1B6SA

Structure of n5-carboxyaminoimidazole ribonucleotide synthetase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
355
structure length
351
Chain Sequence
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDRLGELAIVKRRTGGGQWRLRANETEQLPAECYGECIVEQGINFSGEVSLVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQARAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE SYNTHETASE)
publication title Three-dimensional structure of N5-carboxyaminoimidazole ribonucleotide synthetase: a member of the ATP grasp protein superfamily.
pubmed doi rcsb
molecule tags Lyase
total genus 105
structure length 351
sequence length 355
chains with identical sequence B, C, D
ec nomenclature ec 6.3.4.18: 5-(carboxyamino)imidazole ribonucleotide synthase.
pdb deposition date 1999-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02222 ATP-grasp ATP-grasp domain
A PF17769 PurK_C Phosphoribosylaminoimidazole carboxylase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 1b6sA02
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 1b6sA03
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1b6sA01
4MV8A 4O2BF 4O7ZA 1I7NA 4FE2A 2W6MA 4M9CA 4L1KA 4O7YA 4I50F 2YZGA 3RFCA 3GLKA 5JQWA 5CA0F 4MAMA 4FGRA 3VPDA 5FNVF 5D8DA 5HBRB 1Z2PX 1CE8A 3LP8A 2HJWA 4HQ6A 5JH7F 3N6RA 1B6RA 3KALA 2YS7A 3GIDA 4C5AA 4IZOA 2NPOA 4FFLA 5CB4F 3BSSA 2NU9B 5IYZF 1VKZA 4M98A 2CZGA 2YZLA 1OBGA 1UC9A 3TIGA 4HNVA 5GONF 5BPFA 2ZDGA 1SCUB 2FP4B 2R7KA 2PN1A 1EUCB 1KJIA 3HBLA 4WBNF 4IWXA 3AW8A 3JZIA 4ZHQF 3KREA 1EYZA 4EGQA 1M0TA 1BNCA 2ZDHA 2HGSA 1KJQA 2R87A 1JDBB 5LXTF 1A9XA 4O7WA 4O81A 2IP4A 2SCUB 1PX2A 4EGJA 4MV6A 5LOVF 1KC7A 1PK8A 3U9TA 4MA5A 3TQTA 2I87A 4O84A 1BXRA 2CNVA 1Z2OX 4XYLB 3RUPA 4EA9A 1VBGA 3JZFA 4XX0B 3HO8A 1W93A 5JVLA 4NYEA 3R9RA 1GGOA 2FB9A 4Y8VB 1T36A 2YL2A 4C5CA 2DLNA 3TW6A 1VBHA 2VPQA 1Z2NX 2YW2A 1W96A 3K3PA 5CA1F 4QSHA 3MWEA 3VA7A 1B6SA 3VMMA 1GSAA 3R5FA 4I55F 5K2MA 4O7LA 3MWDA 4HNUA 3VOTA 2YRXA 5LYJF 4IIJF 2VHEA 4O7SA 1GLVA 2P0AA 2W6OA 2J9GA 5DMXA 1WR2A 2DWCA 4XZ3B 2W6ZA 2NU7B 5BMVF 2Z02A 3R23A 4O2AF 1AUVA 2DIKA 2NU8B 2YZMA 2R7MA 2WYOA 4FFRA 4YJ2F 3ORRA 4FFOA 4MV9A 5J2UF 4MV1A 4FFNA 4MV7A 4WD3A 2X0SA 2FPGB 3K5IA 1JLLB 3G8DA 1DIKA 4FFMA 1JDEA 1A48A 3BSYA 2W71A 4M9UA 3OUUA 4YJ3F 2Z04A 3KAJA 3N8DA 1ULZA 4TUYF 2XD4A 5LA6F 4MV4A 4O4IF 3V4SA 3Q2OA 4O82A 3ORQA 2R7LA 2ZDQA 5BPHA 3G8CA 1E4EB 2VR1A 2W70A 4MA0A 2GLTA 4EG0A 3OUZA 2FPPB 5JVDF 3JRWA 2W6PA 1CQJB 2GPSA 2GQRA 5EZYF 1UC8A 1CQIB 3Q1KA 4TV8F 4O86A 5C1PA 4M99A 4YB8B 5C8YF 2CNQA 2YRWA 3BG5A 1EUDB 4O4JF 4ZOLF 2R84A 2GQSA 5C1OA 4EA8A 3WO0A 3R5HA 1KBLA 4YAKB 1IOVA 4ZI7F 1DV1A 3U55A 3MJFA 4EABA 3ETHA 2CNUA 4TV9F 1IOWA 3HB9A 3AX6A 2C00A 4HNTA 4O7VA 4IWYA 3RV3A 1KUTA 4O7RA 3WNZA 5HV6A 3I12A 1JKJB 5JQGF 1EZ1A 2R86A 4FU0A 3U9SA 4GGMX 2PVPA 2W6NA 1KJ8A 2V58A 1C30A 4O4LF 2R6FA 4DLKA 2NU6B 5J2TF 4O83A 1CS0A 3VPCA 1DV2A 1GSOA 3SE7A 3LWBA 4FFPA 3R5XA 4HR7A 1E4EA 2DZDA 2QF7A 4E4TA 4ZQIA 1I7LA 5H80A 4C5BA 1AUXA 3KAKA 3BSWA 1EHIA 3V4ZA 4EA7A 1KJ9A 2I8CA 3UFXB 3DF7A 4J6EA 5I47A 3K5HA 2V5AA 3U54A 2FPIB 3BFPA 2I80A 2V59A 2W6QA 2PBZA 4EAAA 2XCLA 3VPBA 4YBZB 2NUAB 1M6VA 4YAJB 2YS6A 4RZQA 2CQYA 2OLSA 4XYMB 1OBDA 3JRXA 4O7NA 4IHJF 3ETJA 2R82A 4O4HF 3TINA 2QK4A 2YYAA 2YWVA 3E5NA 5CAEB 1GSHA 2GPWA 4MV3A 2R7NA 1KEEA 1M0WA 1C3OA 3QFFA 2YZNA 3RV4A 2R85A 5KKNB 2VQDA 4DIMA 4I4TF 3NUAA 5KX5F 3TIIA 4ME6A 1KJJA 3WO1A 5LP6F 4O7TA
chains in the Genus database with same CATH superfamily
1XALA 4PG6A 5FOWA 5JMTA 1N8NA 1Z6AA 3FPGA 1IULA 2VWQA 4ZI3A 1VJ1A 5ILOA 1V0JA 3S0JA 2PMWB 1ZMRA 2P3LA 2PZJA 2C3YA 2DVMA 2LCQA 3OFJA 1FUKA 5JSQA 4XM0A 1FRVA 4EPRA 1YONA 4HP8A 4HNHA 2JLUA 5I5GA 1JXOA 3WADA 3EEFA 2X6TA 3VKGA 5ITVA 4N7BA 1HSZA 2D2VA 4QJBA 3THOA 3VNNA 2XAUA 1HM5A 5FA8A 4GMKA 3E9QA 5G0TA 3J80A 3HBLA 4BRWA 5FPRA 3BMOB 4DN6A 3UA3A 1GDHA 1EYZA 2Q4OA 1TQ2A 5DU2A 3ROMA 1GUBA 2ZRKA 2OM6A 2GUGA 5JUMA 4KJZA 1Q7TA 5FHRA 3DLIA 1WOYA 3ZLTA 4DADA 3PHHA 5D7NA 1T9GS 1VECA 1XNRH 4EGJA 1G6HA 4ZC8A 1XU9A 1YU6A 5FR2A 2JGKA 4FYMA 3RS8A 3KOWA 4LHSA 1J5XA 5D00A 4PIPA 4POAA 2A67A 3EXFA 2A0FA 3LKBA 5E4JA 5EJ7A 3VYSB 1QH1B 1ZZEA 4AG5A 3W5CA 1XYGA 4DCJA 2WPDA 2IPXA 3L6BA 5SY9A 3E58A 1LX6A 3STXA 3EC1A 1T3GA 3TLCA 2PGNA 3OIYA 4FCCA 2QE7D 1W5SA 4LUCA 1V3VA 5CTAA 5JI3E 4MAFA 2R3SA 4YRBA 3VNUA 5KFVA 3TFOA 2NSDA 1Y4AE 3TD2A 2WB1E 2A88A 2YZMA 2JFHA 3WSTA 1L4NA 3B2EA 4P4SA 4ECVA 2AXQA 1MFZA 1U4OA 4AO7A 5IZCC 5JY1A 3BSYA 1M34E 2GZDA 2GEVA 4KXMA 4Y1GA 2A92A 3UKOA 1J20A 4O0LA 3V8EA 1XEAA 1E2EA 4MV4A 4DL6A 4XAQA 1HNWH 1R5OA 4Y8VA 4PYRA 2WUFA 2KHZA 1JDVA 1E4EB 2GXUA 3RU2A 2PHZA 2DHRA 5ES3A 4PG4A 4F92B 1U99A 1GAJA 2G70A 2ZJFA 4UUAA 1IK6A 3E35A 1QMGA 5CDSA 1RR6A 1GILA 4F3TA 1O0BA 2FCRA 1LRLA 1F8FA 4L6AA 4RPGA 2O48X 2GM4A 4JI4B 3GV0A 3T4EA 4MK4A 3FWPA 2JAQA 4GL2A 3SZ3A 2GESA 1Z6QA 4GX5A 4JC0A 5CT5A 1CXZA 1R0SA 3A9WA 4N7MA 1AXGA 1TYBE 5JMPA 2IV3A 2ZB3A 4P22A 2OSBA 1D1SA 3BL6A 2JAXA 3OCYA 4UNQA 4EABA 5CDFA 3HT5A 1WHSA 2C2OA 1TT7A 4E13A 4MUXA 2DOKA 2E7ZA 4R9NA 3TB6A 1ACMA 3H19A 1ZXXA 3W2FA 5DCYA 3ZR4B 5C0OE 1GQRA 2PTGA 1KR5A 4OATA 2XECA 3VPCA 2W0SA 1PT5A 3MD9A 1AU9A 2FVYA 3SCZA 2CXTA 2YV5A 5H80A 5D3ZA 5KNDH 2OV6A 3FNBA 1ENPA 5KSOA 1BZYA 3R3ZA 2VK4A 2XQVA 3RVSA 4P34A 1TQ4A 4AULA 5BN3B 3PUHA 3K1ZA 3H13A 4CQMD 3ZYCA 3EVEA 3PQDA 1WXGA 3FMFA 3Q9UA 4K6KA 4ZOAA 2IVZA 2H07A 1EVLA 1ZOPA 3MUNA 5BORA 3QWAA 4ECUA 1ZOSA 2W57A 3RWMB 2EJ0A 1HR0B 2OAGA 3TG8A 3LHKA 4FFBA 4KYIB 3BFXA 3ROQA 4EFKA 2QRVA 4ZQCB 3AOGA 2R751 1EJBA 2R7NA 1JEYB 3F5SA 1C7JA 1GTL1 3UIEA 2WF5A 2HM7A 2GA9A 2XMRA 4AUEA 4FMCB 3GFGA 3IP5A 1VG1A 4DNPA 1V16A 1I7NA 2UUBB 3CLRD 4DV1H 2F6RA 3NBUA 5L95A 4R8RA 2Q2UA 1WPGA 1JR3D 1U1DA 1T9ZA 3G8YA 1XZIA 4PU0A 5EIAA 3LXRA 3MGKA 1ZVMA 3MLAA 5D8DA 3K4HA 4J91A 3OTIA 3DAHA 5IXJA 3FFXA 4Y2QA 2XVYA 5BNIA 4M38A 5CDTA 2WV9A 3UHPA 4BY1G 1ZVVA 1JVSA 1E1YA 4HH0A 2V7UA 1FVIA 1P1CA 4CTNA 2QUHA 3JASB 1U0SY 3OFNA 1X1AA 5D3MB 4HCJA 3B89A 3HXQA 3WISA 3ZJ5A 4PBTA 3K70B 3R7WB 2HLNA 2FLLA 3IAM6 3HVJA 1U9IC 3RC8A 2R7ZG 1A7JA 5KKAA 4P3NA 2ZQ5A 1PW5A 2FMHA 3UANA 4KPFC 1NXSA 3B52X 3VBEA 4MR8A 2X1LA 3KKZA 1TRHA 4G5OA 1AKRA 1I1MA 5KSZA 2B36A 5KTOA 2WNIA 2PM8A 3DKIA 5IJ9B 1MIOB 3DAAA 3DPSA 2XZPA 1XJ5A 3DDCA 3WP0A 3ED5A 2I6UA 2CWWA 3DNFA 5EMKA 4ZGWA 1QS0A 2ZIZA 3IIJA 1UOQA 2XYPA 3PQ5A 4HDOB 4GOOD 1YGPA 1FFWA 3OQPA 2P6NA 4P7FA 5LU9A 1UUFA 3FMOB 5SV2A 3F3MA 1HETA 1XVLA 3LT4A 4IHKA 4DLXA 3HKDB 4XWOA 5BO5A 2BTEA 4OHYA 4ECZA 2VNJA 2X7XA 2I29A 5I4CA 3EPGA 1AKWA 2IODA 4KXYA 1DUSA 3OTOH 4TYYA 4BAUA 2PH3A 1PS9A 3TN7A 4DJTA 1K6JA 4GPD1 1L4FA 5GAJA 4E22A 2DGDA 5CLQA 5F51A 5KSYA 4TV9A 5JJKA 1D6JA 3OZGA 3FKSD 5TF0A 3CZCA 3JXEA 3B5IA 3NBQA 4EHNA 4PZUA 5LD2B 4ED9A 1XD8A 3KQHA 2Q27A 3PRYA 1IXSB 3VDNB 2MOKA 3RFFA 4ES6A 2YXLA 2JJMA 3SHWA 5CIYA 2HVSA 3FCAA 4R40A 5BRJA 5M34A 4FE3A 3M8KA 5GVSA 3HCAA 4O4JF 3E5HA 1HDGO 4DA9A 5ECGC 3AOEA 1JDJA 4FNMA 4BB9A 3T9AA 1DJNA 4RVCA 2RB5A 4WESA 2RHDA 4JI8B 4Y2HA 1JTVA 4TQGA 1ZGHA 2ZGVA 4O02B 1OAOC 3SLGA 4GBED 2VJBA 4C3OB 1U1GA 2Q6OA 2FPRA 4XUCA 3GEEA 4FHCA 4M7RA 1M1ZA 4X41A 3FMGA 5K3WA 2OL4A 4UZFA 5LOVA 2BBWA 1S8AA 2YH2A 1AKEA 2Z3VA 4DMLA 1YWGO 4BEJA 2GD1O 4YRAA 1X7ZB 2EJWA 1YKFA 3O7MA 1EA7A 2GRJA 3MSCA 3DV0B 4YGXB 3JVVA 3MJRA 5DFAA 2QF7A 3D6MA 2D4HA 1IM2A 1XLVA 4Q4JB 3JV7A 1E9DA 1B6GA 4RLHA 3OQMA 1ODCA 3C74A 2BKEA 1ULUA 4QOJA 4QA9A 2YFKA 2VKQA 2CFTA 1L1RA 1AE1A 4QYSA 3ND7A 4FD2A 3RYIB 3PNVA 4YCMA 4GMDA 1HK7A 3RLFA 2Y0BA 4E5DA 1P44A 2BDTA 1X9NA 4CG3A 1N2HA 1SN7A 1Q0QA 2V7VA 1EWTA 4KXLA 2UYHA 4OP3A 1GSHA 4TKUA 3PT5A 3IQFA 1GGKA 4HG2A 4EY7A 4JVSB 4U6SA 2CDAA 4DXHA 1DC6A 4JUAA 2VPSA 4CR8A 4M36A 5TSDA 2AKAB 1VKRA 4X0EA 3OX1A 3CMCO 2KPOA 3E9MA 5DJ5A 3CWCA 1S3IA 2ZRMA 1RIIA 3EDRA 2CL0X 2QLLA 5ADWA 2J45A 2ZPAA 4MYTA 3FI0A 4PHFA 5BWWA 1KORA 1O8CA 4J75A 3WL8A 3OX2A 4XSHA 4AUMA 4U2GA 5GONF 4OXQA 3PKZA 3N2KA 4AS3A 1WQ4A 5JJLA 4IWXA 1UIMA 5F7XA 1P9NA 3NOQA 4F5ZA 2IHYA 2ZJ2A 4ROSA 5AJYA 2QX7A 4NZYA 1UKVY 3ZNOA 5G41A 3JQBC 1CY7A 5T14A 1G5PA 5T4EA 4Z1MA 4QHTA 5B58C 3VR5H 1RWWA 4WZZA 2BZ1A 3ET5A 1U0TA 2C5HA 1VIMA 3F7TA 3BE6A 5FB3A 5HE8A 1UT8A 4LQLA 3H4BA 3GUCA 3INNA 2E4UA 4II3A 3NIDB 5FEMA 3R9RA 3O6VA 1RI1A 5AYVA 3CPEA 2OHHA 2Q0HA 1RI4A 4C08A 1U4NA 5NULA 1H0RA 3NHFA 3DUFA 2GO7A 3K0FB 2FPKA 4CLHA 4LOLA 1RK5A 2G0AA 3U5TA 4GEKA 3FGZA 4KRXA 4WADA 3RPEA 4KOEC 4UZSA 1SVKA 2WD8A 4ZVMA 4COOA 5KVSA 2W6OA 1D0VA 3MB8A 2X0FA 1KJWA 2IA6A 2YHIB 3IT3A 4ZVTA 2FG7C 1JEQB 2H17A 2YC4C 1Z7YA 3WB1A 3Q11A 3K4PA 3KUCA 4IWNA 1RRVA 2HCTA 4PE5B 1DS6A 3OZCA 5LXTB 3CC8A 5FJIA 3CUYA 2X5XA 4LYDA 4PPGA 3CLUC 2G4LA 5JCJD 3SS7X 1F0YA 1RVV1 4RLSA 3E81A 2XD4A 3DDSA 2A9KA 2GKSA 1XKQA 1ZGJA 4XDYA 3TKAA 1MOPA 2L0XA 2E48A 2NWQA 1Z47A 4CL8A 2XLCA 1Z9BA 2XMQA 2X1VA 3R6LA 5TJHA 4LJ8A 5C1PA 1SBHA 1G4UR 1E3SA 3T5LA 1JJVA 1JDZA 2HXSA 4BVKA 1J9ZA 1M33A 4TVKA 1TM7E 5A05A 2JLXA 3R3VA 5JZ9A 4XZ3A 1CUIA 4A0SA 1Q22A 4E1AA 2I3AA 2IU4A 1EAYA 3C3MA 4CKBB 3ZJVA 1GRRA 4LFCH 3GFSA 1OBVA 1TGYA 1U31A 2ECPA 4JJ8A 1AJEA 2IYOA 3HY6A 1DL5A 4X45A 3DWIA 3WOVA 2XYRA 4MVWA 4YI5A 1YI0A 1GFSA 5HIAA 1JHOA 4QGFA 1GR0A 3GG2A 2PGOA 5LA6B 4CE5A 5BWXA 1UJ5A 2O8EB 5LB4A 3EGEA 3IA2A 4IRKA 4ISBA 2J59A 2PRIA 5G4KA 3NFRA 3VTZA 4IUBS 2RHLA 3OD5A 5DX8A 5AJUA 1PUIA 1Q16A 1A5BB 4GSYA 5FADA 3V4ZA 4GVXA 3L7MA 3GT0A 3CEPB 2YFHA 1HH4A 1CUWA 1CY4A 3F2VA 8AT1A 1JJFA 3OQOA 4N7JA 5JECA 2YKGA 2I65A 1UXOA 4FDAA 2JEJA 3GMSA 3MPUA 3UB2A 4HDSB 5I4IA 2R11A 4BLRA 3RVMA 3ZHXA 3ZWYA 2C03A 4AMZA 3RAFC 1G4AE 1GRCA 4R1NA 4LFBB 2AIRA 4YRFA 4ZXFA 4UHFA 2CLSA 1DC7A 2YOFA 5C18A 1GZ5A 4ZC1A 1FUYB 2YWVA 1NFRA 1OXBB 3RIYA 4JKYA 4ER3A 2W8ZA 3GJ5A 1QU2A 3MGGA 4R1LA 5GM1A 3OVMA 3GGOA 3W5SA 1YJBA 1RPZA 2ZB8A 4OA8A 4GHWA 4YR9A 1V8PA 3M9OB 3N6XA 1R6AA 5JVDA 2ZOSA 1X38A 5LZ2A 4Z9BA 3NUQA 2D7CA 2YV2A 3ZQUA 4J03A 3S2SA 3VM6A 3Q10A 4KBGA 3VNRA 2A7QA 2IZ1A 3RJ9A 4JB3A 3JWJA 1SNYA 1M6YA 3U17A 4PLWA 1OFIA 3AONB 4MGIR 3UOWA 1CDZA 2X8WA 4HNVA 1O75A 2BR5A 2FP4B 4XCQA 1QRUA 3X1JA 4BP9A 3LUFA 3NGDA 1N5OX 4DTIA 3AEUA 3BTUA 3CPJB 2NVYA 5GJVC 3S1LA 3AVOA 1IBKB 1LBTA 3NBZB 1J0AA 1NN1A 3B85A 2OLJA 2HK7A 2HEGA 4N6GA 4LF7H 1FRFS 3TPZA 3S81A 4U2KA 2XR1A 4O81A 3IAUA 5FPQA 5E9AA 1HE1C 2QUZA 4IYJA 3QF4B 1QFSA 2DR2A 2ZYAA 2IIVA 4FC6A 5A4FS 1F4LA 4FUTA 5F7ZA 2HHJA 2R97A 2QZ9A 3LQSA 2IGBA 1EINA 3I8OA 1US8A 5JSHA 4NCIA 3W7BA 1Z0JA 4KXWA 3S68A 4DR6B 5KFRA 3GD5A 1TD1A 3NAMA 3RG8A 2AFHA 4O1MA 4DSNA 2UZ1A 5IYZB 4AJ2A 2HA7A 4OKSA 3O0DA 2HBZA 5EWJB 1RBQA 1FFAA 2WZQA 3OOSA 1FVHA 5ALJA 3TD6A 2EYQA 3KP1A 3ONEA 2UVPB 5CP8A 3USZA 3LY7A 2FZCA 3FETA 1V11B 1D5CA 5IFLA 3PN1A 1RRKA 4CEIA 1OX4A 4D9IA 4TXNA 4Y1FA 4YVFA 1SA0B 4MI6A 1S97A 2C2BA 2ID9A 2JAUA 3W3AH 5TV2A 4EB6B 2QN1A 2P9GA 1V35A 4CKYA 2W93A 3V1UA 1YXMA 4OQ4A 1JP7A 3EOZA 2V3VA 5B3JA 2XRZA 4AU1A 2A5FA 3ZUGA 3NNNA 5U1PA 2AVNA 5FTLA 1ZQ9A 3U3XA 2E4YA 1Z5GA 4MS4A 4Y67A 4BVHA 1WXEA 3QNWA 3ETGA 1X7WA 3SBOA 2WINI 3GEIA 1N77A 4ED7A 3UAYA 3ZWOA 4ZYVA 1SXIA 3KE9A 1JXMA 5GV8A 2QTBA 5HZKA 3FDZA 4Q05A 3DOJA 4Z5XA 1JE0A 2DUJA 3ZD7A 1VP3A 2ZI4A 3IDZA 3KB6A 2BQUA 3NC1C 5LMZA 1PJSA 3U19A 4BNWA 3PXDA 4LWPA 1P72A 3BHIA 5EGNA 4UCOA 1EDZA 1OMOA 1Z5OA 3CJRA 1H0KA 3LPNA 2C57A 4JAVC 4Z3KA 4AJLA 1HDEA 4C3ZA 1YZGA 4AMVA 3AUSA 4EEQA 1T3HA 4G4GA 2FGKA 1E3IA 1JZTA 5CA1A 2TMKA 4HQRA 1CKMA 1Z08A 1EPUA 3HL0A 5BWUA 2EJ3A 1L5HA 4HWOA 1K98A 4L6CA 5KTYA 2G5GX 4EFLA 1KXJA 1JRLA 2B99A 5JNTA 4UTRA 3CJQA 4RGBA 1K2VN 3CQZA 3CEBA 3QU9A 1F17A 1U2PA 4HQLA 1QKKA 4X65H 1SIUA 4WY2A 2C2WA 1X7YB 2R2AA 3DLTA 4HK4A 1QYVA 2G88A 4UTVA 3K9WA 2B37A 2Y6VA 3QFFA 3PWKA 3F9RA 1XNRB 4ZVRA 3Q6NA 5C81A 1NYQA 3H1EA 5CIWA 4XX1A 3SC2A 3UVEA 4LNUB 4O7TA 4B87A 4E1VA 3PGVA 4RDIA 4BNLA 3D4NA 4TS9A 4NZ9A 4PYLA 3Q0TA 2ZR8A 5CA0F 1HRKA 1QGOA 1SBNE 3R76A 4EGSA 4C6SA 5HBRB 1RRCA 4XDGA 3SVZA 4DLYA 1X15A 1KMIY 3P0HA 5AK4A 2FJ0A 3A4VA 3DLBA 3JD4A 4HZUA 1IH8A 2O4CA 4MDEA 1VG0B 2G8NA 3U13A 2GLUA 4IICA 3K53A 3RDPA 1FP4A 2WF7A 2QJOA 3GTKA 3ZZNA 7MHTA 4IEFB 2PN1A 4HEA1 4H4CA 3MINA 3HQ4O 4ZHQF 2ZYIA 4HX2A 5AVJA 1QF9A 4Q93A 2OB2A 5FPOA 3TH5A 2EJVA 2DY0A 3NBAA 4AKSA 4BVAA 4E07A 1FUEA 2DAPA 4YBRA 1V8DA 4LOHA 2M6LA 4AY5A 2WIDA 1ODSA 2V5VA 1WY5A 4UUBA 2O2IA 2DULA 2XODA 4O4LB 4Y2UA 5KNCH 1N2IA 4WINA 1Y7HA 5CNKA 2GI4A 5KQGA 3LNTA 2D1RA 1DLJA 5I7RA 4Y7DA 2G1UA 1XHFA 4II2A 1FXSA 4EBEA 4FDMA 3R0QA 4D0NA 1E5DA 5DCLA 2AS0A 2WM9B 3EZ9A 4JR2A 4BMVA 3V5NA 1JDTA 3PUXA 4QYWA 4ZQBA 5F4ZA 5AKHA 1HC7A 3GP5A 2CNWA 1L5NA 3ZWBA 1DEXA 2V03A 2MU1A 1OZHA 1P5ZB 4ALMA 4BLWA 2ZUSA 5E7QA 4PVCA 4PPYA 3UPTA 2D1FA 1L9XA 2BEWB 4FYJA 2Q3FA 1X74A 2ZU0C 1MABB 1YBVA 1FE8A 3M6VA 5LZ9A 3DE0X 1FLDA 2PFGA 3QMWA 4PR0A 2VJMB 5HJ5A 1K86A 3NHLA 3G2MA 2ZDQA 4LDJA 4F2HA 1G2OA 2HJRA 3W6ZA 4ARIA 1BA3A 4WAUA 1E4FT 4CMEA 4YIHA 4HATA 3PBKA 1AZTA 2ZG6A 1EXNA 2QPLA 4Q24A 1V6SA 1SUCA 5DEIA 4IDBA 1VL0A 3EQZA 3MBOA 3ZCUA 3TLGB 3A3KA 1HO3A 4YONB 3I5YA 3EZNA 3EDCA 2C98A 3EYYA 2ZIVB 1SEIA 2G67A 3W77A 5JSZB 4D25A 2YJZA 3TZLA 2EOAA 3ZWWA 4MV5A 1SQ5A 1P7PA 2BMJA 4P92A 2ZRJA 4BOYA 4LZWA 4C2MA 2C54A 1L2TA 2PSEA 5ULLA 3QHAA 3O7WA 4KLAA 4E08A 1SXJA 5AKYA 1NBEA 2DQSA 2FN4A 1XZHA 2BM0A 3RSOA 2W6JD 2W83A 2X9LA 4K7JA 1DARA 2A1UA 2GT1A 4IY1A 2OBBA 3WTCA 1F4VA 3IAS6 4XQCA 4QOFA 4AF6A 1GL9B 4R7TA 4DV1B 3GIQA 1ZL2A 3D6AA 3GYBA 1FJGH 2WAYA 2GMWA 1TEHA 5B1SA 1EIWA 2EDAA 1U9CA 3KLNA 1NVFA 3A37A 4NJMA 5E2IA 3IKMB 1P5HA 3FYUC 3D7NA 2GPTA 3AUUA 5BWBA 5A4AA 4P2BA 4CMHA 3DVLA 3C5WP 4YR3A 4ECSA 4M83A 1J90A 3EGOA 4E6PA 1AB5A 4YLGA 2ZIUB 2QM3A 3KR9A 3LGAA 2JJ8A 4L8VA 2OORA 3EGXB 3D9QX 3ZN2A 2AH5A 1Z4KA 1NDUA 3AI3A 5TMDA 3CLTD 2ZWOA 5DG8A 1UQRA 3GFPA 2YJ4A 1FSZA 2C5AA 1SBYA 3GAAA 1KERA 1G8GA 2XYHA 3W6NA 5D1OB 1KDOA 2N3ZA 1SXQA 1TVEA 5K0NA 4TTRA 5HZHA 1KY5A 1KT8A 4NHEA 2Q62A 5EE5B 4J6FA 2MHCA 2QX6A 4AZ0B 4MW5A 2XYQA 3G7NA 3OIDA 3O2JA 2XE6A 3DHVA 1PIWA 1TEXA 1W9HA 4UUNA 3HE3A 3GCGA 3SHQA 3WGOA 2FKLA 1PNRA 4JSYA 1TU0A 2YN0A 1M7JA 2EQ5A 4BFVA 5FWYA 2C4UA 2ZT5A 2XY4A 1PHRA 1JFLA 1BS1A 2R79A 3QYFA 4C3VA 3T5AA 2JAOA 4K9NA 1SQGA 4IV5A 2HPVA 2P7HA 3B3GA 1Z4NA 2OZEA 2PGAA 3LX6A 4WBNF 1JI3A 3MLEA 2CL6X 1Y1WG 4PICA 1XZMA 4EY8A 2NOAA 3A1NA 3OEHA 1ZN8A 3DCNA 3K92A 2DFVA 3FUWA 2WMDA 2EZ8A 5L7WA 4IH4A 4RQAA 4ER6A 5J3JA 5KNBA 4EH1A 3JSAA 3TQRA 2C8KA 4RFSA 3WRVA 3F74A 5C44G 4P0PB 3ILXA 1Q1ZA 3ZY2A 1IEXA 4C3UA 4YX9A 4RKWA 2BFPA 3UK2A 2AD1A 3M2TA 3DUWA 1GTMA 1LI7A 1E2QA 1QIMA 3AR8A 4OI0A 2QW1A 3GL9A 4F3RA 4LDQA 5JXGA 4OM8A 1RYSA 4CGZA 1GL6A 2I33A 3GNQA 1N3BA 1BKYA 5FPKA 5F33A 1C9MA 4C7BA 1TLFA 3LLCA 4J9LA 4QEKA 1IEVA 3WGZA 5DNCA 5IS2A 4RA6A 3PFGA 2JBAA 1OIXA 4MUFA 4FBGA 1HNXH 5KWVA 2EF1A 2W71A 4E3WA 2XOKA 2J9XB 4UFPA 1XAJA 4G8CA 3H0KA 4O4HB 4IDQA 4X44A 4HJRA 2R1TB 1J9EA 1P9RA 2ZSUA 1XEFA 3Q9NA 4WN9A 4B35A 3UXHA 4WLNA 3STYA 5IZCA 2B4YA 3RGZA 5HGJA 4FN4A 4W1PA 2A0UA 3C7CB 3EZ2A 1JX6A 3L82B 3PJDA 4YUWA 3PXEA 3BA1A 4RM2A 3JQGB 3LF2A 4F5WA 1Z8FA 2BP7B 4RB1A 4JYAB 4QXRA 4MX8A 1XRRA 2FWIA 1U8YA 3ZW8A 3H4IA 1TEZA 2XJ9A 4KH1A 5SZKB 4HNGA 3A28A 3JSNA 3S7ZA 3KDSE 3L92A 3GJXB 3OLCX 4DWWA 4PHTA 2G04A 1D5WA 1DAAA 1YCFA 4H7KA 1LTHR 2GN0A 3DJFA 4NBSA 1OIVA 4MIOA 3RV3A 1XKLA 3EF0A 4XJSA 1RABA 3BA6A 2YXPX 4OU5A 3RWBA 2C1EA 1QFMA 4FYVA 2QVYX 4BWFB 1XE3A 5K05A 1N5RA 1Z0DA 2WSLA 2YIMA 5TB5A 3C7AA 3AFIA 2GBPA 3I2YX 3QUAA 5EUBA 1Q7GA 4JQSA 5IG2A 2Q3MA 2X0KA 4HMQA 4MVYA 3SI8A 1NVGA 1SELA 4MKRA 3I92A 3PNMA 2H4XA 5DBOA 3AUJB 3WRXC 1U90A 3KJZA 3OFSA 4RY0A 2FMTA 4B3TH 2OE2A 4DIDA 1W2HA 4IVPA 2OG2A 5EKUA 3W1EA 4KI0A 2P3SA 2YS6A 3ZHBA 2HLPA 2WICA 4KR9A 5CCXA 1WXIA 1JHZA 3K2BA 1YQUA 3GGPA 2P5YA 4WNAA 3TDKA 4BX8A 3T38A 1NG9A 2ZBFA 4KQ6A 1DFGA 4MKIA 4F9EA 4HPJB 3ELWA 3VJRA 1E2KA 3MUOA 1EFTA 3HH8A 1PEKE 1O57A 2RJNA 5EWEA 2O8BA 3ZLVA 7YASA 3LU1A 3BRWD 5EERA 4IFEA 2YOHA 5AOBA 4DZTA 3ILVA 4OXRA 3S3TA 3GIDA 4J2HA 2UUPA 3KEFA 4YJHA 1PZEA 1XMXA 3SBDA 1E0SA 1SKQA 2HFKA 1OY1A 2OC4A 4TV8B 5HXAA 3JU3A 4LDPA 2I9PA 1Z36A 2WLTA 2WUEA 2R7KA 1K4KA 5CB6A 3ICVA 4LZJA 1E1QA 3A1CA 3K0EA 4MVXA 4J43A 4IHJB 1Y9EA 2QNRA 5IASA 1UJCA 2O6HA 1H8ED 4K6HA 1HDXA 4WOBA 4ZI7B 1LS1A 1NXVA 4J4BA 4DV2H 5HM8A 1DZIA 2D5BA 3MWFA 4KN8A 4EO4A 1U9IA 3GT7A 1S8FA 5EHXA 1DO0A 1IXZA 2YV1A 4JLBA 2X7HA 3NYIA 4CM8A 4FS8A 4B8YA 1A9SA 2UYOA 2V6IA 2NNWB 5BVGB 4MYUA 3NDJA 3IO5A 5K0GA 3NORA 3KUUA 1Q1AA 4CTKA 1PWZA 2PNJA 4Q45A 2AQ8A 3WL7A 3HYLA 4R8LA 1FDVA 1KMMA 3LUGA 2ZROA 4BP8A 4GEGA 3GEBA 3F6RA 5TMEA 3TX6A 3B82A 2GHQA 3TAUA 4RTOA 1LWOA 1ZK3A 4U7TB 1XZBA 4D4KA 1MIHA 3N75A 1F7UA 1IY0A 1XRNA 1NBAA 1FX0A 4UXHA 3HBMA 4G97A 4ENWA 1LF5A 3OCWA 1N75A 3K0HA 5CYGA 2ZITA 5A4MS 2YWCA 3OKAA 2V7TA 5E3JA 2XXAA 1IU9A 1NR5A 1KARA 3IVRA 5G40A 4IR1A 5FCDA 3FVWA 4HMPA 5JYEA 4CMGA 4Q48A 4RD1A 3HKCB 1OFTA 3LGXA 1E0DA 1FP1D 4HT3B 1DXQA 3GW8A 5GIPE 1XJQA 1L7DA 3AIKA 2CV0A 3EUWA 3T9BA 4DG5A 3B6MA 4LKOA 1RYFA 1H2RS 1U1FA 1ZD3A 5F1YA 4EO7A 3A6ZA 1YRWA 4YRMA 5M29A 1ZMOA 2GBFA 3M6WA 4FS3A 3O84A 4ILKA 1SVWA 3MJEA 3QVKA 3VSCA 4K9SA 3C8HA 1AA6A 2PJRA 4XGNA 2I3BA 3I4MG 3PR5B 1VG9B 1I2LA 1OT3A 1SRRA 1X2EA 2EHJA 4X97A 3E9DA 3VKWA 2OAQ1 3KJHA 3L1JA 4E94A 5A3VA 4Y1RA 2YY5A 3PQEA 5DIFA 1K88A 1PS0A 3SZOA 1QX3A 1E8NA 1XRQA 1PVOA 1FA9A 1OAOA 3Q0EA 1QLWA 3RTAA 5JISA 4A2AA 1MX9A 3I3OA 4IJUA 2OWOA 4IIGA 3TRHA 3WGLA 1E64A 2YXNA 4K9PA 3LF1A 2QMYA 2CVQA 2I1QA 3QY9A 3GN2A 2RMKA 1T4GA 4UC0A 3AM1A 4OIMA 4EMUA 4YP0A 4FTWA 5ANRB 1TRKA 4KAAA 1PQUA 1J1IA 1U28C 3UV7A 2VT2A 1V6CA 3MCUA 4EO9A 3ZKWB 5GGXA 3CZRA 4FOOA 2EAUA 2Q1WA 4XARA 2RHOA 3BFJA 1L7BA 3KAQA 4JJKA 2XIJA 1F7VA 1XVAA 1MR3F 4Q19A 4FXOA 4MUEA 1YZUA 1Z2EA 3KTAB 1TADA 1THGA 3OIFA 1MAHA 1ADJA 5JDCC 1NLZA 4HS4A 5KIAA 1XTVA 4XYEA 4MR7B 4PTZA 4C29A 1YIAA 4U2CA 2AJTA 2VI5A 3H2HA 4AO8A 4XPZA 2FG6C 1DC5A 3H1GA 4EYQA 1FDIA 1I6MA 1A5TA 3CZ9A 2H65A 2Y3IA 1S96A 5KG3A 1Z2PX 2NZYA 4KMRA 3BZBA 1ZR2A 3WLTA 1K1EA 4D0GA 1Q92A 2FYTA 1I4WA 3K6SB 2FV8A 3DHEA 1NMXA 1M75A 1QH8A 4B2PA 3WGKA 3TTWA 2NU9B 4ND8A 1QHFA 4G85A 2F9MA 4WLOA 4GH5A 4LFAH 2OUKA 4UREA 3KB1A 3JZDA 3LT2A 5ECYA 4WH0A 1N3YA 4Y0NA 2EU8A 3ZV6A 2MINA 3SR4A 1T6NA 4GVLA 3UJHA 1GKKA 3WIVA 1RAEA 4NFYA 4JY7A 4JV1A 1TK9A 4XVRA 2Y1WA 1S68A 5EJ2A 2NVWA 3IUQA 3STTA 3Q6MA 3UWOA 4BCBA 4I4TB 3OJXA 2J6UA 4N5DA 1OGJA 1XELA 4W6ZA 4LYYA 1MA3A 1C4KA 4IS3A 1G9SA 1R8JA 3ABIA 3JQBA 3R3SA 5FJJA 1NBME 3H4DA 4LMRA 2XKBA 4IMRA 3U39A 3CH4B 4HLCA 4NZOA 4ZVSA 1ZEJA 4NZMA 1I4LD 1Q84A 1NOIA 2O8FA 3U3KA 4C78A 5AQEA 3L79A 4H18A 2C7VA 3I3SR 1R5BA 4UASA 4YUZA 4U2FA 4ZI2A 1YQGA 5I3ZA 3I01A 4PRKA 4TVBA 1ISPA 5DGDA 4QATA 4F4DA 3AR3A 4IG4A 1AHNA 1E1NA 4PXSA 4YMSA 3BBPA 4I2VA 3P2OA 2FK8A 2EFGA 1QCYA 1V1MB 2V4MA 2WDPA 1ODFA 2F43B 4GZMA 1PJ8A 4JB8A 1H94A 2RARA 2XGGA 1IIBA 4LJAA 5FUMA 1J07A 1GV0A 4E88A 3MIZA 4FB5A 2VATA 1C41A 1KI4A 3ORQA 2WJ6A 2XNSA 1VE9A 4DCGA 1WABA 1PW7A 2A9FA 1RQXA 3KLMX 1D1TA 3RHSA 1HBJA 3RUAA 4ZO8A 2C20A 3OZEA 4MI9A 2VBCA 5JS1A 2RKWA 1EUDB 1T4CB 1VFNA 3T5MA 3I6IA 2COKA 5GV7A 2QL9A 5J4KA 5HIMA 3QV2A 1PTJC 1VBNA 4ZODA 1GL7A 1F9EA 1L6IA 4IOLA 4Y7CA 4X65B 1W49A 3KYJB 3PDIA 1GPYA 4XOIA 3K05A 1LPAB 1BGXT 2CBGA 5E1OA 3RYCB 4OI4A 3D4IA 2EC5A 4LQ4A 3N0RA 4KO3S 5I51A 1PNQA 1GG2A 5K1ZA 2FSSA 1AQJA 1E9CA 4NPAA 5GJCA 5ICEA 1L7NA 1Z38A 2OEPA 1O5OA 4E15A 1EJ6A 3LWBA 1BCRB 5ISMA 3C16C 1E7YA 4TKLA 4C76A 3BH0A 5FHQA 1J06A 3Q3EA 5NLLA 2Q2QA 2YN4A 1USKA 4YP3A 3NTUA 1IDN1 4MUGA 4MKXA 3B38A 3BN3A 4GKVA 3ROFA 1VB5A 5FWDA 3OX4A 1Z0AA 2BMDA 2RGWA 3CX8A 5KFLA 1UZAA 2A9OA 1B6TA 2NN3C 1QB8A 3BAFA 2GHTA 5KQLA 4NOLA 1L7OA 4AF7A 3PZBA 2X0RA 2BFOA 4HRAA 3VYRB 4A3DG 1QHEA 4IOKA 1J99A 1Q7EA 3SQWA 2O2HA 4BFLA 4O7NA 1X0XA 1ORIA 5HPYB 1PQPA 1ZM2A 2BLNA 3KJNA 2NO4A 3E70C 1SULA 2W2LA 2OMEA 3BHMA 3SYKA 2H57A 4ZVPA 4F45A 1L3IA 1CRWG 1JDPA 3FLBA 5CLJA 1TO1E 3ZI4A 2QG9A 3GY0A 3F5QA 1VE1A 1OI4A 1JBKA 1GVNB 4NYIQ 3JQQA 2PZFA 3H05A 2J08A 4G86A 3PRJA 4JBWA 5GQSA 1TZKA 1FMCA 5LMNH 5ADHA 1H65A 1NI4A 3N8KA 4EHBA 1FFYA 4TM5A 4EELA 2FPIA 2DLCX 1L5KA 3ZCVA 1AK1A 3FSRA 4DSUA 3ZHZA 3DMFA 4KOAA 1AQLA 1MNQA 5FBLB 4RUCA 1L4MA 4ZA2A 4GXQA 3GDGA 3K8QA 2FEOA 2SCUA 4UBIA 4BS9A 3CUTA 4XTCS 1Y5NA 3IPCA 3RG2A 3ZHCA 2EGGA 1UBCA 3E8MA 1Z62A 2OFPA 1QYCA 3V4LA 4YHBA 3IMEA 2AGQA 4LV6A 5LXTF 2BGKA 4LC1A 4E6NA 3V1NA 1KC7A 1ZIXA 3D2CA 4YCNA 3X2SA 4XGQA 2FQXA 3G5UA 5A71A 3DP9A 4V0NA 4JBYA 1AF7A 5KJFA 2DLNA 5KDLA 2V55B 3WNVA 5HIKA 4AF8A 1GQOA 4URYR 3QLTA 5FJ8G 1MB4A 3DZBA 4JJ4A 4B79A 2A3RA 1TMOA 4LF4H 3BCHA 2DCMA 3E48A 3DHWC 4BFTA 3DD5A 4KXFB 4FR0A 3W9YA 1RRPA 4LGVA 1N2JA 4KPUA 3VPHA 3AB8A 2IIPA 3GAMA 3HVRA 5FUYA 4MWGA 5K3FB 4U7FA 4M0FA 2H1WA 4XVCA 3VSDA 3I64A 2JVIA 3GZ4A 1PR5A 1T0BA 1T9BA 4NV3A 3DTVA 2Q6IA 3MWGA 5DSZA 3AVPA 1AX9A 1YOVB 3L7KA 4C89A 1RI5A 2BONA 2JFOA 4EBDA 4CIDA 3JCZA 3T1VA 4KFCA 1LBHA 4FGKA 3QXHA 2I71A 2WW8A 3UGTA 3OUUA 2Q5EA 2IHTA 4F38A 4JYCA 4FMDF 3ZXUB 1UK7A 5LA6F 1VPWA 2JCVA 1CZLA 4LISA 1J5EH 3RHTA 1PGJA 3LVRE 4L74A 1FJGB 1XZKA 4JLMA 5IN5A 4DV5H 3Q8QB 2C42A 3OUZA 1KYVA 3AI2A 3MOGA 4BDTA 4IJ6A 3PNBA 4Z53A 4C6TA 4O2BB 5A9RA 1UJ4A 3ZGZA 1MORA 4NFSA 4GZ5A 3SICE 2VP2A 3RBEA 1A1SA 2P90A 1KYQA 5LYJB 2I1LA 3IQZA 2P4SA 3HO1A 2V6GA 4EHIA 3MT0A 5C2JB 1O87A 1GQ2A 3AKCA 4B5KA 5EC8A 1PG2A 3UB3A 1HKHA 3RVRA 2OBXA 4GLJA 3T4PA 4BQPA 5L4NA 1L1FA 4KXXA 2EFCB 3JARB 3KXDA 5ALLA 2A0YA 4PLPA 3C14C 3DF9A 5KFWA 4CE6A 3DFZA 4K9QA 4APMA 3TZHA 4AJEA 4BJ5A 4TRJA 2MSKA 3K9NA 3L18A 1QE0A 1KVSA 3C97A 4ZREA 3TLJA 4J4HA 4KN9S 1D6MA 1G2WA 1GQSA 4GQAA 5KFXA 3FMAA 2PKXA 2WT4A 4AG6A 4CM5A 1A96A 1B73A 4LW8A 2XW6A 5EQTA 3WYGA 2GXAA 5KYWB 1R0LA 4HS9A 4JLDA 5CVUA 2F55A 2OGUA 5C53B 1G291 4YCAA 1M6VA 1QIDA 4OOEA 3H40A 3COSA 4EWLA 1RYBA 3BH6A 4AWAA 2OLSA 2FSFA 1NMYA 4XYMB 5B55A 4BJ6A 2VUMG 3WWYA 1XYVA 4CMKA 2VYQA 1YE8A 3GGCA 3K09C 3G2HA 2CXNA 4FKBA 3MTJA 3RVJA 3DZJA 2OWDA 1DAKA 3RYHA 4U7GA 1T2VA 4RZIA 1VDZA 5AUQA 1TAQA 1WHTA 5JCOC 1NXXA 1TXGA 2ZATA 5F1OA 3PVCA 4EJSC 4EX6A 5BNTA 3BMNA 4LSMA 2R6AA 3D02A 2V97A 5F5LA 3ZCPA 4QUDA 3L6OO 2JIOA 2YJ3A 2JEIA 3IC5A 2HJWA 4OH1A 3DNPA 2FTKE 2DH6A 1Y8AA 3VR3D 5IYZF 2PX0A 4LTMA 1OFGA 1VE6A 3T3OA 3PW0A 1UC5B 3PZRA 5ALMA 3GO4A 3ZCTA 4Z9YA 1QR6A 1Y9AA 2CXXA 2X8JB 1LH0A 1HFWA 3DR3A 3BXOA 1QNLA 3B6IA 3TE7A 5AOVA 3D2BA 2OT3B 4ON9A 1HNXB 3H5RA 3RTBA 2YW9A 2YFYA 3G9TA 1R6DA 5KTTA 3NP7A 1ZP6A 2I91A 3Q9LA 1IB6A 3HKBB 5AKJA 5L1IA 1K8RA 5EVCA 2AX3A 3V7FA 3R3YA 3PXGA 4Q6WA 8ADHA 1RYDA 3T7AA 4XQGA 1WEHA 3HWSA 4RO0A 1W93A 1QCCA 4G0XA 2CW7A 4PSUA 4JX8A 3TAXA 4NESA 7REQB 2GK7A 1MP0A 3GOQA 3ZE2B 4BUCA 2WU0A 4NBNA 1N34B 4MLDA 4QSHA 1LRKA 1RFGE 8ABPA 3NGMA 3ROTA 1H23A 1AUOA 2LCFA 3PHIA 3UMSA 2ZT7A 1LBEA 2P5UA 4YHHH 4XIGS 4C2TA 1XQYA 4BB5A 1Q6ZA 3NB0A 4D6PA 1PO7A 5AICA 4AQ7A 4YJDA 4XDHA 3MMSA 4M9QA 1HDCA 3O3NB 5B6IA 3E7FA 4KQHA 4ZXPA 4UBJA 1CR4A 3EZLA 4QBIA 1R12A 2YMPA 4J94A 4M0CA 5T4HA 4JUCA 4Y6SA 4NR0A 3P9SA 4JI2H 3ZS9A 3S27A 3D0KA 4ZFNA 3EXAA 3ZWXA 2R7LA 2G72A 1N25A 2W70A 4XGKA 2B1RA 5AUPB 5JE8A 4CCYA 4FFDA 2W2TA 3WMFA 5T8KC 4DQXA 1YVEI 3GTPA 4HVLA 1A69A 4M4SA 2RBKA 3OE7A 3HN7A 4JDUA 4UCTA 1T1JA 4EKGA 5CTJA 4YAKB 4R3NA 3AU9A 1QBKC 1ONBA 5B1DA 1UKBA 3A6GA 3WY9A 4ZTZB 2BMEA 3QLUC 5DSXA 4QQFA 4QBGB 2ZBUA 1DAOA 3CWZA 5I8WA 1XMPA 4LHVA 5DNYB 2WFMA 1VYUA 1YFKA 4N3BA 1JIHA 2DHEA 3REOA 4E5VA 3DC7A 3E22A 4R69A 3FZEA 4CR6A 1LJ8A 5AVTA 2FMUA 1U94A 3MA0A 4M8KA 4CCWA 3NIWA 5KFSA 5LL6P 2ZIXA 5K0CA 3KKKA 2O7QA 3ZS8A 3IEUA 3I1JA 1GUYA 1D4OA 2ODAA 1HDIA 1SU7A 5HFNA 4RZRA 1VJ0A 1MOZA 2YRFA 3KHLA 1CLEA 4QKQA 4I4LA 2NSYA 1MEJA 2EATA 3FYUA 2MR6A 5K0SA 1ZIOA 1G8FA 1BHJA 5IDQA 3H9UA 1XL1A 1G9XA 3DO8A 1B93A 1NQAO 1KEEA 3KKLA 4B8WA 4U7CA 4DV2B 3EMKA 4D9HA 2WKWA 4M1OA 2V7EA 5ESXA 5FLXA 8OHMA 4HKTA 4O7ZA 2XMBA 1V7ZA 4Q9DA 3IR5A 5JNLA 2CD9A 4QLAA 3A32A 3RJMA 5KOIA 3ZWQA 3HJBA 4TL9A 4QICA 1UBTS 3S2YA 4Q3EA 4PX5A 2IYFA 2J6IA 1F5SA 2O1EA 3IX7A 5JUWA 5EHQA 2ZJYA 3T4UA 3RADC 3P19A 4ARZA 4P82A 2C31A 3WB2A 2J5RA 2WU8A 1SVOA 3BIOA 4M98A 4H9GA 3QEKA 2RI6A 3F3SA 2ZCUA 2NUAA 1KZ1A 2GF0A 4FD3A 2OXRA 3KTDA 3SXUB 4BO1A 4KXNA 2VJKA 3IYLW 4IIJA 4NP6A 1XLUA 2ZRIA 1WXWA 1YB5A 4HNAA 2HXYA 1UK9A 2XVMA 3P0JA 4EGQA 4RJIA 4ZZ2A 1FQKA 2H08A 1MJFA 1G20A 2IPAB 1E3MA 1P6UA 4HDCA 1J97A 4HRYA 3JD2A 4Q7MB 4D41A 3ELDA 2VT3A 2NUPB 4WFQA 1Q3TA 4A3KG 3PVZA 2XWQA 2CXPA 2VPZA 1LV8A 2GARA 2P6OA 2HA0A 1Z6TA 1GEEA 4HX5A 1MU0A 2YJ5A 2A0WA 4BZWA 3QEMA 4UPVA 3HU1A 2HJVA 1CFJA 2DERA 2QRMA 4LSXA 2J3JA 1KI7A 1EP3B 5EKXA 1QOQB 4IR7A 3FPLA 2OYRA 5L4LA 2E2IA 4V0RA 1ABBA 1CX9B 2WSSA 3MCVA 5E0OA 3M9XA 4DUGA 3JQ8B 2TSYB 2RHHA 2PGXA 3UKJA 3NASA 4V0SA 4C22A 1E1RD 1E5VA 4NNOA 1EBFA 3VYVA 1L7XA 3UQYS 1ZNXA 5KOJA 4AWXA 3EBPA 3LQ4A 1M1YA 3TZBA 1KOJA 1MKYA 3P2YA 1BCSB 5CCEA 1BHO1 1RE1A 1VXRA 1DBQA 4DV6H 2X4IA 4P32A 2BV3A 4QJIA 3SQNA 2HTFA 3EPIA 3MS2A 3UATA 5IF9A 2PUJA 3Q7EA 1H0HA 3OIGA 5KTMA 1EI9A 2XMSA 2GQRA 1NL3A 1KAGA 1N2ZA 1MO5A 4IGIA 3ESAA 1HOTA 3U2QA 3BXGA 4GX0A 4DA0A 3OZVA 1OHHD 1ZNZA 4DDTA 1OYVA 4GPIB 4H3SA 1W88A 4MVJI 1BKDR 2D7JA 1J23A 2NU7A 4O8ZA 1VE5A 1HE5A 3Q5EA 4BC0A 5DK4A 3VDRA 3GC6A 3HFSA 4B3HA 3DWEX 2IWHA 1VI2A 3JTEA 1II8A 3RVNA 3NUGA 4IIUA 4RJ2A 2X9VA 5BWRA 3GTQA 1OCEA 3GIIA 2OD2A 2ZRBA 4KMMA 4RY8A 4CT5A 3GVIA 3GRKA 4E2ZA 3ITNA 4EY3A 4ZICA 1Q0SA 3WLNA 2W9CA 1SUPA 1L3BA 5B53A 2A57A 1QRDA 4D81A 4KQEA 4C5BA 5JAIA 4GC6A 1E3EA 2HADA 2BFEB 4FFSA 4BNYA 4E5UA 1QJCA 2VTDA 4HLNA 3IULA 5I7SA 1T2UA 1E5TA 5EKDA 5DOZA 5K20A 1CZKA 3GLFA 2PX4A 3L0IB 3TL6A 2DWOA 3A1FA 3HXOA 1NOJA 3CZAA 3WRXA 5DBHX 1X80A 3CQ9A 3VVMA 5I7AA 1H3EA 1N8TA 1DWUA 3RQIA 4L75A 3NATA 4P93A 1QHXA 1Z68A 1HNWB 3ZQJA 2C94A 2YYAA 2GZRA 3VPXA 2OQVA 1HPLA 4F12A 4JYBA 1CUFA 3CB4A 3H2ZA 5BP7A 5MN6A 3OQBA 1DC4A 3EVFA 4QM7A 2OILA 3M83A 4PZ0A 1I14A 5TVGA 1C0EA 1AK9A 3HDQA 2AJDA 4MWOA 4RS4A 3A1SA 1OA1A 4L9WA 4QTUB 1L5WA 4BMDA 3U4GA 2Q07A 2VS1A 3D3EA 4F8YA 1P3JA 2P2NA 4OSEA 2QTTA 5EUCA 1OWPA 3PTZA 3W8FA 5FTWA 3ZX5A 5KFOA 4WBSA 1YB4A 3TIGA 2AKEA 1E9FA 1DMRA 2WKRA 4N41A 2BT4A 2J7PA 2VYVA 3CCCA 3SDSA 1O0SA 4DG8A 4W1SA 3C4QA 4C2BA 5ALRA 4JJAA 1FK8A 2ZRGA 4BDSA 3MK31 4RAZA 3AERB 2D5AA 3JQ9C 5DXFA 1V5IA 4ZVUA 5HMLA 2BKAA 2CDNA 2E3JA 5DEOA 3EGVA 1SCAA 4R98A 4X9XA 2OAP1 2R5FA 3RB3A 1DG3A 3BGSA 5FD5A 4Q3DA 3AETA 3B6KA 5FBHA 3ANTA 2FN8A 2XUDA 4LY6A 3TOSA 3CRZA 4KQKA 3T0FA 4AP6A 2MSDB 2RJOA 4KE8A 1JPUA 2PS3A 1QHHA 5K45A 3BK2A 1MAWA 2C5GA 4WW0A 5TT0A 4LH6A 2K4MA 4RDXA 3PE6A 4CUKA 2WB2A 2WJ4A 4LXXA 2QXYA 4A5OA 2YDYA 1F2UB 2Z3ZA 2BPOA 1NXQA 2JJ1D 1AUVA 4FDVA 4MP6A 3RYFB 1FRNA 1ECBA 4N5IX 3M9WA 4EARA 4F7DA 4Q5IA 1ECGA 4XGIA 5BOSA 2JH8A 1KA9H 2L42A 5TVKA 2G4CA 3O91A 2W42A 4WNIA 1T3ZA 2JFFA 5INTA 4Q7JB 3KBBA 2VDVE 5HRAA 5G3ZA 2CNBA 2E4VA 1ZQ7A 3WLOA 4NBRA 3BK7A 5ADVA 3HKEB 3FSGD 3NS7A 4Q1VA 4R3WA 4HB0A 1S3GA 5KSPA 2PL5A 4I6EA 4HLQB 1S02A 2VUHB 1SB8A 3KNZA 3TLBA 1OV6A 3OWHA 4NH0A 3IALA 1Y3FE 3FPSA 2WTXA 3NG1A 3GGSA 4CT0A 4H31A 2ID4A 1BWSA 4EA8A 1XMIA 4YMWA 3R5HA 4RMJA 3PUWA 4R05A 3G79A 3QGMA 2C9YA 4DL7A 1VIDA 4O3PA 2WE6A 3KOXA 3RU9A 4CM9D 4RA9A 5IM4F 3NHWA 2GJ4A 4CZ2A 3OZFA 2AEEA 4H2DA 2WAQE 4EFNA 1AN9A 1HYGA 2XSZA 3BMQB 4EY5A 4S12A 1NUHA 2ZB4A 1EK2A 1CJKC 3UXEA 3P5SA 4X1KA 2WKPA 3KX2A 2AZXA 2QN2A 1N6KA 4TYQA 1IVNA 1AK2A 3W2IA 4BWGA 3MERA 1C7ZA 5HCUA 4DF3A 4YAOA 4EECA 2HQOA 1A0IA 1U6KA 3SOPA 2H3EA 2QUIA 5I47A 2EQAA 3OTOB 2CB0A 1WXXA 3DEHA 2WWRA 3PK0A 3ENNA 2XKJE 1XJCA 2ADMA 1UBLS 1XB2A 4BIIA 3UAXA 1Z56C 1WE2A 4U7DA 2QOEA 1U28A 4EB0A 1C2TA 4UTNA 1TZMA 5E9WA 4IHJF 1L1QA 4RPHA 3I6BA 3A6HA 1UIRA 3H2GA 1VBKA 2QK4A 1Q7CA 1YS1X 1H6CA 1U0GA 4WFKA 1YDEA 2HA4A 5C3UA 3LY5A 3I2IA 1OYOA 4YA6A 1JZSA 3D6JA 2XTAA 3SQDA 2ASVA 4M9CA 4BRZA 3K9LA 5T4FA 3DMDA 1HOXA 4V3CA 4DEYA 1RWPA 3P96A 2QI9F 2CLOB 3NDPA 4L2IB 3QWHA 1R6XA 2CUNA 1D7OA 1T34A 3MWEB 4UPEA 2IY9A 4FEGA 3FTCA 2W2NA 2ZANA 4G26A 2FR0A 3O4FA 2ZK7A 2X19A 1MD9A 2ZXFA 3IQGX 4GP7A 1E2IA 3NBXX 3RSFA 4IP0A 4DOMA 5H59A 4JWTA 4D9NA 4L3WA 1JVBA 3Q4GA 3HI4A 5J40A 1S3FA 4XVQA 3VISA 3E53A 3HPQA 3SFVA 4DBLC 2DKFA 1P7CA 3ODGA 1M0TA 2AOXA 3T5GA 2EJUA 2E37A 2ZDHA 2QLNA 2GR9A 3LG2A 4HYYA 3HYTA 3A6LA 1AUPA 1GKLA 3ETLA 1EIZA 2UUCH 4ETIA 4DQKA 1D8AA 1UM9A 2X77A 3DFFA 1CP3A 1SOUA 5B2ZA 2FFHA 4PQRA 4KVZA 4A2BA 3AIOA 1J5EB 3ELBA 4AW9A 4DV5B 4AY4A 3H8JA 5DNUA 4XLLA 1WKCA 1VDMA 2XIQA 1G5RA 5D6OA 1NVAA 1V96A 4DPMA 3A6JA 2WVGA 1Z75A 3IAAA 5A5VA 4LXGA 4V0MA 2HSJA 3EXFB 1IZ0A 3OWXA 2PKWA 4RK6A 2UUAH 2ZFUA 4OVKA 5EZYA 1XPUA 1CUXA 3B2NA 1OKKA 1SCUA 3PTAA 4QLBA 3BA8A 4QPDA 4H0FA 2F3TA 4XDZA 2EX1A 3W6UA 2V0GA 4F84A 5IT0A 3BIJA 3P2MA 2VDPB 1T3SA 3TR0A 2GAJA 3CW2A 4XRRA 1RWKA 1YBFA 2DPLA 4PS0A 2VYFA 1U8UA 1UF9A 1B23P 1DBWA 3LYAA 5F1KA 3SHTA 3N8DA 1DRWA 5EJIA 1DINA 4YDQA 4P4SB 2IUUA 2FZ5A 4YRRA 1IWPB 1WLSA 3U3ZA 5KFHA 2Z5FA 3JRWA 5LP6B 3WMRA 3A3OA 3DONA 1TUIA 2UZ0A 3G6WA 5JU6A 3I6ZA 5EZQA 2HRZA 3Q2KA 4Q18A 3THWB 1I0LA 4O3FA 3TJZA 1NX9A 1OQAA 2JH9A 5LSAA 1JECA 1QVZA 3T7RA 2EBFX 2MR5A 3NQ41 2A6PA 2XGPA 2CL5A 3P2EA 2GBCA 4I6JA 1Y4UA 4EHDA 2HCJB 5K0FA 2ENUA 2OZLA 4KAFA 4OQPA 1SM4A 4YCDA 4WXEA 3ZV7A 2BF4A 4MWBA 3W34A 1M8FA 3I2FA 4DR4H 4BMZA 1IPFA 3LBFA 2P41A 4L9RA 5H3CA 2Z1NA 1EVKA 2GH1A 3MMPA 3QKIA 3DEFA 5C7LO 4RF2A 5I45A 2XGOA 1E7WA 4PTYA 4TLAA 4ZT7A 3K2QA 3J81A 3EH2A 2VNIA 2PGDA 1Z6ZA 2NU6B 3ASUA 1RJ9A 1H2BA 1U9ZA 5BUZA 3FE2A 4BGVA 2JKYA 3AM3A 3SIRA 4C4RA 4WNYA 4ZQIA 2QGFA 4EYOA 4GWKA 4E03A 4MRMB 1SG6A 1ESCA 2NO1A 4UNPA 1VPLA 4J16C 2I67A 1JJBA 5ESDA 2ZBDA 1QTQA 1OE0A 4M1TA 2DFDA 3DF7A 2NTEA 4FN5A 2LZ0A 1XTUA 1WRVA 1JF8A 5H68A 1K7SN 2YY6A 2PA3A 5JH7A 2ZSEA 2QX9A 1UFQA 1NP3A 4RW0A 2VHJA 1RKUA 2RGCA 5ALYA 1A2BA 1RHKA 2PX8A 4IRXA 4WX2B 2X1MA 3RSCA 1K5HA 3D4LA 3DL4A 2QRHA 3ZU4A 4KPEC 1E5QA 1ISJA 1P1RA 2W6IA 1J2EA 4BVLA 2GJAA 3DBLA 4Y0VA 4I4TF 2JI6A 2Q3LA 5CUQA 5AI6A 5JHGB 4FFBB 1ZD9A 3N0WA 3L1VA 3WICA 1LNQA 1ZH4A 3JZ6A 4TUYB 2VPXA 3RB4A 1TM2A 1PDVA 1IN4A 3QPDA 3RK4A 3QNUA 4IDEA 1IC6A 5KU1A 5B4VA 4EJ6A 4B7AA 4YHHB 3TOVA 4LFCB 4U5XA 4MO2A 3N0VA 2R00C 3L7IA 4RXUA 1ESNA 3WK6A 1E4YA 3LX5A 3M0EA 1HY3A 3DG9A 5F2NA 4EUEA 1ESMA 1RC8A 2BI7A 4AZ3B 1T2FA 3LTEA 1OU0A 2B6HA 1GNRA 1AGXA 5JI2E 1GLGA 1SU8A 1WCYA 1S4MA 3NRCA 3VDMA 2QTAA 1OA0A 2JI4A 1N2CE 4YJGB 1EVEA 3FIJA 3H5LA 2IKQA 2PU5A 4QOSA 1F2DA 3GRVA 1P3DA 4JI2B 2UYGA 3TF5A 4WBXC 3GTGA 1VTKA 3DTNA 4ZYWA 1M72A 3SK0A 5BXYA 3VU1A 4RTPA 4NABA 1VMDA 1YFJA 1WVMA 3SEFA 4INPA 1C3XA 4Y6GB 3J7AK 4O7LA 3G0OA 2ZB2A 3W9UA 3WR5A 3GJ6A 2J3QA 1GCGA 2CLDX 2IPMA 3TLYA 1T43A 3BGOS 3IPYA 1THMA 2QJTA 4OX9Y 3HNPA 4NCNA 4B6QA 1XC7A 1NVXQ 2PXAA 3T3IA 1U5BA 1UWKA 4UBNA 5F3DA 5FUWA 5FLMG 3H2SA 1ZHSA 5C35A 2BGNA 4ONEA 1DDOA 5I6DA 4ZIRB 3WLRA 5EE9A 4ALIA 4FMCF 3UMBA 4FGUA 3UZOA 3LMKA 3U4QB 2W7TA 1EM8A 2JARA 2DWQA 4XX0A 4HQKA 2D8MA 4YCJA 5B37A 5I5UA 3TCKA 1T6XA 4DARA 4EG0A 2ISQA 2V8BA 4ZCMA 2FR1A 4I55B 1UC8A 4KR2A 5KNBH 1H42A 3CVOA 2WWTA 1YS2X 3VUFA 2Q5LA 2HSEA 2X76A 5GINE 3LOPA 4J0MA 1PKXA 1Q95A 4LF7B 2A59A 1YC5A 3GFOA 3ZU5A 4KQ2A 1YA4A 3D1LA 4FQ7A 1NSYA 5BN1A 3CUVA 5ALFA 1TM5E 2XWPA 3WWOA 4WESB 4LXQA 2Q0QA 2R93G 4UMEA 5BR1A 2BSAA 2DJ5A 2CL7X 2AW5A 1N1EA 4RNNA 4IAJA 1D9ZA 5C4IA 2XDAA 4CIWA 1UDRA 3HYCA 5HJ2A 1J2YA 3HOVG 3EXIA 3TLAA 1R88A 1E5LA 2OMKA 3OTQA 2B4RO 2PMZE 3T5KA 2VA3A 2AMJA 2XCIA 3KJEA 3R0ZA 3UGKA 5LOVB 3GELA 3WKDA 3AHFA 3RK0A 3WLKX 1HTTA 3RSZA 4F4YA 5TS2A 4GZ6A 1QYXA 2NYRA 3GROA 2IUFA 1QGED 4QUKA 4YAFA 4IV8A 2YZ2A 1G8PA 1PFVA 3ND6A 3E2MA 4AMUA 5ICFA 3H9QA 1SXPA 2CUKA 5K0ZA 1KMHB 1NVWQ 3BGIA 2QNBA 1YTUA 3EIEA 2DMRA 2HLHA 2PK3A 1YDWA 4TWJA 3H6GA 4K28A 4CM3A 3HL4A 3U3DA 3KFLA 3PGA1 1BTOA 3DOFA 2NM0A 1GD1O 1C3EA 5IAKA 2ANBA 2R65A 3QE9Y 1X1DA 4L27A 4IINA 1Z16A 2E21A 3E9NA 2HC9A 3GP8A 3AEKB 3AR2A 4Q02A 1JALA 3T41A 3TIIA 1BQ3A 3VRHA 3K09A 2B5OA 4B3XA 3NAQA 5ENDA 1KQPA 4K81B 2Y0EA 1EBBA 3C7DB 2F3SA 2QROA 1JQEA 3LFUA 3TE6A 3KOUA 4BWYA 3NVAA 4D42A 1EXWA 5GP1A 1WLYA 2GAFA 1Q83A 5JCOA 1CUAA 4EJSA 2PBFA 2MYTA 1RRMA 3PQ8A 2DX7A 1I24A 2A9RA 1E0AA 2CLMB 2GCGA 3RQSA 5A7GA 4M21A 1AKTA 4HDMA 1RZRA 3U3RA 3DEKA 1S9HA 3G6KA 4L9SA 4B0OA 3NDRA 1LW6E 4M1QA 5D1HA 4Y2VA 2PSFA 5AFSA 4LY3A 3MR3A 1T4DA 3DPUA 4RNDB 3BQ1A 4JJFA 4CODB 5BNZA 1TA4A 1PSZA 1F2VA 4L0CA 3RR2A 3OAAA 4TOIA 5CCBA 2V3WA 1M10A 4AKEA 4DV6B 1TCCA 3BUSA 1TW2A 2FEWB 1FY2A 3U0GA 1U2RA 1N5MA 4TSKA 1J8DA 1ZEMA 4UFZA 3S8MA 2NT4A 3LUBA 4M76B 3CXUA 5K8IA 2P30A 4CL2A 1TL7C 1XGKA 3WYAA 4XOUA 4A3GG 5JALA 2C4WA 1VIAA 5AVUA 3GJYA 1P6QA 3I8XA 5FD8A 3C43A 1KIAA 3F0TA 5LYJF 3HCNA 3P8ZA 4RBNA 1ELOA 3KQWA 1WPXA 2QBYA 3H1PA 4R1PA 3CM0A 1T5SA 3GUHA 3LP5A 1KGSA 4WASA 3QBDA 1SC4A 1Z3CA 4DSOA 3BRSA 1UT6A 2B9VA 2FKAA 3IUMA 5TQ0A 5I7HA 5CLGA 1DBVO 3FIUA 4X92A 3V3KA 3K8YA 3HU5A 4KITB 3HYSA 3AY7A 4Q9JA 1DO2A 2EGUA 3L0YA 3TX2A 2X2OA 3AFMA 2ZVQX 3E9YA 1AGYA 1CS0B 1ULAA 2X22A 4WGFA 1E1CA 4UCVA 2BOVA 4QRDA 3WLLA 4OK3A 4LVNA 1M7GA 3VUEA 4HAUA 4NFLA 5AVZA 2JLCA 2CKMA 1IQPA 4OXYA 5HM6A 2IBKA 3PD0A 4XD7A 4L6IA 5BSVA 5IVPA 1D2CA 1VAJA 1Z82A 2YRWA 1RJQA 3A1VA 1NJ8A 3EIOA 1F1BA 3DEYX 4EJMA 4KFSA 4GSLA 4RF4A 3DFUA 3ZC3A 5T8KA 5AKZA 1O95C 2VQEH 5T5QA 3PNQA 5IT4A 3OQ6A 2NLOA 1X3SA 3N7UA 1ADFA 3N6VA 4D9JA 1CQXA 4HV4A 2RHCA 1CP2A 1G8HA 1R0ZA 5JTUA 4MUYA 4REOA 5I9TA 5C8DA 2WMYA 3A4MA 3G5TA 4DREA 3QVLA 3QLUA 2ZJBA 1P4RA 2VT6A 4CMBA 3MT7A 5E1BA 2VOBA 5JZSA 1TWHA 3N0XA 3HG7A 4HAZA 3RS2A 1XAHA 3B5EA 3VZDA 3LQKA 1ZNWA 4I50A 4M8IA 3CG4A 4C1NA 4AIRA 2ONYA 4UE6A 4E5MA 4OI2A 1KVQA 4ITVA 2WIFA 3V1YA 2YU9A 4Q0MA 1MC4A 2Q28A 3UWMA 4EX7A 4OLHA 1KDVA 2FRVA 1WV1A 3GCXA 3EPJA 3GV8B 2Y9MB 1SZDA 3EZFA 2HMWA 1RXSA 3X2EA 3QVTA 1Y7PA 3H65A 4RK4A 3NXSA 1UL1X 1U3VA 1MZBA 1YKSA 3U3OA 3H5TA 2Z2XA 1DTWA 3TL2A 4GC7A 4X61A 1G59A 3HGTA 2A9VA 5LVAA 3II6X 1L5MA 4R41A 1Y8QB 1K8QA 3UA4A 2R8ZA 2IPOA 3BB1A 4C21A 1IPHA 2PKQO 1XQXA 3EARA 4HDQB 1EAMA 2OB1A 1CV2A 1LCIA 2VHTA 3G0IA 4FYIA 3GVPA 2ERCA 5JVDB 5BRAA 1ZBQA 3F67A 1B0AA 1QK3A 1RHMA 2E4ZA 3U7RA 5CFLA 3NNSA 1JMYA 3AR6A 5FI5A 1A9TA 2V4RA 2QS9A 4BMCA 1REQA 2BEUA 4OA5A 4ENRA 3QMMA 5I7EA 3KELA 3G13A 3PQ4A 1RNLA 4OHBA 2JNWA 3IG0A 5EE1A 4IO1A 1MF7A 4O3MA 1P4JA 2BBOA 3WQRA 3K70D 3MILA 2ZBRA 4UHJA 3AQ4A 4M8NE 4C14A 3HDHA 3BD6A 5KPDA 1VCMA 1I80A 4GYJA 4PGHA 1A9RA 3NVDA 2GPBA 5CRIA 4RL4A 1JFVA 1AGNA 3ADPA 3I1FA 4G0QA 5TY0A 4P81A 5CGZA 3VMMA 1U7TA 4BUJA 4A8TA 2XGMA 1H2YA 5L7TA 1YD7A 2R4TA 4PNHA 4CHTA 4J1QA 3SZRA 3IIIA 3WKAA 1V41E 1PLKA 2H2FA 1EX9A 2FMXA 2NV2B 4JBXA 1W4ZA 4Z7NB 2CD7A 3MTBA 4UJ5A 4C4OA 5M2QA 2DWCA 3MTEA 3B48A 4GBGA 4BNDA 2AFHB 5EWLA 2UZ1B 2I54A 2R48A 4RLQA 3VZPA 4RZUA 5C8VA 1PI3A 1EWRA 3I5AA 4U9HS 1Y4DE 1YS7A 1E9BA 1PYOA 2WRZA 1N6HA 3VYUB 1KAHA 1ZFNA 2Q3HA 1K92A 2GFIA 3G2IA 1HURA 5KKCA 4YB8A 3P0FA 1U2TA 1NTRA 3G23A 5BV2P 1ZJZA 1O1YA 4HQFA 5EZ5A 4TTAA 3P4YA 1X92A 5L1JA 4MQEB 4MP8A 1X7GA 3VR4D 1WKBA 4BTLA 2BR0A 4MRRA 16PKA 3I52A 4D96A 1YCHA 2E6UX 3PC8C 4BNMA 3TGPA 1G2PA 4U0KA 1EFPA 1R9TA 1EH5A 3WO0A 3RTXA 5HILA 4J9NA 4MS4B 3GCWA 4ALNA 2WFLB 1W35A 1C4XA 1AS0A 2HSZA 3MRXA 4I1SA 3TXAA 2P1ZA 2QVBA 2WJGA 3PUZA 3I9V6 5UKDA 3FDZB 1FNNA 2R92G 4Z54A 2V58A 5AW5A 3LCMA 3MMZA 2MYNA 3DB1A 5DNEA 3GVCA 5BT8A 3ZJTA 3FFTA 1WCMA 2XUPA 1Z0FA 2HIGA 1T0IA 1XDWA 2BGUA 3WWHA 5TPWA 2G9QA 3ZDZB 3HK2A 4GMFA 2QQGA 5E95A 2C5LA 4D4GA 3AYHB 2I80A 1TAHA 3ZDRA 1U7HA 3KZVA 2O2EA 2APJA 4DABA 4EF6A 2ECQA 2QIOA 2GJKA 2XCOA 3U1TA 2GETA 3SEQA 3UJNA 1GNPA 4UEOA 4PWYA 4ZT4A 1SFRA 3B9PA 4EQ5A 2COEA 3A9VA 3NUZA 3FA2A 4MUKA 1MN6A 2QJFA 3W06A 1JHUA 2UUCB 3VO9A 1RYYA 1JQBA 3QU5A 2IU6A 1JR3E 1JSLA 4N8EA 2Z2JA 1NW5A 2Q7DA 1AIPA 3UK7A 5AM2A 1UBRS 5BSWA 2AOTA 1RLIA 1V5WA 2J3MA 1E6CA 1DIBA 1E9AA 3V6HA 2JGRA 4IXTA 1TO2E 4XQ0A 4QULA 5GIOE 2COIA 3N40P 1KL7A 3BVPA 1EE2A 1YMUA 1JLHA 4F11A 3EUEA 4IAOA 3WHKA 4F2DA 1B14A 1CB0A 4W5QA 4RHXA 5JEEA 2C3UA 7ADHA 3CNHA 2YS7A 2UUAB 3NHUA 1LZLA 4FOSA 1OUMA 1NC3A 3LZCA 4TPKA 2I4MA 5KU7A 2GGSA 5C8YB 4TX1A 1FS5A 1AB6A 4RSGA 2VHVA 2HA3A 1R4NB 3ESZA 2IEIA 4KBYA 3EOBI 2OFWA 4AXXA 1UJMA 3D8BA 4BBSG 5BW5A 2PGLA 1FVOA 4US1R 4QYIB 1B8OA 2ATIA 2X5JO 2OK7A 4GD3Q 3ML1A 2VBGA 2H2IA 3KZCA 3ZTTA 3KFVA 5CW2A 4MVJM 3ZE1B 4WCFC 3MFIA 3EFOB 4DL5A 4KHZA 1GPAA 2A58A 1LDEA 3E61A 4JIMA 3JQ9A 4B3TB 3DYBA 3EASA 4IJQA 4BNJA 2C2HA 1HORA 2FB9A 1EUZA 4R2XA 1QAQA 4R0VA 3N3BC 4WL0A 1OI2A 4YJKA 4KK4A 3I1IA 5FAXA 1BD4A 3SC4A 2PUCA 2HMYB 3RI3A 3CBQA 4KRYA 5DHUA 3TUZC 1ISSA 4O7SA 1G5HA 3IEKA 3ONDA 5FBKA 4JLAA 2ZWMA 4AX4A 3CBGA 2G17A 4PV7A 1GDDA 1TCVA 1ZUHA 4DR4B 1T6ZA 4M1SA 2Z02A 1CDDA 3E7PA 2DIKA 3AFHA 4R9UC 4N5MA 4Q39A 2B63A 4YMIA 5HR5A 3OURA 1KQ3A 3WWCA 4R5HA 3QKUA 4I5IA 3EODA 4CEJA 5CH3A 4GLLA 1RXYA 1PZGA 5A0TA 1ISGA 3T9EA 4D57A 3KU4A 2J9ZB 4OHKA 5SZJA 2MDTA 2EKZA 3GLHA 1VI6A 1Z3IX 2ZWVA 4F4JA 4R1QA 5AKKA 4DHEA 3A25A 1E2DA 3OEYA 4PLFA 1IUNA 1Y1PA 2G5CA 1XBTA 4B74A 5FNVB 5DRYA 3PNOA 3LCCA 3OY7A 4W7SA 3TM4A 3I9OA 3M6FA 4DGSA 1AY0A 3NKLA 3ND5A 4UTZA 1H93A 5EEGA 3F6PA 5DGAA 1OOEA 1LSJA 5IVHA 3TJRA 4PDBA 4EFMA 3TNLA 1UPCA 4TTPA 2CJPA 3EFBA 3NWOA 2Y0SE 5HF9A 2C7BA 1KZ7B 3DT8A 2R86A 4DQ0A 5T64A 2QZJA 2UYCA 2IEZA 4ZYTA 5BN5A 4O4LF 4I5DA 2QQ5A 3SF0A 1ZH0A 3ABOB 3OPQA 2AOUA 4E2FA 1I5OA 4UXJA 4BLQA 1TT5B 3AT1A 2WLSA 4JXZA 4L0DA 5JHHB 3HLKA 5KT6A 2H1HA 3HCDA 2A1UB 2VYNA 2J33A 1PR0A 2HF7A 1ZU4A 5L3VA 1RXWA 5JR3A 1PDWA 3DWFA 3KRTA 3E84A 3NRJA 4AL4A 4R51A 3ESQA 3U54A 1DGQA 3GF4A 3TTYA 2MMGA 1EXVA 2EFYA 3EW9A 4KQGA 2YHUA 1JV2B 1NNI1 4NU8X 3QUQA 3SKYA 2KI5A 2WWVD 3D5TA 4X6YA 3TNJA 5KT5A 4FXPA 1GSIA 1HGXA 2PXCA 3AF4A 5FQOA 2DKOA 2NXJA 4NYJR 2BHTA 3ETJA 3SDBA 4QYTA 4R7GA 1IBSA 4JJEA 2X15A 4QVIA 1JKJA 3CX6A 1U2GC 2ACWA 5ITZB 3EPLA 3K35A 2R85A 4QXPA 5IX8A 3ZWAA 4ZEVA 4UQOA 2C9OA 2IY8A 3ZGXA 3OPYB 2NSLA 2O1WA 4INAA 1GFZA 4EIWA 4LG1A 2UYYA 3BB3A 2YWHA 4KO4S 1WUKS 1VYHA 4MVJA 4ENVA 1BQ4A 1KE1A 3GOHA 3ER8A 1VCHA 2JJ2D 2P75A 4HUQA 4X20A 4MHTA 4DUZH 5AMXA 3TO5A 2IS4A 2WYWA 2RBEA 3OX3A 1ISIA 4CV1A 4DQNA 1MQ8B 4IGEA 1Y3BE 1SBCA 1NKTA 2PLWA 2AU0A 3AHIA 3FCEA 1ONNA 3IAHA 1U2DC 1GAWA 1WUHS 3W4KA 2V4QA 3BMCA 3KSAC 1D2AA 5ES4B 3TTUA 1R00A 4UBMA 3SNHA 4LXUA 4EYGA 1L4GA 3T61A 3R7DA 1NJ6A 1OFUX 3VH2A 2QRGA 2C59A 4N76A 5L8VA 2UXDH 3BMXA 3WLEA 3V4FA 3OT1A 3ZDAA 1NWHA 4M54A 4LCEA 2QN6A 2VNHA 4J0EA 1T24A 1GKIA 1JQLB 2XHEA 5DRTA 3C8MA 1YRYE 5A4IS 4M0LA 3SJCA 1EMDA 1H1TA 1ZJYA 1LI4A 5DM2A 3L7JA 5COQA 3ZDQA 2XZOA 1KDPA 3IBFA 1T0UA 1ML4A 4EB3A 2OQIA 3A0RB 3NALA 3SSMA 1U8TA 1TTTA 3LA6A 5JAZA 3P9RA 4B09A 1N4AA 1JNYA 4WY5A 1B1AA 2NP6A 5TQ2A 3GMIA 3RUCA 4NX2A 4G1UC 3SKVA 5LDDC 1ZGCA 3AV3A 5BSTA 1J4AA 2PBLA 3WLSA 4WDRA 4IKEA 5ALXA 1N9GA 3VAAA 1IUKA 1B7GO 1JU3A 4HDAA 3FVQA 4J7CA 3V6LA 2PFKA 4H6VA 3UUGA 1HLFA 1KKUA 4CLOB 2P2YA 4N01A 4JP2A 2YN2A 1D9XA 5LQKA 2B5WA 1S8OA 2QP9X 2YHAA 2ZI6A 3V4PB 4LFAB 2GPNA 4DEXA 5L3QB 3CVWA 2FEAA 3RT1A 5JANA 1CS4C 2QLJA 4Q44A 2Q50A 1CQIB 4TLMB 2V98A 9ABPA 1ZMTA 3PCRB 1IHYA 1U3FA 2IYVA 3KXPA 5CNMA 4JBNA 4P83A 2FF7A 4Z6KA 1V43A 1NQTA 1EE1A 2PWAA 2INGX 5HF5A 4RJTA 3LC1O 1XLWA 1U0JA 1DUIA 2RIRA 1B2LA 1BXGA 1ZLYA 3A04A 4I1RA 3JQAB 1UBMS 4AJ4A 4BBRG 2WPNA 3ST7A 4IRMA 2NQ8A 4G37A 5CXQA 4D44A 3PPIA 2FUG6 1XHEA 1TC2A 5M7EA 4BVJA 1UXKA 1Z37A 2IELA 1NULA 1QK5A 2VCYA 2FK1A 1RIFA 2HHAA 2WTFA 3NPAA 2YR0A 1T1IA 3C5HA 1T94A 3QE2A 4PC2A 1BMDA 3KJXA 3VX3A 4Z1OA 4OYYA 5DQHA 4DM3A 2R5WA 1NV8A 2QE6A 3VOBA 4GQBA 3WBFA 1V4YA 5AHRA 3EPKA 1Y5RA 4OK5A 3V1TC 1K7CA 3T06B 2X2FA 5I5EA 5D5PA 5IYBG 1X7HA 5FTMA 1ORVA 3K8ZA 1PK9A 3BH7A 5IBPA 3DCIA 3HOUG 2BMWA 3KQKA 1PJAA 2X0IA 1M9NA 3FGNA 4U8GA 5JD5A 2VDOB 1NPTO 1F6DA 2VK2A 4L5CA 4MMZB 1FNSA 4J3NA 1YO6A 2V96A 4HL6A 3KU1A 1IHPA 2R1VA 4M89A 3ZDDA 3OSPA 1GTSA 4O4HF 5C4GB 5LPNA 1R0KA 1QE5A 1M0WA 4MEBA 4XKJA 2ZSFA 4RIGA 4LMBA 3CISA 1XCJA 3AH8A 4J0FA 4O4IA 4OU4A 2MYUA 1Z5ZA 4L28A 1G3MA 4PCUA 2DKNA 4TQUS 4CKWA 3RSLA 5IDYA 2YJTD 1P3Y1 4JEHA 4PTLA 2PBRA 3AIMA 1PEDA 1QHYA 5TPZA 2YV3A 3FSJX 1CZUA 4W4TA 5KI6A 5TQVA 1PZNA 4JA2A 3I4LA 4OHCA 4RIHA 3DKVA 4GI7A 2Y4OA 3W9BA 5I5WA 3DYVA 1QMPA 1X39A 2SECE 1TVMA 2G40A 3I04M 3C24A 4DLZA 4FFLA 5AH0A 3H9GA 3UYYA 2GZ1A 3DMNA 3FYCA 4ZK2A 1UANA 3HNOA 4YAJA 4GI1A 1ZM9A 2FJUA 4JB2A 1TC1A 4F4WA 4I66A 5KG1A 4B40A 3G2PA 5SY4A 4JEMA 3KSUA 4K9MA 2W9BB 3F6BX 1H2WA 1ATIA 1PG0A 3MN1A 1JHAA 3AHCA 5EMLA 1K7EB 1D09A 1U63A 1D2RA 3CURA 1ADCA 1DAIA 1MX1A 4MV0A 3R9XB 4PC6A 4KYVA 2V6FA 5AUNB 1XA4A 3C41J 3WRYC 2D3WA 1A5ZA 2Y05A 4M60A 4B6PA 2VPQA 3M6UA 1P29A 2XLBA 1FF9A 4QQ8A 4WECA 1J2UA 1U6IA 3VH4A 4JQYA 3STUA 2YJNA 1I3OA 4OKIA 4JGBA 1U8XX 1L6RA 1UMBA 1Q7BA 3PFIA 2CXRA 1ZHHA 5LKRA 5FOTA 1TF2A 1QCDA 2JRCA 3W2GA 4CM8B 2C4HA 3PFHA 5EHIA 5DCWA 3PIDA 2C04A 2VQEB 1V9LA 2FZ4A 5JAOA 4TYWA 1P7YA 4IJVA 5E4TA 3PYLA 3KXKA 1NF2A 2TMYA 3U40A 3VU9B 4G9GA 1WSBA 4LBWA 2C2YA 2ZYVX 1XU7A 3AFGA 1D7AA 4BO4A 4OGLA 2HMAA 4DKXA 1YI8A 1FBNA 1JN0A 4EVIA 2G7ZA 3G5MA 1DVRA 1Q11A 1SD2A 1A4IA 4ND6A 3AKDA 3ZWNA 9MHTA 5AJXA 5AJWA 1UMCB 2X86A 4JJ6A 5LMNB 1G21B 1T26A 3UB4A 1OH6A 3VGJA 3OE4A 1QSGA 2P77A 3ZIUA 821PA 1ZN7A 3OQIB 5KYUA 2LRHA 2WIJA 1E5XA 4NQRA 2IZZA 2A4KA 4TV8F 1AZWA 3FOBA 3AVWA 3GK3A 2JFBA 2RGRA 1HI9A 1Z7EA 2BE9A 4Q3LA 5F9MA 1MMFB 1YR2A 2VQ6A 3PL1A 4KE9A 3S28A 3ICEA 4N65A 1GCAA 3WWDA 1B33N 4YT8A 5KNDD 3QBVA 1AKQA 4CM4A 2XB2A 2B8TA 3FMPB 2H7VA 4ZI7F 5FWXA 2NU8A 1NRJB 4Q34A 2PTHA 2IYUA 3ULKA 2ZIWB 2VNKA 3HHPA 1Z6XA 1N5DA 3I30X 3L4JA 2QV7A 5THKA 1DOZA 5JDCA 2O7SA 4ECEA 3W2HA 3U9SA 4RVUA 3K32A 2FQ1A 1X9HA 5HZGA 4LF4B 1RC0A 3AZQA 4MQMA 2HBYA 3ECCA 1RQ7A 2P5TB 1JX4A 4FLMA 1SCBA 3IJRA 3DE3X 1KVUA 4D3ZA 3TIXB 1P19A 1I7LA 3LXMA 1P16A 3RC1A 1HZZC 4D02A 1XQ6A 3F98A 1NU8A 1HMYA 4L22A 4QGHA 3S7TA 1SFOA 4YAUA 2V7BA 3M4NA 4A91A 1KP3A 4X8OA 1J8VA 3X2FA 3HP7A 4DIOA 5C7IO 2DSTA 4KBFA 3ONWA 3SF8A 4F46A 4C05A 3HP4A 2ETXA 3IQEA 2BH2A 1IOLA 2WIBA 4D26A 2GXSA 1RMQA 2QMOA 3DL2A 4PAQA 1TGVA 1TWGA 3FPHA 4Q9KA