1B7FA

Sxl-lethal protein/rna complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
167
Chain Sequence
SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3')
publication title Structural basis for recognition of the tra mRNA precursor by the Sex-lethal protein.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna-binding protein/rna
total genus 35
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b7fA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b7fA01
1WWHA 2X1BA 1WG5A 2CPXA 2DNLA 1U1RA 1WEXA 4M5DB 1L3KA 4C4WA 2F9DA 1VC0A 1RKJA 2HYIB 2FY1A 2LEBA 2ERRA 3CCVS 1VBXA 1WG1A 1VQPS 2LMIA 3S8SA 3MUVP 5LXRA 3CF5Q 1WEYA 1UP1A 2RU3A 1A7GE 2RS8A 3UD4P 5EN1A 4TU8A 1U1OA 1OPIA 2NLWA 2KM8B 2RS2A 2D9PA 2HZCA 1VQ4S 1WI8A 2YH0A 3RW7A 2Q79A 1X5TA 2KXFA 5GMKa 5FJ4A 1G2EA 2FC8A 5GAGU 3VAGA 3J7YU 1H2UX 2VONA 2RT3A 1R8PA 3ULHA 1U2FA 3HHNB 1CVJA 2MKSA 5LXYA 3MURP 1KOOA 2L41A 2KRBA 3VAKA 1NJIT 3NNHA 2DH8A 2DNOA 4Y00A 3EX7B 5IM0B 3BO3A 2OSQA 3D2WA 1M90T 2X1AA 1UW4A 2M7SA 2DHGA 3J7ZT 4V19X 1U6BA 1VC6A 1RK8A 2M2BA 2CQ0A 4CQ1A 2KH9A 1FJ7A 3K0JA 3HI9A 1KOHA 2CQGA 2CQIA 2V94A 3CCSS 1OWXA 3TO8A 2KRRA 2MPUA 2XS5A 2LA6A 5HL7Q 2AYEA 3BO2A 2EK1A 1VQ8S 1S72S 4C0OC 2J76E 3NNCA 4Z2XA 3BS9A 3CMES 5CYJA 2MSTA 4BS2A 2MKJA 2DGSA 2WBRA 2DGUA 1FHTA 2KG0A 2DB1A 4J5OA 4A8XA 5LSLA 2M8HA 3FEYB 3UWTA 4WFNQ 1AUDA 3P3DA 2O3DA 2I38A 3U1LA 2UP1A 2MGZB 3B4DA 5LJ5Y 2JWNA 2L08A 5D78A 1X4HA 1FO1A 4RU2A 2CQ4A 3CXCR 1X0FA 4WKRA 5DM7Q 2J0SD 3S6EA 3LQVA 2MSSA 3FEXB 2MQPA 2DNRA 2CPJA 3CC4S 2MY7A 1IQTA 2DO4A 2CPEA 4TU9A 1U1PA 5CA5A 3MI7X 1HD1A 2HGLA 1VQ5S 3DXBA 4OZ0A 1WF1A 5DDQC 1U1KA 4Y0FA 3UCZP 1X4FA 5IM0A 2BOPA 4UY8T 2CPIA 2LXIA 2ADBA 1FXLA 5GAEU 3U1MA 2L9WA 2MZJA 3H2UB 1VQLS 3IRWP 2DISA 2CPDA 1H2TZ 2KVIA 3B4MA 1U1MA 2XNRA 3CC2S 2EK6A 2GHPA 2DNZA 5LSOA 5DDRC 2LECA 2CPHA 1YHQS 3SDEB 3CUNA 2VODA 3I55S 2QFJA 1FJCA 5IFMA 3CCRS 1SJFA 3UE2A 1WG4A 2KT5A 4UQTA 1D9AA 2RUGA 3OW2R 2DNNA 2RRBA 3CTRA 3CCUS 1U6FA 2DGVA 2AD9A 2MHNA 3V4MA 4TU7A 2MKKA 4ZKAA 1X5SA 1PO6A 2MGZA 1M5VC 2MYFA 5IQQA 1N88A 3ZZZA 2DGOA 2RVJA 2MXYA 1Q81T 2MZSA 2MKHA 2DH7A 1QVGR 1WTBA 1H6KX 1JJHA 3UD3P 3ZZYA 2YKAA 1DZ5A 4QPTA 3R1LA 4W92B 2MQLA 1KC8T 2CPYA 3G8TA 5GAHU 1VQ7S 2CPZA 3MOJB 2ZJQQ 2MZ1A 3MD3A 3G71S 1Q86T 2F9JA 3P5TL 1U1QA 4FXVA 2FPHX 2KHCA 3NS5A 3CCMS 2LCWA 2DK2A 2DGTA 4WCEQ 2XSFA 3G4SS 3NNAA 2HGNA 3VAIA 1Q82T 3CCLS 2NZ4A 2OSRA 2OTLS 1OIAA 4QU7A 2J0QD 1X4BA 3LPYA 1K8AT 4ED5A 2U1AA 2DH9A 3PIPQ 4U67Q 1ZZNA 1NU4A 3SDEA 4F26A 2N3OA 3P6YC 3VAFA 3I56S 1R8HA 3EGZA 2OTJS 3JB9k 2JX2A 1M5KC 3SMZA 2M8DB 2E5GA 1K73T 3CMAS 1ZH5A 1D8ZA 1K9MT 2EVZA 2M70A 2CQBA 2CQ1A 2DO0A 2JVRA 2MQMA 1KD1T 2PE8A 2D3OR 2KXHA 2MMYA 2FHOB 1WI6A 2MQOA 2J8AA 2MZTA 1SJ3P 3H2VE 2U2FA 1JMTA 4CIOA 2M0GB 1X4CA 1DRZA 2YWKA 4WIIA 1VBZA 1S79A 1X4EA 1XN9A 2LKZA 2CQDA 1P1TA 2DNHA 3S01A 1YI2S 2DGQA 2MQNA 5DM6Q 4WF9Q 1O0PA 2LQ5A 3P49B 1P27B 2XNQA 2OIHA 4OZ1A 1WHWA 1NO8A 1SJ4P 1PGZA 3VF0B 5H1SV 4EGLA 1QM9A 1VQNS 2RRAA 5JVHQ 4WFAQ 4PRFA 2KM8C 1YIJS 1UAWA 2MJUA 1WEZA 2XS7A 2G1DA 1SXLA 5DDPC 1OO0B 1N52B 1WELA 2DIVA 2F3JA 2X1GA 3DLLQ 1QVFR 4WFBQ 3CCES 2MB0B 4P6QA 1YJNS 1U1LA 3THTA 2QEXS 2DNYA 1WF0A 2CQ2A 2DNKA 2KU7A 2CQCA 3BEGB 2RNEA 1F9FA 2CQHA 2DHSA 2K3KA 1H2VZ 3VAMA 3R1HA 1U1NA 2D9OA 3CC7S 1A9NB 4C7QA 2DGXA 3RW6A 3MXHP 5DETA 2B0GA 1FNXH 4LJMA 4CH1A 4YOEA 2DIUA 3VAJA 1VQMS 3TP2A 4QU6A 1X4AA 4PKDB 1SJQA 1YJ9S 5CXTA 1DHMA 1JJ4A 1YJWS 5LJ3Y 2XS2A 3G9CA 2MKCA 2LYVA 2SXLA 5HO4A 3MUTP 1UFWA 1X4DA 2AYGA 2XB2D 1N8RT 2JRSA 2MKIA 3Q2TC 1VC5A 2M88A 1WHXA 4CH0S 2FC9A 4YUDA 3UCUP 2LA4A 5DDOC 3N9UC 2KFYA 1M1KT 2DGWA 1M5PC 2KG1A 2HGMA 2HVZA 2E5HA 3G8SA 2ZJRQ 1FJEB 2CPFA 3MDFA 3NS6A 2N7CA 1N54B 2DNQA 4PR6A 1JJ2R 2OJ3A 4IO9Q 3SXLA 2MZRA 2MJNA 3L3CA 5MLCV 2DNPA 2JVOA 3CCJS 3VALA 2DHAA 2BZ2A 1VBYA 1DBDA 1HA1A 4IOCQ 4TLQA 3NMRA 3IWNC 3CCQS 2I2YA 1WHVA 4LIRA 4ERDA 1YITS 1W2BR 3US5A 1URNA 3CPWR 2KN4A 2VOOA 1WF2A 3MD1A 1VQ9S 2AYMA 2DHXA 2DNMA 2GO9A 4IOAQ 2MY8A 3CD6S 2E5JA 4LMZA 5D77A 2KYXA 1FT8A 2PEHA 1WHYA 3PIOQ 2G0CA 1VQ6S 1X4GA 4F02A 2CJKA 2M52A 1Q7YT 4YB1P 2M4MA 4FXWA 2E5IA 4QQBA 3TYTA 2KXNB 3MUMP 3S7RA 1VQKS 2CQ3A 1BY9A 1X5OA 1SJRA 5BJRA 3THPA 2QA4S 3VAHA 2MZQA 4F25A 2M9KA 2A3JA 2RQCA 1YWXA 3UCGA 3R27A 3Q2SC 2K8GA 2N3LA 3G6ES 4IUFA 2G4BA 1HD0A 1ZZFA 3CULA 2KI2A 2RQ4A 2AYBA 2E44A 2LXUA 2X1FA 1X5PA 1KQSR 2MQQA 3BO4A 2ZJPQ 1M5OC 1YTYA 2LEAA 5GADU 2DITA 2CQPA 2YH1A 1HL6A 3G96A 2DNGA 2YTCA 5JVGQ 2VOPA 1B7FA 2N82B 2ADCA 1VQOS 3EGNA 5GVQA 5ITHA 4W90B
chains in the Genus database with same CATH superfamily
1U1RA 2DEJA 3BF4A 2YKNB 2F8HA 1NK4A 2YPZA 4WFXA 2LEBA 4DUZF 4I6AA 4DOZA 1E6VB 4Y2MA 1A7GE 3HFKA 4DR6F 4NRUA 2Q79A 2IA6A 1IBKF 1OQ6A 1HNWJ 2FC8A 5JUMA 1CG2A 1HW8A 1FXDA 4CLPA 3UNGC 1ELOA 2F4FA 1BQNB 1S1VB 3EPGA 1WNEA 2I5JB 4FKXA 1VYAA 2DCUB 3HX9A 3VGSA 4HHHA 4OHVA 4GKKF 1VHFA 1NH8A 2QYCA 4X4NA 1VI7A 2YVSA 3NNCA 1HWUA 1CJUA 1BHNA 3GONA 2LLZA 4KHPJ 3ZZOA 3BGRA 1YG0A 5IC4B 2QSFA 3P5BP 4ZN1A 2J9DA 3ZZ0A 1OSDA 1X0FA 4RNFA 3J81Y 4M94A 3D3BJ 2VIHA 2HMIB 5E41A 2QLWA 5CA5A 4NYZA 1GTEA 4UOGA 3RRGA 1X4FA 5IM0A 2BOPA 4UY8T 3CDBA 2CXEA 4NCGA 5A2QY 3MR5A 1TK0A 4DR7J 1TL3B 2HQDA 1F9HA 1NHKL 3CD0A 2CPHA 3WDOA 3CUNA 2XLKA 2H65B 3DDNA 3M8ZA 1N0UA 1F0XA 4DV2F 4F4XA 3GCWP 5CYMB 1RA7A 5KFNA 5F3TA 1TUWA 3TQEA 1TQLA 1T3NA 1WTBA 1TKXA 3HVTB 3HZEA 2MQLA 3WIVA 4A8QA 2VFTA 4EBDA 2W4DA 1WTFA 1RJJA 3OFHA 1T0TV 2OI2A 3KLVA 4OI6A 3E51A 4YB6A 1RU2A 4DS4A 1KONA 5T41A 1HBOA 3FQLA 4DX8H 2RDDA 3QAEA 1EETB 3TAMB 4ED5A 3J7Z5 5CHCB 4GMKA 4M5JA 3AB4B 3ENWA 3GIKA 2OP5A 2I0XA 1K73T 3CMAS 3M8WA 1Z2ZA 1C0UA 3BSAA 3V2UC 4QWAA 4U95A 2W2OP 5J2MB 4FBTA 3GFHA 4CLYA 4USKA 4NLYA 1FFWB 4WJBA 2E7WA 3Q8RB 2LQ5A 2OPRB 1ZPVA 3OJUA 4NLPA 1FWLA 3UW1A 3DKDA 1HBUA 5CH7B 3DOKB 1CJTA 1UAWA 2JEJA 1AZSA 3NGTA 3ENQA 2DKOB 4JI7F 3N6LA 1LKZA 1XMOF 5J2QB 2H9ZA 3A8JA 1H2VZ 3NKYA 4ICLB 3EVMA 4UOCA 2XULA 1SCJB 3WC0A 1YBTA 5D0EA 1DAXA 3EJMA 5HO4A 4FVMA 2AJFE 9ATCB 1CULA 5DDOC 3G8SA 2YWWA 2KFZA 2QE5A 4BBYA 1SH3A 1U2RA 3I9ZA 2DNQA 2RRNA 4IO9Q 3TEHB 5KFXA 1F5AA 2GNKA 2J9CA 3FQKA 1RTZA 2B8PA 1IBKJ 3NMRA 4URGA 1RTIB 4RW8B 2ZH5A 1NEEA 5CYQA 3GV8B 2VOOA 4CLZA 2DHXA 1RT7B 2GO9A 3DOLA 2ZZMA 3NAIA 3J81U 4V1Ak 1FX4A 2LEPA 2R2RA 4F4ZA 3W5YA 3NGSA 3UCGA 2XCPA 3OSPA 2MEWA 1NPRA 5AT1B 1E6YA 1TTHB 3R6LB 5A2QU 3H42A 3PZPA 1FERA 3WC2A 1EIYB 2FVRA 2W2NP 1YTYA 5GADU 3CEDA 5HQ8A 2GV1A 5K5MA 4PG4A 4PG6A 5ITHA 4OIXA 3NGKA 5LMUF 3R5DA 2DR5A 2A10A 2X51A 1UVKA 4J9NA 2C2DA 2EC2A 2HNDA 2HNYA 3T5HA 2H48B 2NXEA 5EWGA 2AJQA 4LSNB 2IMWP 4ZCKA 2W8KA 2RUSA 2B9EA 3K59A 2HVHA 2NCKL 2WZ1A 2CVIA 4K50A 1B64A 1KOOA 1S9GA 2QLJB 1NDCA 1X9SA 1FDAA 1M90T 1S1XA 2ZE2A 2KFNA 2R2UA 2CAJA 5KFGA 4K4WA 3HI9A 5KG5A 1MG7A 3MAAA 3I0SB 2WVBA 3T6JA 1UCNA 4DV2J 4J9UE 5HL7Q 2WBMA 2HNZB 2J76E 4JI2J 1S0MA 1I1GA 1JLBB 2C42A 3VVTA 4G6VB 2LP4A 4KGMA 2XHCA 1LW2A 3ZNJ1 4FKYA 2MSSA 3FEXB 2IJRA 3D4JA 1RHMB 5HN0A 2P8IA 5DLFA 3R7SB 2MQPA 2F8EX 3ZZRA 1AB8A 2YBVA 1FEEA 1LWEA 1VQ5S 5D8HB 3THVA 4DL5A 4HACB 2ZM6F 1FKAF 1NDPA 4KGXB 3W63A 3CT9A 3NRBA 2VFVA 1RWUA 1D3WA 4ATNA 2W2MP 1S6QB 3EDRB 4Y2KA 4HEA9 5LSOA 1JKHB 5HK4A 3PW0A 4I64A 3DRSA 3DLJA 2F8MA 4IRCA 3KMSA 2BJDA 3L7UA 4AL5A 1DURA 3OUYB 1NSQA 3DLEA 1CJVA 2BW7A 3MCNA 1RT2B 2DRBA 4X66F 1R6VA 1C1CB 3ZZYA 4FYWB 4LRFA 4ZJOA 1NPKA 4KRWA 3V81B 2D3O1 3LWLA 5A8KB 2Q1LA 1LFPA 1D0EA 2G9OA 3CJQA 2HQGA 4OYXA 2AGOA 2WVCA 1DTQB 2HS3A 4IG0A 1FKOB 2AT1B 4QU7A 2JC1A 4YDXA 3O3LA 1ZZNA 1NU4A 3SDEA 3MM8B 1LWCA 2B4OA 2YWHA 3GIMA 3PHEA 2DO0A 2YQ1A 4DCOB 3UR3C 2KXHA 2FHOB 3CWJA 3K8VA 2L48A 4EYIB 3DFEA 2PFDA 1LW0B 2YWKA 3NCPA 1PBAA 3FCWA 1DTTA 2ZOMA 3SSQA 4C0HA 4IFYB 4MFBB 3VF0B 4ETXA 1D9DA 1PIEA 1VQNS 1FE4A 2OH2A 2H3EB 1FD2A 4B17A 5CD4A 3JSMA 4OX6A 3FBFA 4HT5A 2CDRB 5I4MA 3AHPA 4USHA 2EBGA 2DGXA 4BHQA 1RHUB 2ZNZA 1YJ9S 1ZAXA 1NZAA 1U0HA 3KHRA 2W2QP 3MUTP 2VC0A 1SIZA 4WE1B 3V4IB 3HHEA 5LMUJ 1DQAA 3W66A 2XWXA 4HDHA 8RUCA 1GEHA 1MWZA 3AJ2A 5E2QA 3BKUA 4K0KF 2DHAA 3KDNA 2BZ2A 2KT3A 5C24A 4ERDA 3JYTA 2LQBA 4OYMA 3GJSB 4QR1A 3CJ8A 1BMQB 1RCOB 4ECWA 4J37A 2AZ1A 3PIOQ 2M4MA 5HAOA 1W2IA 2ZD1B 1RACB 3K58A 4QIGA 3W5XA 5HBMA 1BWVA 1R0CB 3G6ES 3NOGA 1NJYA 1ZZFA 1KWMA 2ZH3A 1LOUA 5EWEA 1REVB 1OPZA 3RBDA 5HATA 2V8PA 4QZVB 1Y5NB 2Z58B 4A8WA 4F4AA 1HW9A 1HWIA 3QRQA 3FJ2A 1HBNB 5DO2A 3GYNA 4DLGA 2YKMA 4WXOA 3UD4P 3R6GB 2ZWPA 3MR3A 4J9OA 3RTVA 1WORA 3K5OA 4Z7YA 1WUUA 1IBMF 5IZHA 4L74A 2D1CA 4X4VA 5CCMA 1A0OB 5D0HA 2WONB 1N5VA 1N0VC 2B9XA 4IQMA 1TV6A 4K4YA 4ILMA 1PAEX 3GYGA 2X1AA 3ZZTA 1U09A 2C2EA 1VRUA 1UVMA 3LAMA 4PXCA 3R5GA 3CDEA 4V19J 4LIWA 4AXJA 2UU9F 3C16B 1D09B 1KKHA 3RUBL 1FDBA 4TQSA 2AP6A 5M2UA 5CYJA 2ZITA 4PQUA 4X66J 5B0GA 1RT4B 4WFNQ 4DL7A 3GILA 1S10A 1I5OB 2GIQA 4LR8A 1JB0C 2VF3A 4ZVTB 3RRHA 2HBZB 3G82A 3GR1A 4IR1A 3UCZP 3VZHA 1SUQA 2ZKTA 4D3HA 2MZJA 3HD2A 4DPOA 3IRWP 4KJIA 2GGPA 2AGPA 1T9TA 5ETLA 2VBYA 4EBEA 3GE9A 3D68A 5E7OB 3ITHA 3ADAC 2BQ3A 2PD1A 2RRBA 5KTQA 1Q5VA 3ONQA 4MMOA 2MHEA 4NI2B 4DFPA 3E01A 3D6HB 4C8OA 4ITSA 1IWGA 3D5MA 2KVQE 2V4JB 3EVOA 1RAHB 1S1TB 4W92B 3G8TA 5GAHU 1AFIA 1Q86T 3P5TL 3NAHA 1HNIB 2L9DA 5AXKA 3KFWX 2E5LF 1NJXA 2VG6B 3IG1B 3VAIA 4M5HA 1RGVA 3KLEB 2NSBA 1RU1A 4Y3CA 1RTDA 5E3RA 4ELVA 4KSEB 2EFQA 4IFVA 3KLHA 3FBEA 3VAFA 2BABA 1JXEA 3JB9k 3D67A 3RZAA 5F0WA 3OXGA 5CCLA 2VDHA 2F65A 3HHLB 2YNFB 3CVKA 2DY1A 3OFGA 2MMYA 2VV5A 2MZTA 1I51B 4K0KJ 3AJ1A 2CVEA 2PFFB 1NK7A 2VG5A 5EHHA 3BPSP 1GMUA 3D3CJ 2DR7A 4DR4F 4K4ZA 1MROA 3A3NB 4DQPA 2RB7A 3LP0A 4KGVB 4U6PA 1QM9A 3W9JA 1FNOA 2RIJA 3FSIA 1WEZA 3FGVA 5F8MA 5DQGA 2EEYA 5DG8A 3V5RA 1WF0A 2QFIA 4H4MB 2A18A 4NE9C 5KFJA 4WBFA 4FNIA 3VAMA 2D9OA 1MSWD 4WFZA 4YOEA 4DJBA 3VAJA 4KR0B 1SJQA 1NRKA 1JJ4A 2ZZTA 5HJXA 2Z8QA 4YFUA 3MM5B 1FRXA 2AYGA 2YNIA 1EARA 1FRHA 3KG4A 4R5PB 3EWGA 3QGPA 3K17A 4JI1F 6FDRA 4KIAA 3M9OB 5HVFA 4NLUA 4IRKA 1Z1ZA 2FLPA 3PJWA 1IBMJ 2DNPA 2B5JA 1NBEB 4DU8A 2VJUA 1HI8A 2VPWB 2ZVIA 2HBYB 3UN5A 1X9WA 1QY7A 1PYTA 3VGTA 2GQQA 4DPWA 3KK2A 4N47A 4O0IA 3IA0A 4M5IA 5F8NA 2EG2A 2PI4A 4AL6A 2A3JA 2RQCA 3NBPA 2N3LA 1HD0A 2KDOA 1F2GA 1RT5A 2Z0GA 3R5JB 2ZJPQ 2GJIA 1T8EA 2DNGA 2W9AA 4CTAA 2DNLA 4CYUA 4M5DB 2QL9B 3Q22A 3RB4A 4EU0A 1T9VA 1QAYA 4IH5A 1KLMB 1TVRA 2HHTA 2FZCB 3W62A 2HHQA 2XQCA 1U1OA 1SQFA 2ZNYA 4KO0B 1WI8A 1N6QA 2R7OA 5B0BA 1RWKB 3MWBA 2XSJA 3EZOA 4NA2A 3KHHA 5E3PA 5HJYA 1SV5A 3T1AA 4RWXA 1HKAA 2FZGB 3ULHA 5KFUA 3MURP 1WJ9A 4HHJA 1QE1B 2UUWA 5LMNF 5GAEI 1Y11A 3IFEA 1QAIA 4CQ1A 1T3OA 2XEXA 2ZH4A 1U47A 1M0SA 1J2VA 2HQCA 3T9ZA 1PAUB 4DL6A 2IPOB 2XHWA 4DV5F 5KFHA 1H7WA 2VG7A 5EDWA 3J7AN 1ROFA 2DGUA 5LSLA 3DC2A 4ZPDA 2NXNA 2I38A 2BDPA 3MF5A 3KLIB 4NPOA 4KFBA 4ECYA 1N4LA 5C42A 1REGX 2KO1A 4NLSA 3KK3A 1HYSB 1S9EA 3PM9A 2MY7A 4I2PB 1U1PA 3MTJA 2FVQA 2COLA 2E5LJ 1L3VA 4OZ0A 3DRPA 4F4YA 4DZ6A 1KLNA 2PEBA 1YZ6A 2DHHA 3SEOA 2QGFB 4P7TA 3UDLA 4ES2A 1U1MA 2VH7A 2ALZA 4OHZA 3T1HF 2JHEA 3NGDA 3VHQA 2UXDF 4JB8B 3CSKA 2J6UA 2VPZB 3H5YA 2AD9A 1YKWA 5KFCA 2Y1JA 2MKKA 1SPBP 4B3OA 4ZKAA 2QO3A 3ELHA 1MU2A 2OFHX 5HQLA 4DR4J 5HMXA 1JLQA 1M5VC 1SC6A 1BQXA 4A8OA 1FKPB 1S4FA 2UUAF 4PXEA 4YDDB 4QPTA 2D41A 1GMVA 4B9VA 1S76D 1F2HA 3CCZA 4LF9F 2BACA 1BQMB 5ETQA 2BQRA 1Q8IA 4QW8A 3FSYA 4DV6J 4Q7AA 2FB0A 2XSFA 1SQEA 3C46A 4WYLA 2EI5A 1Q82T 4MAKA 3HSDA 3BYRA 2BJ8A 3PX0A 3JTPA 3P6YC 1TUGB 2FHJA 2OTJS 1S97A 1T9UA 4KB7A 1NCLA 4JI1J 3KJVB 2V9WA 2MQMA 4I6WA 4KKOB 3L09A 2GA7A 1BE4A 2F7VA 3I9V9 1QTNB 3UN3A 1YBAA 3VCDA 1N5QA 2XWYA 3OL6A 1LWFA 4OX9J 4WP9A 1BLUA 2OMLA 2HWHA 1P27B 3D9BA 1S77D 1SJ4P 2WOMA 1YBUA 3DI6B 3I0RA 3OD2A 1QAXA 2A0FB 1RWWB 3QO9B 1SC4B 3RBZA 1WELA 1X8DA 4OX7A 3TZXA 3TJAA 4NCBA 2Q43A 3GG0A 2C3PA 2BV3A 1JWWA 4FYDA 2ZH7A 5EWFA 4IDKB 1PJ7A 4A46A 3EZUA 3GFYA 2ZBIA 4UUWA 4QU6A 4Z37A 4J9KA 2CZVC 1DHMA 4IG3B 3G9CA 2IC3A 2J7KA 2DGWA 2ZJRQ 4JYAF 2XY5A 2YNHB 2JDJA 1WDTA 2AJ0A 1R3NA 1WOOA 4LF2A 1DBDA 5F8IA 3OR1B 2EFVA 4BCAA 1CLFA 3BSOA 3SV4A 5H9FK 4LMZA 5D77A 2KYXA 4JP8A 1JNZB 3C8YA 3A12A 2HWTA 2B3TB 3BQ0A 3UN2A 1IKVB 2E7VA 2M9KA 1YWXA 4USTA 4RU9A 1UWBA 3BO4A 4DV5J 4USIA 2ROPA 3BR9A 4HH1A 4ZPCA 5KFTA 4JV5F 3ZTPA 3PFEA 1XNQJ 3PW4A 2I8EA 1RT1A 4OZ5A 1HMVA 1VQPS 1CJUB 1R0AB 1HI0P 3BGRB 2D9PA 4ED1A 2HS0A 1Z2LA 1SKSA 3SZ2A 3DHXA 4OZ3A 1S1WA 3RAXA 4EEYA 1RP5A 4AXIA 2DTJA 2ZH6A 2WSCC 5GMDA 5IM0B 2VUGA 3T1HJ 4NCGB 4DL2A 3ZTSA 2UXDJ 1NK9A 5CD4H 1RHQB 1OS5A 3FNNA 1HNVA 4YB5A 4CLUA 3CCSS 5C5JA 2XS5A 2LA6A 5HSPA 1WKKA 4HDGA 2RF2A 3IXQA 2C3UA 2Z2ZA 3GB0A 4HTJA 3BS9A 2P2CB 4OYIA 4K7QA 4DEZA 4LF9J 2W25A 5ETKA 5LJ5Y 4OHXA 3JQJA 1RTHB 1B3TA 3NCQA 2CJQA 3MEEB 2J0SD 2CADA 1KFDA 5H9FJ 1TKXB 2O01C 4NLOA 5KFWA 1AT1B 1HD1A 2VJVA 4Q2LA 1AYEA 4EO8A 4E0DA 1YRXA 2W7AA 4JI3J 2CPIA 4G1QA 1F3VA 5HANA 3M1VA 4DHVA 4R25A 1TP7A 1S59A 4PCQA 2J9EA 3H2LA 2HIQA 3P8BB 3TA1A 4KBIA 1HBOB 2E9RX 3CJ4A 1T11A 1R0BG 4B3MF 4L3KA 5E5NA 1FDNA 2GAHC 4AFFA 4K4UA 3I55S 3PX6A 2XMUA 2E1AA 4USJC 4ECTA 3FKBA 1C0UB 4NL5A 4QYZJ 1KHVA 3H5XA 3MR2A 2PC6A 1LQ9A 4DN9A 4J9MA 3H4BA 3QIPA 4MKAA 2MTLA 3FBCA 3U27A 2YKAA 4DLEA 4ES1A 1VQ7S 1Y5LB 3J80Y 5I3PA 3OLBA 1NKCA 1V6HA 3G6VA 4XAKA 1MNEA 1CJTB 2KZMA 3NS5A 3O6QA 3JTOA 3V6DA 1AZSB 4K8RA 4QJVA 3DDKA 1YQHA 3W2VA 2KJWA 3LPYA 4KYZA 2IHR1 1HHSA 2AGQA 2YQ3A 3D6FB 2WVEA 3A4TA 4OMFG 3OFFA 4U7CA 1WC3A 1EP4A 4JYAJ 3H90A 3HVWA 3NY0A 4ZCIA 2W01A 3N4WA 2IM0A 3LOUA 1CS4A 4DXLA 1SL2A 2LKZA 2B8QA 1ZA2B 3S01A 1FTCA 1JXLA 3GSDA 3AAWB 3B8HA 3GIIA 4NLVA 4WP8A 1NJWA 4PUOA 2RRAA 3GIJA 4QWDA 1KEKA 1N56A 5CYQB 2G1DA 3N5BA 3DOLB 2FVCA 3TUZC 2F5GA 4YS2A 2K3KA 4LF8F 1MN9A 3LP2A 5F9LA 3BPDA 4LJMA 2DIUA 4BLGA 1WDDA 1S57A 2OPQB 3TZZA 3ETOA 4J9PA 4JV5J 4ZLPA 1AA1B 2HWIA 2IFXA 1TL7A 3UCUP 4ZVPB 1M1KT 3F0NA 4P7VA 2R7QA 4H54A 1JIHA 3AXKA 3GLJA 1KVJA 5K8PA 3CCJS 2HNDB 2HNYB 4NXNF 2DXDA 3CB4A 2FHJD 3LGMA 4GC6A 1YITS 1RWOB 2KN4A 3PR4A 3MD1A 3ET6A 4C8KA 4DX7A 4OV6A 4I69A 2G0CA 5GAGI 2CJKA 3J7YI 4OJ3A 3HULA 3EZ5A 1MWQA 1S9GB 2ABYA 5F8HA 2KJVA 4LFCF 4DL3A 4C3LA 3KUHA 3LTOA 4U9RA 2VICA 1R27B 4ES3A 1CEZA 2FJVA 2YTCA 3MAAB 4RBTA 4LSLA 2GMJA 1VC0A 1V9OA 4OYAA 2ERRA 1U25A 1NSKL 4FDFA 1YRUA 1RDRA 2ZBQA 1OPIA 4ZITA 1VQ4S 4QWCA 2ASLA 4F0MA 1LW2B 1P9QC 2DXEA 1VRTA 2J9DE 4ZJLA 4G1IA 3J80U 3HHNB 2GVZA 2L41A 1LWEB 5A8WA 2CWXA 3OVBA 2DHGA 4K5SA 4GKJF 3E3XA 2XLIA 2HKEA 5I3UA 4EBCA 4NCAA 3RRKA 1VDHA 2MLZA 4GVBB 2AZ3A 3DRSB 4QR2A 3NL0A 1RBOB 2EFOA 2OPPA 2F4VF 1NUEA 3UWTA 2NXUA 1CBKA 3HCXA 2RHQB 3M2RA 4TY8B 2L08A 5D78A 3DLEB 1CJVB 4MKBA 4MIWA 4OI0A 2CQ4A 1AROP 4WKRA 4U96A 3L95X 3HKZD 1F6TA 3CC4S 2JH3A 3KLFA 4DQRA 3M4XA 2JFKA 5ETMA 2G0JA 1R6YA 4RZRA 4MJKA 1RLCL 3GIRA 4DV0F 3ZZPA 3QSYB 2CJ9A 2HGLA 2V8DA 1U1KA 2Z57B 3R8YA 3CJ2A 3BB5A 3QPIA 4I7FA 3GPAA 4Y28C 3MMBA 4D3GA 2HBRB 4DV3F 2BQUA 4C97A 4IG0B 1AUSL 1S0OA 1FRMA 3PHTA 4XTTA 4TXSA 3SDEB 3UDCA 1EZZB 1LWCB 4ZVRB 2KT5A 1D9AA 3B54A 2P9GA 2RUGA 5DQHA 3UDEA 2UXBF 3MPUB 3J7A1 4ELTA 4R8UA 1X5SA 1PO6A 2DGOA 2F40A 3HSJA 3UFCX 2AEFA 2C22A 4F3OA 1YJTA 3A8IA 4ZCLA 3AD8C 1DTTB 4FPIA 3OR2A 1UZHA 4ZA1A 4ED6A 3VVUA 3G71S 2QC3A 4DQQA 3TVYA 5T7LA 3PKYA 4FXVA 2Q6CA 1RBLA 4NZ0A 4OQJA 4LF8J 1HQEA 4M5NA 2IVYA 3CCLS 2NZ4A 1E6VA 5K8OA 4KY3A 2QA1A 4NXMF 4CO2A 2RMLA 4RNNA 3LALA 3NGRA 3PYDA 1U0HB 2AX0A 2D3OR 3BREA 1ITPA 1Q0NA 3OFEA 3QBCA 4ZP8A 2HHVA 3WX8A 1LK5A 2FGOA 1SJ3P 3MM7A 2ASYA 1Y7PA 1X4CA 4B3RF 1S79A 2I5JA 4NXNJ 3W64A 2DGQA 3Q8SB 2ZHOA 3QQCD 3GG1A 2OIHA 5L8RC 4F36A 4FP9A 4OFZA 5C24B 3PVXA 3AOAA 4DPUA 3JYTB 3W61A 5E3CA 2OPSA 2E9TA 4UY85 3O1LA 3LAKA 1F9FA 5KFMA 3FBBA 5JJBA 4LFCJ 4C7QA 2W9CB 4R0EA 4E8UA 1ICEB 3VZIA 3NCRA 1X4AA 2KT2A 5CXTA 3HLUA 5KG2A 4DFMA 3PYGA 1TFYA 2FZKB 1ZPWX 2NXCA 4IH6A 3UVJA 4DV4F 2KTQA 2V2QA 5E0OA 4OJHA 4OYWA 2R7XA 1TL3A 3GJRB 2PMHA 1S9FA 4IOCQ 1UEVA 4TLQA 2OLWA 5THWA 3IGNA 1DY3A 3R7NB 4UTGA 4CLKA 3QZ8A 1WHVA 3GZ7A 3NWGA 4UQGA 2DJWA 1IJEB 2E1PA 4ZVHA 2B4PA 2ZFHA 2QZ8A 1ZAVA 1WHYA 3AODA 3KUEA 3TA0A 3NOCA 5CYMA 2V4RA 2M52A 2OUGA 3ZC4A 4YB1P 3TYTA 2KXNB 3QWUA 3S7RA 2CQ3A 1UETA 5BJRA 1TV6B 2JOQA 5K8MA 3WBZA 4IUFA 2RQ4A 2FLOA 1VRUB 4DQSA 2LEAA 4J9SA 1RYRA 2GHWA 2F4VJ 5JVGQ 4X4QA 3QATA 4G1PA 2F9DA 3P45B 4PWUA 4O3PA 2G2OA 1EETA 1UVIA 2LQ8A 4N77A 4DL4A 2KM8B 3DYAB 2E29A 2NPIA 5C25A 3PRVA 3QRPA 1T9WA 1HBMA 1FCAA 1IKYA 1HNXF 1V5IB 2DCLA 1KQGB 4LSZB 2RILA 4FF2A 2W4PA 4PWDA 3C6UA 4DV3J 4G3IA 2OMOA 4GRSA 1WKJA 2VQEF 2VFRA 3G82B 4XDDA 3HJFA 2AX1A 1FJ7A 2GGPB 2HRTA 3AY0A 2CQIA 2UXBJ 2NSCA 2AYEA 3G6XA 3ITHB 3QRRA 3K7RA 4ZN3A 3HVAA 4NZ6A 2JLEA 2VD3A 3C6TA 1HHTP 3OTDA 4YQWA 2H1YA 1OMSA 3P3DA 3GCXP 2UP1A 1HIYA 3E01B 3ILOA 1NPPA 2HLUA 2AU0A 3L9ZA 1FO1A 4N7TA 4RU2A 3AA9A 3QT5A 2ZDPA 3GQCA 2QG9B 1IUJA 3BJYA 2DNRA 2BJ1A 3R2DJ 4C8ZA 2AHOB 2Y9HA 5DDQC 3QFHA 4J9RA 1RI7A 2R42A 1FXLA 4NXMJ 1YJRA 3M7VA 4NYPA 4U8VA 3LP1A 2KVIA 1RTDB 3N01A 2EK6A 1VLOA 3QNWB 2QLXA 1RTIA 4FYVB 1XERA 2UXCF 4IFVB 3KLHB 2XMWA 3Q8UA 4PYAA 2QFJA 1RAJA 4Y34A 1WG4A 4PEOA 2C3YA 2DNNA 3CCUS 4B3RJ 5IOLA 4FNHA 4K4VA 2NR0A 2O5DA 5L1LA 4ANEA 1TKZA 3LGNA 2AW0A 3MECB 1VJWA 2CPZA 3QT6A 1VIOA 2GQ2A 5J1NA 4X4UA 3LP0B 2F9JA 5AE2A 3O5TB 3HM9A 1XMQJ 3BDPA 1MMDA 3G6YA 2DR8A 1UFKA 2B43A 4RW4B 3EE3A 3SFUA 4IRDA 2WHOA 2N3OA 4CCHA 3RG6A 3CCWA 3EGZA 1TFWA 5KG3A 3TZYA 4DSJA 4ANDA 5EX0A 2I6WA 2YNIB 3DU5A 1WI6A 4RLEA 4DV7F 4UUXA 3ZTOA 4XK8C 3KDOA 4NLDA 1UJ6A 4TLRA 2DNHA 1XEZA 4X65F 3CJ5A 5KT5A 1RAEB 2HAFA 3G87A 2E9ZA 4C2MA 2HFZA 3W9HA 2B5JB 5KFEA 3LGHA 5A8RA 3MEGA 3BH7B 1KRPA 5JVHQ 3CMQA 3DCAA 4RWWA 5K9FA 3RB3A 2OD4A 4TYBA 1BWEA 3K2YA 2VA2A 4URQU 4UW2A 1V3RA 2ZWOA 2DRDA 2DNYA 2CQCA 3BEGB 3KK2B 3AXMA 5DETA 2PA8D 2O66A 2OELA 5CAAA 2HQ3A 1HI1A 3NBPB 1VK8A 2FHMA 1KDNA 3MGJA 2LYVA 2PA3A 1UL3A 1JNRB 1X4DA 1J5OB 4ED7A 5L38A 3Q2TC 1RT5B 4NZ7A 4EFAC 4UT4A 2C1EB 1WHXA 2DPJA 2CNLB 3F41A 3N9UC 4OJ1A 3DGPA 2N7YA 1IXKA 5KFFA 3CDAA 2VC1A 4A8MP 4CTAB 3MDFA 3EXCX 4CYUB 2NS1B 4PXBA 4BC7A 1FF2A 1FE0A 5MLCV 2JVOA 3VALA 1TL4A 1TVRB 4J9VA 7FD1A 5E3AA 2ILYA 1Y3JA 1GT8A 1HNXJ 5C7PA 4LQ3A 5B0EA 3FC9A 1RE1B 2QA2A 2HLTA 1N6QB 2VQEJ 1DLOB 3E2EA 3B6BA 2XSJB 4YY3F 4XPCA 4KV8A 5F8GA 3HMJG 4M95A 2HHUA 3CD5A 3NP5A 4I0WA 2ZBCA 2V67A 3R27A 4ZPWR 5ADZA 3D0HE 4K59A 4RUAA 4C8MA 1M5OC 5KT2A 3ZZUA 1PC5A 4W90B 4JV0A 3PEJA 1WEXA 3IWXA 1DTQA 3CCVS 2VG7B 1T94A 1HWLA 1XTZA 2LMIA 3D1HA 3QT8A 3S8SA 1UP1A 2BJEA 2ZUGA 1RQ0A 2K1RA 1VISA 3FZBA 4P10A 2FVSA 4O4RA 2IJFA 4A47A 1X5TA 2KXFA 2XO6A 4KFBB 5C42B 5FJ4A 3KK3B 1S9EB 4XO0A 4M5MA 1H2UX 4P75A 5AJ3J 4JI2F 3TR5A 3M6XA 2GHVC 3DRPB 3NGUA 4HLBA 1WC6A 1SC3B 3VWSA 4I68A 1IQZA 2UXCJ 2FLNA 2V8VA 1CQNA 4IFYA 2CQ0A 1WC1A 4LR7A 2YX1A 3PYEA 1XMBA 2NZCA 3Q0AA 1YX2A 4A8KA 4DMZA 4UZCA 1H0HB 3RBXA 3PDNA 4WK3A 2ZC3A 2MSTA 3LW5C 3ENVA 1FHTA 2HZAA 4AD6A 1RHJB 3TWZA 2DB1A 1IWAA 1Y10A 4B3OB 1MU2B 3PJ9A 1T05A 4Y2CA 3KK1B 2ILZA 3MPYA 3S6EA 2PI5A 3V4IA 3HVRA 3JS9A 4Y2IA 4TU9A 3NS7B 4ED2A 3H4DA 2FVPA 1FEHA 1WF1A 4CO0A 2R8HA 2JFDA 3WQPA 3W7BA 1VRQC 2IJNA 3IR5B 4HHUA 1U4BA 2R8GA 4JV1A 1XR6A 4A8YA 1VQLS 3VQTA 3FMWA 4K2XA 4WU3A 1D9FA 3B4MA 5EX3A 3D1QA 2BBEA 1GNKA 5B0FA 3PRDA 4X4PA 3HXMA 2PMWA 1YHQS 2XTJP 2QSWA 1SKRA 3W60A 4PG7A 4LRBA 4ZPAA 3I6PA 4DV7J 1U49A 2YKOA 2YX7A 3BGUA 1DFDA 2HEKA 1VOMA 5KT6A 3ZO7A 4X65J 3BZQA 2ZD1A 2XGPA 1Q81T 2MXYA 3BSCA 1HR0F 2BKPA 3VR1A 1LWFB 2PDAA 3R1LA 1KC8T 4OYBA 4USWA 1V3SA 3PX4A 3I0RB 1PKUA 3DRYA 2VFSA 2LCWA 2A1BA 5HP1B 1ULRA 1RT6B 5FD1A 1HBNA 1Y00A 2J0QD 1YJ7A 3AB2B 3H25A 1CJKA 3KLGA 4WZQA 2GJ2A 5LL6d 3I56S 2V6AA 1HWJA 2H4YB 2QN6B 1K9MT 4B9LA 3OTOF 2WONA 3C66A 2MQOA 5E33A 3KG0A 5AXLA 3GU0A 3M30A 4DBQA 5G4DA 3TARA 1DRZA 4WIIA 3VV2B 3OHAA 3X3UA 4Q8FA 2CQDA 4QR0A 1YI2S 3S1TA 4O3NA 2J6TA 1S6UA 2EG1A 1U26A 1JLGA 4OYOA 3JAMY 1FJGF 2W9BA 4YY3J 2HSEB 4P9SA 2NUHA 3C16A 2VKRA 3DLLQ 4KTQA 2MLXA 2KL8A 2Z2MA 3R1HA 1R31A 2MQ8A 2DXFA 1FNXH 2FTRA 3GJTB 2FJDB 1QSLA 2Y1RI 2B56A 4DU7A 3D6TB 3C2PA 3TJ9A 4K4XA 2GS8A 3CJTA 2MKCA 1UFWA 1UWBB 2MKIA 4LR9A 3KKFA 4CH0S 3M8SA 1S12A 3UQSA 1M5PC 1OY8A 2D3ZA 1F9EB 5KOWA 3W3SA 1JJ2R 1SL0A 3ZTQA 5KFRA 1YRTA 2EBEA 1GX6A 4MYTA 4KPYA 3CCQS 3MMJA 1N36F 2RJZA 2XZWA 3US5A 1NNDA 4LF7J 2Z30B 3CD6S 2ZBPA 1GFWB 1K1QA 1YLXA 1FK9A 1XR5A 2J8SA 4NI2A 5GMEA 1X5OA 1C2PA 1IR1A 3O44A 4NLWA 1HARA 2V4JA 1FTRA 3DLGB 3Q2SC 1H74A 4UOFA 2UZAA 1X5PA 4WIQA 2IM1A 3I87A 2ADCA 3QYYA 2VASA 1KNZA 3RU0A 1UTAA 4ED3A 2ZEJA 1RXOB 2FYXA 3A8EA 4LRAA 3GV7B 3H40A 4DUYJ 2VKZG 1GQEA 3POTA 4H4KA 4RUHA 1G4CA 2LU1A 2EFGA 3PXGa 3M8QB 1CPZA 2RS8A 3DRXA 4K2JA 4C98A 4Q43A 3OSNA 5KT7A 3HHLA 2XC9A 5B09A 2YNFA 3HT0A 5F8JA 2MKYA 1PJ6A 1U2FA 2MKSA 3M6UA 2V2KA 3VAKA 4Y00A 3BO3A 2R3VA 3X1LB 3SBMA 4G1QB 1DJ0A 4FYXB 1T9YA 1X0PA 1U6BA 1QSYA 4H4KC 2KH9A 4I56A 4JV2A 2RE1A 3DU6A 2A2DA 4TVAB 4CT8A 2A2CA 4LF4F 2DGSA 3HHLC 4WTOB 1HR0J 1XK8A 1F5CA 1S6PA 2CG4A 1QUPA 2R7RA 1UVNA 2VZ9A 3AQPA 2YKPA 5IWAJ 3QIPB 5DM7Q 3EUNA 1RWXB 1ZYQA 1IQTA 2RD5C 5HVGA 3JAMU 1MN7A 5D4LA 5LSRA 4HYKA 3N6NA 3EMTA 3V6DB 2JL9A 1PSDA 3U1MA 1L3TA 4RBVA 4XDCA 3W2VB 2DISA 4YHHJ 2BUNA 1NSPA 2FLLA 3K5NA 4UZBA 4ZLLA 3OTOJ 4RUBA 2Y0BB 2H5EA 5IFMA 1IR2A 1RBAA 2VBWA 1SKUB 3FDSA 4FF3A 4FS2A 4EZ9A 1U02A 2E1RA 3B82A 2RHSB 5DQIA 1QTMA 2MGZA 2QTWA 1RLDA 4FPRA 5IQQA 4OI2A 4Q44A 2BE2A 1CS4B 3HSGA 1FJGJ 4RW9A 3UD3P 4BWMA 3AOCA 3OTBA 2M5YA 1RTJA 3QFWA 1ZS6A 4PUOB 3M8PA 5KG6A 1X60A 3GMGA 4WCEQ 4N41A 2AQ4A 5M2PA 3Q86A 4ZP6A 2C2RA 3NNAA 1TMMA 3OXFA 4I67A 2EKNA 1OIAA 2R9LA 3PIPQ 2EW9A 3LP2B 3DMJA 2JNJA 2AJ4A 1JJCB 3UR0A 1D8ZA 3MAHA 3OL7A 1IR0A 1P1LA 2DEIA 1G3OA 2WAQD 4KAIA 4GC7A 4WTYA 1JMTA 2CUYA 4CIOA 4L6V3 1KQKA 5D3GA 1N36J 1BD6A 2OFGX 4EGLA 1UWAA 3BR8A 1FRLA 4WXWA 5KFOA 5DDPC 3E8OA 2XGQA 2GJFA 1QVFR 4DR3F 4WFBQ 4ILLA 3ILJA 1U1LA 2QIFA 3ET6B 2V0NA 1H98A 4DG1A 1YGYA 2GC8A 5HROB 3CC7S 2EWHA 3R3TA 4LREA 4ZK7M 3SQOP 3HHKA 1X9MA 4PKDB 3L7PA 5AXMA 2XS2A 7FDRA 1VHIA 4GVLA 1WC0A 1N33F 2OAUA 1UJ5A 4YB7A 2ROGA 5KFSA 2XYPB 1HPZA 1WACA 2DBBA 5GADI 2G13A 2C2MB 4DPXA 2FJWA 2CPFA 2ZH2A 2V68A 2Z4PA 2N7CA 4W98A 1C0TB 1XWLA 2MJNA 3CIZA 3KJFB 1HHQA 4L72B 2YNGA 4FYYB 3IS9A 4P2XA 1N34J 3IRXB 3QJLA 4NLQA 4QIFA 1JLEA 4URSA 3ZNUA 5D4OA 1URNA 3D6MB 2IM2A 5KFKA 4NYOA 4RNMA 4IOAQ 3ILIA 4E98A 2RQKA 1X4GA 2V34A 4F2SA 2HFUA 5IS2A 2E5IA 1NDLA 2LDIA 2GVZB 4KPCA 3VAHA 4RNOA 3TX0A 5A8WB 5BR8F 1LXJA 1FXRA 2E44A 1NKBA 2MQQA 1GMWA 2G2YA 1BQMA 2DITA 3GFXA 2BANA 3IO1A 1GTHA 4QBUA 4LF4J 4MK7A 2XLJA 3QLHA 5I3UB 2LFVA 2BMBA 2QL5B 3P4UB 1WWHA 2CNOB 4LVOP 4ZVQB 1IJFB 5CQGA 1OYEA 1NB7A 2OPPB 4ID5B 1KVKA 1WEYA 4EYHB 1UJ4A 2NLWA 3W2WA 3NEKA 3IN5A 2GVDA 3A3PB 1FFSB 1UVLA 3MMAA 3WHIA 2OGUA 4KKOA 1QD1A 2C28A 4WFYA 3KLFB 4NEYA 3MTKA 4OYPA 2DH8A 2B4VA 1RYSA 4I7FB 3MMBB 1HQUA 1B4SA 3LH2S 1MMLA 3TNVA 3FCVA 1KOHA 3PW5A 4DR2F 1VMBA 3D0IE 2Y0SD 4ZP7A 2BYCA 4DUTA 1RWMB 3IGVA 2EK1A 4MK9A 2QMXA 1M1GA 4M8LA 4BS2A 2W1BA 2CKWA 4NLXA 3K57A 4J5OA 4P52A 4A8XA 3AA8A 4MIBA 2KHDA 2ASDA 2IMOA 2HHPA 4ECRA 2UVUA 1XNRF 2XMMA 2O3DA 5F8LA 2ACYA 2B9YA 2WCXA 3OR2B 1TL1B 5KFBA 1H73A 3T6BA 4EK2A 2W24A 4C9DA 2HAIA 4CDIA 1HQEB 2L9WA 3HSZA 5DG7A 1ZETA 3T19A 2CPDA 1T03A 3CO0P 1LV5A 5DGBA 4MT1A 5A0YB 5DDRC 3OR1A 4ZPTR 4LQ9A 3MOZA 3HHLD 1SJFA 4O44B 2HRUA 5BYSA 4ED4A 2NUUG 3OW2R 4LRDA 4AYBD 1I6JA 1X31C 4DV6F 4KGKA 4L76A 4N56A 2UUBF 5JMNA 2LU2A 1IKVA 2LDYA 4QIEA 2MYFA 4HT7A 3QAUA 5SUHA 1QLNA 3MM7B 2B7BB 1H6KX 2V4QA 1X7VA 2GMLA 3RAMA 1WSRA 1U48A 1L3UA 3JSYA 2AF6A 3W8GA 5IT4A 4OHWA 1FVQA 5C2GA 4DR3J 3LUYA 5D4PA 3GJQB 3HPOA 4ECZA 4ZP9A 3M8RA 5J1EB 1ZM3A 2OPSB 1R0AA 9RUBA 2R7SA 3EYZA 4OX9F 4C11B 3H8YA 2V5HG 1VFJA 4M5LA 4EUVA 1N33J 2B7CB 2YXLA 5B0DA 1M5KC 5KFVA 3V6KA 2D7SA 1EJ7L 2PE8A 3W5ZA 1UFLA 3ENAA 4NMXA 1FESA 3UVJB 4OL8A 1S7HA 3MR6A 4RW6A 5T14A 1O0PA 1TKTA 3D28A 1RWNB 1SI9A 4U7UK 4DDFA 4WFAQ 4PRFA 2H5JB 2Z2YB 4ECXA 4ZHRA 2GAGC 1SB6A 1M5SA 5I42A 2VPYB 4ECSA 5BR8J 3QGGA 1YJUA 1RTHA 4OI3A 2IM3A 1VQMS 3JXOA 1YDLA 3M32A 3MEEA 2M88A 2JEFA 4I2QA 2LA4A 4HVZA 3C19A 4CI0B 5K14A 2HZVA 3FSXA 5J1PA 4ELUA 2F63A 4QIWD 2I2YA 1XR7A 2OO4A 4ZVGA 5KOXA 1WF2A 2ZHBA 5C25B 2MY8A 3C15B 4WWSA 3TUJC 2I9SA 1Q8BA 2E5JA 3A8KA 1HBMB 3HT3A 1FT8A 2KB2A 1IKYB 3CDWA 4KHMA 3HJVA 3MR7A 4F02A 4PWDB 3C6UB 1XNQF 3N6MA 2D74B 1ZM2A 3PW2A 4UOHA 3R9LA 2K8GA 4F3MA 4DR2J 2G4BA 1H7XA 2X1FA 1KQSR 1O51A 2OKQA 1NK5A 3SSSA 1B7FA 3KWMA 5GVQA 1U0SA 2UVWA 2R7UA 5HLFA 3M2UB 1R7IA 1XNRJ 3HKWA 2FY1A 3M6VA 3TEGA 3C6TB 3SFGA 4TQRA 5DJBA 4JI4F 4OZ2A 2HHWA 2E66A 5J2NA 5L46A 1UPMB 4HKQA 1EB0A 4OZNA 3TUPA 4C3MA 1RAGB 3IBWA 2KZZA 3BGOP 2H4WB 1G7CB 3PACA 4DUZJ 1KTQA 3IBFB 2EFNA 1OY9A 2HK2A 4DR6J 2KKHA 3LP1B 4I6YA 2CQGA 1RHKB 2OD6A 1Q4RA 3BO2A 1D8YA 1K1SA 2UUBJ 3HF5A 3CCTA 2X3GA 3CJ3A 4U8YA 2WBRA 1NSAA 1JLAA 5A6PA 4JI3F 3HFZB 1I3OB 2M8HA 1AUDA 1EAYC 4CT9A 3EICA 4EZ6A 1PYSB 2OPQA 4GKKJ 3HFVA 3DM2A 3LQVA 1GMWD 1TKZB 4ANCA 4CO3A 1EKRA 2CPEA 2ZC4A 5GAHI 4CLWA 3TW0A 3AT1B 2K3IA 3VQSA 4RPFA 2BRLA 3T9NA 4F50A 3H2UB 1RB0A 2APOA 3WX4A 2PN6A 2I1RA 3VGUA 2JSXA 2J5AA 3HDSA 1FRKA 3FRYA 2B6AA 3DLKA 1FWKA 1CQMA 4TU7A 4RNHA 2OEJA 1URRA 1L5UA 1S6OA 1Y3KA 1G1XA 3FFIA 3KXDA 4O4GB 1QVGR 5FLXY 3Q23A 3T5KA 1DZ5A 5FDLA 3OL8A 4AUKA 1N5YA 2C3MA 3ISNC 3ILLA 5ETSA 3I4HX 5A8RB 3MEGB 2HFVA 3VGVA 4HI1A 1JLFA 4OJGA 2UV8A 3JSBA 3OTCA 4R0JA 2UUTA 3OV7A 3MEDA 1RA6A 3LF0A 1B0TA 3H7HB 2CQ1A 1DQ9A 4F04B 3RR7A 3AD9C 2UVRA 2P9CA 4ETZA 4ED0A 2FGCA 3SYZA 1VJQA 3DGPB 4QPXA 3FMBA 1XN9A 3CW2C 4OX8A 2AEMA 2DR6A 3FK4A 2Y8WA 1S99A 3UNYA 1NM2A 3M2VA 4OZ1A 2HQFA 4JI0F 1C1BA 2FIUA 3H98A 5L9XA 1BGXT 4GVBA 2MJUA 2DT9A 4C48A 2IIHA 1OO0B 1LWXA 2QMUB 1H3DA 1R89A 2NQPA 2MB0B 1YJNS 1UEKA 1PBUA 4KV8B 4X84A 4QYZK 2L9NA 1RT3A 1U1NA 3I5BA 3IBCB 3TAQA 4ZVFA 4TY8A 2LXFA 4CNYA 4DSEA 3RGIA 2NPFA 3BYPA 4NA1A 1TELA 3RJMB 2Q66A 4CRJA 5B0AA 1VC5A 3EGWB 3GSIA 4JI7J 4F3QA 2P9EA 2HVZA 1XMOJ 1SBRA 4W4MA 5J2PA 4CWBA 3BBBA 3PO4A 2IA0A 4JI4J 1RAOA 4B3TF 1OY6A 1IKXA 2XZTB 1WKLA 1KP6A 1HA1A 2Y1IA 2BKNA 1W2BR 2K1RB 3DOMA 2DNMA 2QA4G 3Q8YA 2XG8A 2A6MA 2RDIA 1AW0A 3MUMP 2QA4S 2MZQA 3MMCA 4KT0C 2B4UA 3SQGA 4USMA 1FX2A 4NLGA 4FZVA 3CJKA 1RWVB 1HL6A 2N82B 4IQXA 3EGNA 1Y4ZB 2R2SA 2P6SA 2X1BA 2WSEC 4J9QA 1MWYA 4OI4A 4F0KA 1ZA1B 2HG4A 2ZH1A 1RKJA 2VQFF 3CF5Q 4ZS6A 4Q8EA 2IBOA 3MCMA 2BKOA 4ZCMA 3KG1A 1QAJA 1T05B 5FLXU 3MM6A 4X62F 3Q24A 2XCAA 2FJEB 5LXYA 1M1HA 2KRBA 4MIAA 1NJIT 2BJ9A 3D2WA 4RJVA 3MM9A 3J7ZT 1UEUA 1VC6A 4USUA 3DGVA 3DRRA 2GO8A 1OWXA 2ACMA 2KRRA 1HBUB 1R43A 1QDUB 1EHWA 3IR7B 2R7TA 4DCJB 4DI6A 4IKAA 5KFYA 1B7YB 4DS5A 1GAOA 3KHGA 2O1PA 4JUZA 4DR5F 3L7OA 2W9CA 2POKA 2JWNA 1UMJA 1X4HA 4ZIVA 3PG9A 6AT1B 2DO4A 3B78A 4KH0B 4Q5VA 1CULB 2BR0A 3DXBA 2PGCA 2WK4A 1ZBTA 2IAJA 1RZMA 3MPDA 5GAEU 2VHGA 2XY6A 2HVDA 1NH7A 1GXUA 1H2TZ 2FJAB 4B9UA 1H72C 4ZVOB 2X3DA 1CJKB 3KLGB 2QJ3A 2VODA 3QGHA 3CCRS 3UE2A 5F9NA 2MHNA 2V2VA 2EXUA 3V4MA 1CC8A 2E1MC 2ZM6J 3M30B 1N88A 3ZZZA 2DH7A 2M3DA 4Y2AA 1JJHA 1K44A 4JI0J 1E6YB 2VBZA 2RSQA 5I3QA 1OSCA 1JLGB 3AH6A 1NMEB 1YJVA 4N8OA 5LOQA 3BKTA 2W9BB 4PZVA 4B9SA 4U7UD 1WOSA 1NDKA 2R4FA 3Q8QB 4CO5A 1AXQA 2U1AA 3DYAA 3EGVA 1Q1KA 2HHSA 6FD1A 1R8HA 2JX2A 3DN9A 3HHDA 3TJ8A 4B9NA 2IYGA 2PSZA 2F1FA 5KG4A 4WK1A 3Q8VA 1FA0A 4B3TJ 4ECVA 3BN4A 2M0GB 1T7PA 4A8SA 2OEKA 4H4OA 3ISND 2XBPA 3KMQA 4X4RA 1XQIA 2KYZA 1S1XB 2ZE2B 1DQ8A 2XNQA 5LM7E 1NO8A 3MZIA 1IKWA 1YVFA 1RUSA 2KM8C 1P6TA 3NG8A 4PQAA 3IWLA 1SXLA 4ZLJA 1UA0A 3J81j 3TUIC 1XIQA 4L3NA 2CQHA 1FK9B 2CYYA 3UPFA 2YQ0A 2Y3YA 1RKIA 1H38A 4O3SA 2YWGA 4RUCA 4CM0A 3A1YG 3M8YA 2W2PP 1YJWS 4P71A 2AEJA 4ZIWA 2XB2D 2JLFA 1RAFB 3OHBA 1XC9A 4DQIA 4XIUA 2N4DA 4QIVA 1FJEB 4IOBA 2VQFJ 2HBQB 1N32F 1N54B 4WYWA 3OTEA 1B99A 2RKIA 4AL7A 3POTB 1Q78A 4Q0BA 3LA0A 3OXLA 1Z4UA 3U7JA 4XPEA 1SC1B 4X62J 3IWNC 4B08A 4BC9A 2GQCA 4ZJQA 1S1UA 4ID8A 4LF5F 4NEZA 4NRTA 3BQ2A 2XYGB 1F1BB 1NB2A 1XBWA 2BE9B 4ENOA 3SCIE 1PC4A 4QQBA 1VQKS 1UA1A 5AE3A 4F25A 2QMWA 1KBRA 3MEKA 3TX8A 1UVJA 2HVEA 3AJDA 4AE5A 1FI4A 3MECA 1AFJA 2KI2A 3H0PA 2Q6BA 1IBCB 4G65A 4CLSA 2BOAA 2CQPA 3G96A 3BDEA 1JLCA 1WG5A 4C4WA 4DR5J 1KFSA 3PJXA 2HYIB 3QMQA 2QV6A 1VBKA 2P6TA 4TYAA 2ZOFA 2BRKA 5B08A 2MDAA 4RW4A 2RU3A 3C14A 1J27A 1S6PB 3QT7A 3CE8A 3KHLA 2VFUA 2YH0A 3QIDA 4DSLA 5CZXA 2XMTA 3IMQJ 1KQFB 3WZ0A 1SJ1A 1UPPA 1CVJA 3N0VA 2R8IA 4GO7X 1VGYA 4RO0A 2GCFA 5CABA 4PG8A 2WW8A 1W26A 4RW7A 1UW4A 3CJSA 4B9TA 1RAIB 3BGLA 1F5BA 3RR8A 4K4SA 1LEOA 2VL1A 4LFBF 5G0RA 1RADB 1GX5A 2XI2A 2MLYA 2YKNA 1VQ8S 2DVIA 3OVSA 3MCOA 3JSMB 1NK0A 3W1YC 1OQ3A 2KG0A 2JEIA 4DF8A 2WB4A 4DV1F 5L9NA 4FF4A 4CLTA 4Y65A 2MGZB 3B4DA 3MPWA 3PRBA 3TA2A 2BE2B 3CXCR 4RW9B 4X64F 2DPIA 4OHYA 5A6WA 5D15A 3OPKA 5E3QA 1J5OA 2UU9J 2CPJA 2UVVA 1RTJB 2ZZNA 1A6LA 2ZDOA 2E7XA 1Q8LA 3UO0A 2D69A 1U24A 2OHDA 8ATCB 4Y0FA 1BQNA 1S1VA 3M8PB 3SSRA 3SV3A 4BWJA 1NZ8A 3CC2S 4DFKA 2YWFA 4O3QA 1TU0B 3DMJB 3IC1A 4P2MA 4LBPA 1VQSA 1DLOA 4RKUC 4Z7CA 1U6FA 1XMQF 2ATCB 4F7VA 5HBMB 5LT5A 1ZM9A 2HMIA 2Y1LB 5D3GB 3HP6A 1KVIA 3MOJB 3HO1A 1MMNA 2GIFA 1JK9B 1VR6A 2FPHX 2DY9A 5ETVA 2DK2A 1ACMB 1Y5IB 3BM7A 4DX5A 3W65A 2AMCB 5HI7A 2OSRA 3T5JA 5DZ7A 2YKMB 4O3OA 3D1OA 3AFGA 4DG1B 4CP5A 1LK7A 4F26A 5K8NA 1KSPA 3PCOB 2L3MA 1Q79A 3TVZA 2BX6A 1KR4A 1KD1T 2RU9A 1N32J 4I4BA 3TOQA 1HPZB 4DWIA 1NAQA 1EQMA 2ZH9A 2AV5A 3DHWC 4OYZA 2U2FA 4YR3A 1U8WA 2CWKA 3HVTA 1I94F 1P1TA 2CDQA 1U7LA 2IDLA 4PYDA 4LF5J 5M2RA 1WHWA 4B9MA 2ZHAA 3N5FA 5DZ6A 2FQQB 3EVWA 4ZDNA 2J7UA 2YNGB 2FY8A 2R8KA 3IS9B 2P5VA 5HMZA 1YIJS 3EPIA 4FBUA 1JLEB 3PO5A 1N52B 2WSFC 5KFIA 2QEXS 2RNEA 4PQUB 3TAMA 4C8NA 3KNAA 1T9XA 3BBFA 1RWPB 1S5ZA 2GW8A 3KK1A 1YZ7A 5DG9A 5LJ3Y 5F3ZA 3IAM9 4CLFA 1IN0A 2Z2LA 1BUXA 5L39A 3F56A 3O8WA 4E2FB 2HVIA 4CH7A 5J2MA 1ZM4A 1VIXA 2Q3PA 5HQMA 2BANB 1NLKL 4A4JA 2KG1A 2E5HA 3QLHB 3OVAA 1SUQB 2QT7A 4PR6A 2IRUA 2B9WA 2OPRA 1IBLF 2GX8A 2HRYA 2CJYB 2Y8YA 3DOKA 2ASJA 4ECQA 4NX9A 4LIRA 3W2WB 4JI8F 2GVDB 3V6HA 3G86A 3MMAB 2OEMA 5J2QA 1W7WA 1HWKA 3SCKE 1VQ6S 4ICLA 1IM4A 2RAQA 2VB6A 2XMKA 1SJRA 5F41A 4X4OA 4C8LA 4LFBJ 4WZMA 3PW7A 4FF1A 3ICLA 5KG0A 3QJJA 4Y6IA 2HFSA 1HQUB 3K8WA 2LXUA 4YMEA 2YH1A 2XM3A 1S0NA 2VOPA 3D7SB 3OT9A 5DLGA 4JI6F 3MPVA 2CPXA 5KG7A 5HP1A 5BYRA 4DV1J 1JX4A 5AJ3F 4JI5F 3A13A 3SIPB 1RT6A 4LF1A 1FWPA 4KGZB 3MUVP 5LXRA 3R97A 4X64J 4LT6A 4HR2A 4ZPVR 4FS1A 3H5UA 4RW8A 1U45A 4OLOA 2HZCA 3RW7A 1RT7A 4J9LA 1IM6A 4MKYA 4KHRA 1G2EA 5GAGU 3VAGA 3ZFVA 3J7YU 1V5VA 2RT3A 3EDQB 4MYUA 2CNNB 2G0IA 2DNOA 2PIIA 2VG5B 2E1CA 2XZDB 1MROB 4V19X 3JSRA 3Q89A 4PAAA 2M2BA 3PNIA 3K0JA 1T03B 4ECUA 4M1KA 5IQ6A 2GMHA 1ZOTA 1S72S 4USVA 4ZOSA 3N28A 4Z2XA 1R8AA 3CMES 2ZBRA 3ZTRA 4EO6A 3PKMA 3FEYB 1SVDA 5LMNJ 5F0UA 4QCLA 4QWEA 1BC6A 4QW9A 4LSNA 3RB6A 4WP3A 4TY9A 3OQ2A 4WKYA 5AE1A 5EGYA 4P2FA 2G1HA 3IR6B 4Q2MA 4LF6F 3I32A 3JTNA 4CM2A 4N76A 2CJAA 1QUVA 2ADBA 4FXDA 3SCJE 2B51A 4RL1A 2WB1D 3Q83A 4N8NA 1G6BA 3G8QA 2J0WA 5MAOA 2G2ZA 3I0SA 5JXSA 2HIYA 2GHPA 4NA3A 2DNZA 4EWTA 1NHUA 4NOHA 3NXZA 1SH0A 2CZ4A 2HNZA 4RR5A 3EM1A 2EKYA 2ROEA 4UQTA 3IM8A 3CTRA 3KJQB 2QLFB 1Q8KA 4IYQA 1JLBA 2NXJA 4DL0C 1I94J 1B70B 1TK8A 3H20A 3BV8A 2W4CA 3WIUA 2RVJA 2C2NA 2MZSA 2MKHA 1TAQA 3DLGA 2CJXB 3KNGA 3RYLA 4RW6B 4LUBA 1VCTA 3TANA 2ZJQQ 1TKTB 4PABA 1S7IA 4J7CA 1U1QA 1FNMA 2FJXA 1S4EA 2HHHF 4O0NA 4HACA 2BW2A 3G4SS 2HGNA 4HH0A 3QZ7A 3F73A 4ZHRB 4DSFA 2V8GA 3M8QA 2OTLS 5I42B 2DRAA 2UUAJ 1S6QA 5AXNA 1TL5A 1JKHA 3TQ1A 4JOUA 4NWBA 1C4AA 2M8DB 3U02A 3BH6B 4AQYF 1OJ4A 1QJHA 3M32B 2CQBA 1EKSA 1HQ2A 3T1YF 1WD6A 1SV5B 3OUYA 4I2QB 1W25A 2FJBB 1IBLJ 1RT2A 2IBKA 1R8BA 1VBZA 2WTFA 5K14B 1C1CA 3LANA 3MFIA 2QLBB 3G2XA 3DXSX 2MQNA 4S0MA 3KTQA 1MW7A 3R5BA 4JI8J 3V81A 5A8KA 2VU5A 3CJ0A 5H1SV 2O67A 4PPZA 4KQZA 5ETNA 2UV8G 2VPXB 2F3JA 1FKOA 3TZWA 2NYHA 3CCES 3PY8A 3THTA 2RQMA 2CQ2A 2ALYB 2DNKA 4OZLA 1Y0HA 1NKEA 2DD8S 2ZUAA 2IRXA 3RW6A 3H59A 1TR0A 3MM8A 3I96A 4M5GA 1FRIA 2HS4A 4JI6J 2PO4A 3LPEA 1O5JA 2JRSA 1S48A 4YR0A 3QWPA 2BE7D 4YUDA 4LF7F 4JI5J 1LW0A 1RABB 3UDVA 5DRKA 4BDPA 4CLLA 4PPDA 2IVMA 5HLFB 1BXNA 1NK8A 2HFNA 2MZRA 2QL7B 2W7PA 2VBXA 4MFBA 1VBYA 5IV4A 2YPYA 4DSKA 2R7WA 3GWCA 2W8LA 4NLTA 4FVCA 3R5CA 1VQ9S 3TAPA 3MCSA 4M5KA 1WSVA 5KFAA 2IYIA 5J2NB 2ZH8A 4O23A 4A48A 3NLCA 5HMWA 3MFHA 3BQ1A 1Q7YT 4DUYF 4FXWA 4EMDA 5KG1A 1JLQB 4DX6A 3THPA 1NJZA 4O3RA 4LRCA 3Q8PB 3GYXB 2V2ZA 4WE1A 2FUG9 2HHXA 3BBCA 3K5PA 1P9YA 2WVFA 1YSJA 4EI2A 4DR1F 1L3KA 2EC0A 5HVHA 4C3KA 3QSIA 4DF4A 2GFFA 1WG1A 1JLAB 2QYGA 4MK8A 1HLWA 2RS2A 3HK2A 2XO7A 2XMJA 1GH8A 2NREA 5CZVA 4LF6J 2BEFA 5GMKa 3CD7A 3DM2B 2CZ9A 5BYQA 2VONA 1R8PA 3L4BC 4CNZA 1LFWA 3OL9A 1C4CA 3CO9A 4X4TA 2JEGA 1RAAB 1O8BA 1DARA 1REVA 2WOMB 5IWAF 2RDJA 5BXIA 1RHRB 2MPUA 2CNKB 4DCPB 1L3SA 2FD2A 2MKJA 2B6AB 4A8FA 3DLKB 4P2SA 3OBIA 5HROA 1TUVA 2R2TA 1Q5YA 2AKWB 4ALZA 2V63A 2WRMA 4YHHF 1QSSA 3PFOA 3FFIB 4PWWA 2R7VA 5RUBA 3FEZA 2V50A 5FDLB 2IC3B 2HHHJ 2BVZA 2J7WA 1N5YB 4HTIA 3MI7X 4MTPA 5D0GA 2H5IB 5L1JA 3D0GE 2AJ1A 3U1NA 4CO1A 2HQIA 1F3FA 2LXIA 2H54B 1JLFB 3R7BB 1NHVA 4M63A 1C0TA 8AT1B 3DNCA 3SI8A 4F8RA 2BA9A 4AQYJ 1PCAA 5FIIA 4DZDA 3BGFA 3M05A 3T1YJ 1U8SA 2LECA 3MEDB 3IRXA 1FD8A 5DGAA 1FJCA 1KN6A 2JC0A 4B3SF 3I31A 5EUHA 1NXIA 1RT4A 3MHYA 4ZLNA 4QWBA 5H9EK 2IY5B 1Q16B 2JLGA 4B3MJ 2Z56B 4ZVEA 2CPYA 2W7OA 4P72A 3TRGA 1PILA 2LVWA 2V9KA 3M2VB 4GO5X 1C1BB 4F67A 3M9MB 4PG5A 3ETMA 4UF4A 2DGTA 3O2IA 3I5CA 3KJNB 4KH1B 3R5AA 2NYIA 1RT1B 1HMVB 4ID5A 1R8CA 3CGIA 1KHWA 2YKQA 1X4BA 1K8AT 4CO4A 3AOBA 4L73A 1RT3B 1WOPA 4MKVA 3SMZA 2E5GA 2EVZA 2M70A 2JVRA 4I1TA 1S1WB 3I4PA 2ZOGA 4YR2A 2J8AA 3QGIA 3H2VE 1CC7A 4DPYA 1M5HA 3RAQA 5K20B 5J2PB 1S1TA 4WF9Q 3BN7A 1S49A 2HPUA 3P49B 1IKXB 4OV1A 5HMYA 3TVKA 1HNVB 1HNIA 4LVNP 4DN0A 4ZVSB 2XS7A 3CIMA 4LBHA 2LQJA 2X1GA 1VLYA 2RF2B 2VG6A 1O6XA 3JQKA 3IG1A 3DOMB 2JZ5A 3KLEA 2XMAA 3FRZA 3PR5B 4F0HA 1HNZF 3EXYA 3I82A 3AQOA 3V6JA 1A9NB 2UUCF 2XI3A 3CJRA 1OYDA 4TKTA 3IM9A 2WW4A 1NK6A 3MMCB 3SQGB 4ILRA 4DPTA 1PG5B 4MH8A 2SXLA 1N34F 1D1UA 4OLPA 4DR1J 4NMLA 1N8RT 3PTWA 2XY7A 1TL1A 4ER8A 3CJKB 5B7WA 5H9EJ 1SIWB 1N5SA 5D0RA 3M1VB 4K5RA 5IT9Y 3SCLE 1JXVA 2OJ3A 2ZKUA 1T95A 4QOTA 5SZTA 5KT3A 3NMAA 2PT0A 4OI1A 5KFLA 3K5LA 5C2CA 2GZOA 2FHKA 5A0YA 4K4TA 2C3OA 1UZDA 2AJ2A 4ZMMA 3CPWR 4TNOA 4O44A 2AYMA 3MM6B 1VQYA 2H51B 4IH7A 4H4MA 2IRYA 1J5EF 4TN2A 1IVZA 4L75A 1ZAWA 2CFXA 3F44A 3FZ2A 4RX6A 1XJWB 4KC5A 4J90A 3MM9B 3MM5A 3R2CJ 3DDIA 4R5PA 1EQ0A 3DLBA 5ETRA 3DRRB 3W8PA 2EPIA 2J0XA 2PMZD 1VQOS 2D3UA 1MLAA 2V69A 5ETTA 2QRRA 1VBXA 5J1EA 4FN5A 3PEHA 3T3FA 5EN1A 4TU8A 4C11A 1SH2A 4RBUA 3RBEA 4F4WA 1TKDA 2CA9A 3FCHA 3C3LA 3CNQP 5U47A 1EP4B 3CDUA 4Q45A 3K5MA 2R8JA 1UW9A 7AT1B 3NWRA 5A76A 3NNHA 4LFAF 3GV5B 2IAJB 3EX7B 1JQGA 2V8HA 3PV8A 2OSQA 3OJSA 1GK8A 4F2RA 3KUGA 2M7SA 4OZJA 4QYRA 4YP3A 2C2ZB 3QJPA 1RK8A 3FUYA 2IVFB 1KS2A 3N79A 3MAQA 2V94A 2N4CA 4B3SJ 3TO8A 3BKFA 4JBCA 2QX0A 3ZXWA 4M5DA 5KFQA 3ISZA 2GIRA 4C0OC 1APSA 1ZTWA 1PYOB 4P73A 3IAS9 4F4KA 1KLMA 4J91A 1LXNA 3RB0A 1LNQA 2BJ3A 3GP9A 5ETPA 2BM0A 4HL9A 1PJ5A 3U1LA 4KO0A 1GXLA 4HI2A 3GTYX 4GKJJ 2C2OB 3VTIA 5IT0A 1Q95G 5KAKA 3UI3A 3UD5A 1TMJA 1FVSA 2XMVA 1TL7B 3P96A 3GFZA 2HURA 3GR0A 1HNWF 1QE1A 1N5TA 1U2CA 4AT1B 1SQGA 4WU2A 2XNRA 1FRJA 4ZVUB 3T5LA 3KOAA 4DV0J 3C15A 2LQ9A 5IC6B 3LWMA 2DGVA 3PYFA 4NLRA 2CG8A 1VS3A 5D4NA 5L1IA 5B0CA 2AIRB 3KLIA 2JJ4D 4H4OB 4KHPF 5IT9U 1HYSA 2YWEA 2ATLA 4I2PA 3W9IA 2MZ1A 3MD3A 4C8YA 1IKWB 2BM1A 1T02A 1HNZJ 4LSLB 5L1KA 2KHCA 3CCMS 2DYAA 2A6OA 3M2UA 2VDIA 1K0VA 2UUCJ 4X2BA 4C6AA 5ETOA 2IDEA 1GXTA 1F60B 2DH9A 4U67Q 4DR7F 5KFZA 1ZH5A 4P74A 2VA3A 1Q53A 3DLHA 2YX4A 5DS7A 1VRTB 4X4SA 3AD7C 3M9NB 1P8GA 1FKPA 2FDNA 4DSIA 2YY3A 1TK5A 2RH3A 2HW3A 3D54A 1HFEL 3K89A 1X4EA 1Q7LB 1SL1A 5DM6Q 1WC5A 5KFPA 2RKIB 4Q0BB 4DFJA 4CZCA 1PGZA 1U6ZA 2CJBA 2AWZA 1RSCA 1EX8A 4YEAA 3H5SA 1J5EJ 1S1UB 1KTVA 2BXJA 2DIVA 3TI0A 4P6QA 3KYLA 2KU7A 2DHSA 4IR9A 4B02A 3MXHP 2CRLA 1V3ZA 2B0GA 4C0BA 4WPAA 3M2RB 4CH1A 3LO3A 4LBIA 1B0VA 3TP2A 1SKWA 3KJVA 2X7IA 2J6SA 3HZGA 5IXUA 1RISA 2HK3A 4YN3B 1TZ0A 2FC9A 1TAUA 2K7KA 2KFYA 3A3OB 2HGMA 1B0PA 3OLAA 2DR9A 1JLCB 3NS6A 5D6GA 2K7JA 1ZTTA 3D66A 4ED8A 5IV3A 3SXLA 2BJ7A 3L3CA 3DI6A 3C14B 2WVDA 1N48A 1K0TA 3QO9A 1VK3A 4DV4J 2C2KB 1WC4A 4ZPBA 3FVYA 4LFAJ 5KT4A 2EFPA 2PEHA 2ZVSA 2HFOA 5KFDA 4R8UB 4IDKA 1BY9A 1CSJA 2K06A 2CIMA 1UKUA 3T41A 4KE5A 4O4GA 3M6WA 2K2PA 1FFGB 1Y9OA 1YK9A 1FDDA 1RCXB 1S0VA 4IG3A 4RW7B 4IO1A 2XYHB 3CULA 3BSNA 2AYBA 3JQMA 4NASA 3I5AA 4PXDA 4N5SA 3IP0A 5G0RB 3HD1A 5T7LB 1K47A 2YNHA
chains in the Genus database with same CATH topology
3RU0A 1WG5A 4ED3A 1U1RA 3BF4A 4C4WA 2YKNB 3A8EA 3PFEA 3GV7B 2F8HA 1NK4A 1KFSA 3H40A 2VKZG 3PJXA 1GQEA 2HYIB 3POTA 4H4KA 4WFXA 2LEBA 3QMQA 2QV6A 2I8EA 1RT1A 4DUZF 3PW4A 4OZ5A 2P6TA 1HMVA 4I6AA 4TYAA 4RUHA 1VQPS 1R0AB 2LU1A 2EFGA 2ZOFA 3M8QB 3PXGa 2BRKA 4DOZA 1E6VB 4Y2MA 5B08A 1A7GE 2MDAA 2RS8A 4RW4A 2RU3A 1HI0P 1CPZA 3HFKA 3BGRB 3DRXA 4C98A 1S6PB 2D9PA 4Q43A 4ED1A 3OSNA 3CE8A 4DR6F 2HS0A 2VFUA 3KHLA 2YH0A 4NRUA 1Z2LA 1SKSA 3QIDA 4DSLA 3SZ2A 2Q79A 2IA6A 5CZXA 5KT7A 3DHXA 1IBKF 2XMTA 1OQ6A 3HHLA 2XC9A 1S1WA 1KQFB 2YNFA 3WZ0A 5B09A 2FC8A 5JUMA 1CG2A 4EEYA 1RP5A 3RAXA 1HW8A 1SJ1A 5F8JA 1U2FA 1FXDA 1CVJA 2MKSA 3N0VA 2R8IA 4GO7X 3M6UA 4AXIA 1VGYA 2DTJA 2V2KA 3UNGC 3VAKA 1ELOA 2ZH6A 2GCFA 2WSCC 4PG8A 2WW8A 4Y00A 1BQNB 1S1VB 5IM0B 3BO3A 3X1LB 3EPGA 1WNEA 2I5JB 4RW7A 2VUGA 1UW4A 4G1QB 4NCGB 4DL2A 1DJ0A 4B9TA 1X0PA 3BGLA 2DCUB 3HX9A 1U6BA 1F5BA 1QSYA 3RR8A 4K4SA 1NK9A 4H4KC 5CD4H 2KH9A 2VL1A 4LFBF 4OHVA 1OS5A 4I56A 3FNNA 5G0RA 4GKKF 1HNVA 4YB5A 3CCSS 4JV2A 1GX5A 1VHFA 1NH8A 5C5JA 2RE1A 2XI2A 2LA6A 2XS5A 2QYCA 3DU6A 2A2DA 2YKNA 4CT8A 4X4NA 1VI7A 2YVSA 4HDGA 1VQ8S 2DVIA 3OVSA 2RF2A 3IXQA 2C3UA 2A2CA 3GB0A 4HTJA 3NNCA 3BS9A 1HWUA 3JSMB 4LF4F 2DGSA 1NK0A 1OQ3A 3HHLC 2KG0A 2LLZA 1XK8A 2JEIA 3ZZOA 1F5CA 4DF8A 3BGRA 1YG0A 2WB4A 1S6PA 4DV1F 2CG4A 4DEZA 2QSFA 5L9NA 1QUPA 4FF4A 2W25A 4Y65A 2MGZB 2R7RA 1UVNA 2VZ9A 3B4DA 3AQPA 5LJ5Y 4OHXA 1RTHB 3MPWA 2YKPA 2J9DA 3PRBA 3NCQA 2CJQA 3TA2A 2BE2B 3ZZ0A 1OSDA 3CXCR 3QIPB 3MEEB 4RW9B 4X64F 1X0FA 2DPIA 4OHYA 5DM7Q 2J0SD 5A6WA 3OPKA 1KFDA 5H9FJ 3EUNA 5E3QA 4RNFA 3J81Y 1TKXB 4M94A 1J5OA 2O01C 4NLOA 5KFWA 2HMIB 2CPJA 1ZYQA 1IQTA 2RD5C 2UVVA 1RTJB 5E41A 2QLWA 5CA5A 1A6LA 2ZDOA 2ZZNA 1HD1A 2E7XA 1Q8LA 4Q2LA 4NYZA 5D4LA 1GTEA 1U24A 5LSRA 4HYKA 3N6NA 4Y0FA 3RRGA 4EO8A 4E0DA 1BQNA 1S1VA 1YRXA 1X4FA 2W7AA 3M8PB 5IM0A 2BOPA 3CDBA 4UY8T 2CPIA 3SSRA 4G1QA 4NCGA 3M1VA 4DHVA 5A2QY 4R25A 1TP7A 3MR5A 3V6DB 1TK0A 2JL9A 1PSDA 3U1MA 4PCQA 3SV3A 2J9EA 1TL3B 4RBVA 3H2LA 1L3TA 4XDCA 4BWJA 2DISA 2HIQA 3TA1A 2BUNA 1HBOB 4KBIA 3W2VB 2FLLA 3CJ4A 2E9RX 3K5NA 4B3MF 3CC2S 4DFKA 5E5NA 2YWFA 1FDNA 3CD0A 4O3QA 2CPHA 3DMJB 3IC1A 3WDOA 3CUNA 2XLKA 2H5EA 4AFFA 3I55S 4K4UA 5IFMA 1VQSA 3PX6A 2XMUA 2E1AA 1DLOA 4USJC 3DDNA 2VBWA 1N0UA 4ECTA 1F0XA 4DV2F 4RKUC 1U6FA 3FDSA 1C0UB 4NL5A 4F4XA 4QYZJ 1KHVA 3H5XA 4FF3A 4FS2A 3MR2A 4EZ9A 1XMQF 5CYMB 1RA7A 5KFNA 5F3TA 2E1RA 3B82A 5DQIA 2PC6A 1QTMA 2MGZA 1LQ9A 4FPRA 5IQQA 4OI2A 4Q44A 4DN9A 2BE2A 4J9MA 1TQLA 3H4BA 3QIPA 1T3NA 4RW9A 1WTBA 4MKAA 3UD3P 3U27A 5HBMB 4BWMA 2YKAA 3OTBA 1TKXA 5LT5A 3HVTB 4DLEA 4ES1A 3HZEA 1ZM9A 2MQLA 5D3GB 2HMIA 3HP6A 2M5YA 1KVIA 1VQ7S 4A8QA 3MOJB 1Y5LB 1RTJA 3J80Y 5I3PA 3OLBA 2VFTA 1V6HA 1MMNA 4EBDA 1NKCA 3HO1A 1JK9B 2W4DA 3G6VA 4PUOB 4XAKA 2FPHX 1WTFA 1MNEA 3M8PA 5KG6A 2KZMA 3GMGA 3NS5A 1RJJA 2DK2A 3OFHA 3O6QA 4WCEQ 4N41A 1Y5IB 3BM7A 3JTOA 3KLVA 5M2PA 3V6DA 2AQ4A 4ZP6A 2C2RA 3NNAA 4OI6A 3E51A 4YB6A 4QJVA 3DDKA 1YQHA 3OXFA 4DS4A 1KONA 5T41A 5HI7A 3W2VA 1HBOA 3FQLA 4I67A 2OSRA 3T5JA 4DX8H 1OIAA 2KJWA 3QAEA 2YKMB 1EETB 4O3OA 3LPYA 3TAMB 3D1OA 2R9LA 4DG1B 4DUYF 4ED5A 3J7Z5 3PIPQ 2IHR1 2EW9A 1LK7A 3LP2B 4GMKA 3DMJA 5CHCB 1HHSA 2AGQA 3AB4B 3ENWA 4F26A 5K8NA 2YQ3A 3GIKA 1KSPA 2OP5A 4OMFG 2L3MA 3OFFA 1Q79A 2I0XA 2AJ4A 3TVZA 4U7CA 1K73T 3UR0A 3CMAS 1D8ZA 3MAHA 3OL7A 1Z2ZA 1IR0A 1EP4A 1P1LA 1KR4A 1KD1T 1C0UA 3BSAA 2RU9A 3V2UC 4I4BA 4QWAA 3HVWA 1G3OA 3TOQA 2WAQD 1HPZB 4ZCIA 1NAQA 4DWIA 4KAIA 5J2MB 3N4WA 4GC7A 2IM0A 2AV5A 3DHWC 3LOUA 2U2FA 4WTYA 1JMTA 2ZH9A 4CIOA 4FBTA 4YR3A 3GFHA 1SL2A 2LKZA 4L6V3 1I94F 3HVTA 1P1TA 1KQKA 4NLYA 3S01A 2CDQA 5D3GA 4WJBA 1U7LA 2E7WA 3Q8RB 2OPRB 1FTCA 2LQ5A 1ZPVA 3GSDA 3OJUA 4NLPA 1JXLA 3AAWB 3B8HA 5M2RA 3UW1A 3GIIA 1WHWA 4NLVA 4B9MA 1BD6A 2OFGX 2ZHAA 3N5FA 1NJWA 4ZDNA 4PUOA 2J7UA 2YNGB 4EGLA 2R8KA 1HBUA 2RRAA 5CH7B 3DOKB 3IS9B 3BR8A 2P5VA 3GIJA 5HMZA 1YIJS 1FRLA 3EPIA 1UAWA 4QWDA 1KEKA 4WXWA 5KFOA 2JEJA 1N56A 5CYQB 2G1DA 4FBUA 5DDPC 1JLEB 3E8OA 3ENQA 3PO5A 1N52B 2XGQA 4JI7F 2WSFC 5KFIA 3N5BA 4DR3F 3N6LA 1QVFR 1LKZA 2FVCA 3DOLB 4WFBQ 1XMOF 4ILLA 1U1LA 2QIFA 2QEXS 5J2QB 3TUZC 2H9ZA 2RNEA 4PQUB 2V0NA 3TAMA 1H98A 4DG1A 2K3KA 4LF8F 1YGYA 1H2VZ 3LP2A 3NKYA 2GC8A 5F9LA 4C8NA 2EWHA 3R3TA 4ICLB 5HROB 3CC7S 3KNAA 2GW8A 4ZK7M 4LJMA 4UOCA 2XULA 3HHKA 2DIUA 3KK1A 5DG9A 3WC0A 1X9MA 2OPQB 4PKDB 3L7PA 5AXMA 3ETOA 1DAXA 4J9PA 5LJ3Y 2XS2A 5F3ZA 7FDRA 3IAM9 1IN0A 5HO4A 2Z2LA 4ZLPA 5L39A 1N33F 2HWIA 3F56A 3O8WA 2OAUA 1UJ5A 4FVMA 2AJFE 2IFXA 2ROGA 4YB7A 5KFSA 2HVIA 1HPZA 4CH7A 5J2MA 1WACA 3UCUP 1ZM4A 1VIXA 2DBBA 2Q3PA 5DDOC 5GADI 1M1KT 2BANB 2G13A 4A4JA 2KG1A 3G8SA 2E5HA 2FJWA 2KFZA 3QLHB