3A 2WLSA 3ZI4A 3IOMA 5AW3A 2E2HA 2J9FB 5E7QA 5FUXA 3FPAA 4DV2B 3MIIA 4AW9A 1G7TA 1YS4A 2XA2A 3JAKB 4UW9A 1KOGA 3OOEA 2RDJA 3HEBA 4GZMA 3LGAA 4FFSA 3URMA 4BN0A 4MR7B 5DTJA 1WL8A 3H9EO 3LZDA 5JO9A 5K3DA 5C4IA 1P0MA 4W9RA 4FFPA 2Y0SE 1NR1A 3H0EA 1P2UA 3C7KA 1HFKA 2A33A 1KFKB 2DY1A 1HFEL 1NVBA 1LCIA 1OT3A 3HBMA 2I80A 1P61B 1XVAA 4LXGA 4OHKA 5GZ6A 1NDQA 2R6R1 3LNCA 4FE4A 3TINA 1BQEA 4NBRA 3RU9A 4GRAA 1YI8A 1OLOA 4E70A 3KR9A 1TLTA 2BIFA 2AR7A 4IDAA 4MLPA 1S2DA 4KQ1A 3BL5A 2I1LA 4RF4A 3MNFA 4JBNA 1E4FT 2P65A 2ZQYA 4FNAA 1UBTS 5D01A 5BR8H 3TOZA 4DKXA 4ND2A 5CVDA 1KP3A 5A04A 3GG2A 5EP2A 3E7XA 4XI9A 5F77A 2B21A 4B43A 5FLXA 4P0PB 1AKRA 4O4IB 1SZPA 1SURA 1DXHA 4DV3H 3JD4A 5M29A 1RM0A 1DKRA 4BV2A 2CNVA 1E5TA 1DEXA 1DAMA 2WJJA 3W7VA 4ZVUA 3AGQA 1C1HA 3G9ZA 1I13A 2PRJA 5EN4A 2PZAA 3RTGA 1KKUA 2WD9A 3WGKA 5A1TA 4ZMSA 2HGZA 2MOKA 1QP8A 3I6IA 4O2BF 1C8KA 1F2TA 1G8GA 4W6QA 3STYA 1NDHA 1XI2A 2C9YA 1KSFX 4HDMA 2ENWA 4HH4A 3SPXA 2QIOA 2W6QA 1XC7A 1S2LA 3DXYA 4BIIA 2CDRA 3FZEA 5CEFA 5JTTA 5JFTA 4XR4A 3LVFO 1P4JA 4D9MA 4EZEA 3UJBA 1XVUA 2GT1A 3WGTA 1CY6A 2D2IA 1JALA 1JLLB 1TQ6A 3RW9A 4BPRA 1J2YA 1J7JA 4GOND 1N34B 4CQLA 2PRKA 5IAKA 1UJ5A 1XG5A 4GOXA 2OAGA 2IXDA 5KDOA 4JOBA 5A4IS 1LDBA 1M34E 5E6SB 1J8YF 1B0AA 4Q6BA 2EFEB 2GF0A 2Y1GA 3MWFA 3Q7TA 4GUAA 5FI1B 2RH9B 2W4IA 3DEYX 3I9LA 4S2EA 4V1CA 2EWVA 1MORA 2PA3A 4P08A 2OXIA 3TMKA 4ZPJA 4FFWA 1REQA 3DBOB 2IEBA 3DBHA 3BQ1A 1KVTA 3EGDB 3FDXA 3JQAA 4CM8A 1BN6A 1QIIA 3EYWA 2J6TA 1NGSA 4JQZA 1N2OA 2MSCB 4U7FA 5HKLA 3M2TA 3WYGA 3WYNA 5KZMB 4F8EA 3S81A 2PEYA 3JRWA 3BGWA 3KOOA 3VZBA 3FYUB 1JLHA 5C8VA 5DCUA 2V4RA 4XH9B 1R4MB 1Z0UA 3EDOA 3CZAA 5HBGA 3SVZA 3ZQKA 1UPAA 4EPTA 4LF5B 3FZQA 3P27A 5F5NA 3MSXA 1NBMA 5C51B 4FFLA 4NYEA 4NMWA 5LXTA 1AXRA 5AK6A 1PS8A 2XVXA 3D9QX 4DMFA 4EG7A 4EG3A 2C9DA 4L9RA 4DWVA 1YZKA 1PL7A 4RVUA 1W59A 4GO1A 2JVKA 3OQ6A 5G4KA 4GU5A 1P4SA 4RENA 1GNPA 3PEYA 3OLCX 1B0ZA 3PQ6A 3O0DA 2GAFA 3SHVA 1M1YB 4A8JB 4CM3A 4AY2A 5C1BA 1R4AA 4XRRA 1E7MA 1P5FA 4GDMA 4QSHA 4KJXA 4RNDB 4XTCS 4YP6A 4X64B 1ZR4A 2RK6A 3HEAA 4QBHA 4LFAB 3T9DA 1Z0FA 3JR7A 4WFJA 1NIJA 4LF7B 2NVOA 2CXPA 1VBHA 1E0DA 1GCUA 1JEQA 1IEQA 1P0QA 4FGLA 1CJMA 3CN9A 4X6XA 2FMKA 3TNJA 4IBOA 1XZGA 1YF3A 3ICWA 2GKSA 4DS3A 1ZL0A 5JCOC 1FDVA 2FMXA 4ESVA 1T1RA 1UP6A 3UK2A 4JI6B 5BW8A 2XCIA 3KXPA 4EHIA 4IAOA 4R8LA 4YT8A 2C0CA 3RIEA 2ZM5A 1OVMA 1JFSA 4O2AB 5JU6A 3IQWA 3FNGA 3RHTA 3PIDA 5K99A 3QEKA 1URPA 3OPYB 1P7PA 1R9MA 1G4AE 2XQVA 1RI1A 3ZI7A 1E9AA 3DBVO 4MRNA 1GSOA 4O2AF 1I6MA 4YAOA 5HF5A 2G9NA 1Q0UA 1YO6A 1K08A 2YZ7A 2KS6A 3A6KA 2OKCA 3FLEA 3K0EA 1JDUA 4YMHA 4LOKA 4IJ6A 3RS0A 1B2LA 2ZTVA 4ZYVA 3TTYA 1W1UA 1HUQA 1Z0IA 1I2LA 3AG5A 5J2UF 3GJXC 2WB4A 3MCVA 5DM60 3ORHA 3O8CA 3DKIA 4UAJA 2IPOA 2ZJ1A 2JCXA 4MPJA 1Y4SA 5IAAA 3NIDB 3NWJA 1PG0A 4Q12A 5H0IA 3RRMA 1SKAA 4EFKA 3W6OA 5SYNA 5BSFA 2ZWPA 2RHLA 4IZIA 3L4BC 2H1VA 3KYHC 3LC7O 3UWMA 2BQ3A 2C9OA 1ISJA 4MQ4A 3OIDA 4FJ2A 3SS8A 3UIEA 5A9SA 1L5WA 2VDOB 1WKCA 3BF7A 4YS6A 2IYYA 5FPRA 1B74A 3MT0A 2Q2UA 4Q0MA 5E1BA 4C6TB 3ER9A 2QT1A 4DCCA 3IMGA 1LQ2A 3LE8A 4K1XA 1H2AS 4OHRA 5AK4A 5DDIP 1XLWA 4ZRDA 1VGVA 2DJIA 5HF8A 4DG9A 1TQ8A 2C5GA 1U2QA 5JDIC 1K7YA 4CODB 1NASA 1NN1A 1QAQA 4HS9A 4HWRA 4RFSB 3GFBA 4ZWNA 2VUIB 3GN2A 3CX7A 3EFHA 2B6HA 2Q6LA 1RM5A 4GRIA 1RJGA 3NEPX 4FMBB 4RZUA 1XQ9A 1EK6A 4MO9A 3GH3A 4PGHA 5FTMA 3W2GA 5JYCA 2COKA 2G9RA 1R5OA 4GLOA 4MZDA 3C4JA 4OD0A 4AKGA 3H20A 3EIUA 5AKGA 4OVKA 4A91A 1SOUA 2Q2TA 5BWXA 4BY1G 5BMVF 4O7ZA 1KEVA 2HRDA 2XH8A 2ZBQA 5FP0A 4X71A 5PGMA 3R7NA 4JI3B 3LQYA 1P8JA 1RWPA 3LQSA 3RADC 2ZBRA 3DTVB 1IHXA 4NP6A 4R84A 4QASA 3Q87B 4S2UA 3T35A 3VVLA 4NFLA 4EW1A 4F72A 3DKRA 5ADWA 3W0LB 3PPYA 1NBME 3S1SA 2JGJA 1EINA 3IAUA 1TF7A 3GVPA 4KQXA 4M3NA 5T4FA 1ODSA 1VXOA 3IBYA 1R5NA 4DJJA 1QH1B 3EIEA 4Y6LA 1R37A 4CTNA 5FOXA 4U2GA 1T9ZA 4Y2SA 3BWCA 1DRVA 4UMFA 2V7GA 1FKAH 2BV3A 2Z1NA 4ZVRA 5EE5B 3MBKA 5CM0A 1N2ZA 3MW8A 5HVNA 4NLGA 1L8LA 2OFOA 3A3YA 2WWIA 1BRTA 4C7OA 1XKTA 3WGQA 4ZV7A 2QR5A 4CM9A 2GFHA 4KGZA 4F3TA 2NMVA 2JD0A 2X0JA 1ZEJA 2BVNA 3ZPXA 4R8RA 3GT3A 5JUWA 3G1WA 1TC2A 3DH0A 3K5PA 1HR0H 1BAPA 4FDTA