1B7FA

Sxl-lethal protein/rna complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
167
Chain Sequence
SNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3')
publication title Structural basis for recognition of the tra mRNA precursor by the Sex-lethal protein.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna-binding protein/rna
total genus 35
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b7fA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1b7fA01
2KI2A 1N8RT 2LKZA 5BJRA 3U1MA 2F9JA 2ADBA 5JVGQ 5DDOC 1G2EA 4F26A 3UWTA 5GAHU 1ZZNA 2CQPA 2DNHA 4IUFA 2ZJPQ 5CYJA 1YI2S 3UCZP 1WEXA 1WEYA 1N88A 2DGUA 2CPEA 4WIIA 3G8SA 1SXLA 2CQDA 2KFYA 2MZJA 2N3LA 2CQGA 3CMAS 2MGZB 2QA4S 3SXLA 2MJNA 2PE8A 1A9NB 4WFBQ 2J0SD 3MOJB 1X5OA 5IFMA 3B4MA 2I38A 1JMTA 2MZSA 4FXWA 2PEHA 2OTLS 3U1LA 3NS5A 2KG1A 1Q82T 2M52A 2VODA 1UFWA 3MD3A 2MB0B 2DO4A 2FC9A 1S72S 2JVOA 2KT5A 1X5PA 2FC8A 2DH8A 2LEAA 3NNHA 2WBRA 1M5KC 2RU3A 4WF9Q 1X4BA 1VQKS 4YOEA 2EVZA 4UQTA 2E5HA 1SJQA 3MXHP 2MSTA 1AUDA 2YTCA 1WHYA 1ZZFA 2DIUA 3NNCA 3THPA 2DNRA 3FEYB 1UW4A 3SMZA 2CPFA 4YB1P 1QM9A 1PO6A 3UD4P 2L41A 2DNZA 1VBYA 2GHPA 1DHMA 3BS9A 2OSRA 1VQ5S 5LXYA 3HI9A 5JVHQ 2CQHA 5IQQA 4WFAQ 1L3KA 2MY8A 5GMKa 1X0FA 2XS7A 2VONA 2DGOA 1WEZA 1X4AA 2CQ1A 3P3DA 4W92B 3UE2A 2LXIA 1FHTA 2XNQA 1X4FA 2CPZA 2DK2A 2DNNA 1VC5A 2DHXA 1YTYA 1JJ2R 3B4DA 3VAKA 1X4HA 2KRRA 2KXFA 1M1KT 1R8PA 2DITA 5DETA 1Q7YT 1YITS 4ERDA 3UCUP 3ZZYA 3RW7A 2CPJA 1SJRA 4CQ1A 2YH1A 3IRWP 2DGXA 2CQCA 3US5A 4C7QA 2QFJA 2DGQA 2VOPA 3G6ES 1NU4A 3VAGA 2LYVA 3JB9k 5DDQC 1X4DA 1VQ8S 4LIRA 3P6YC 1WHXA 4QU6A 2FPHX 1Q81T 4Z2XA 1U1NA 2LEBA 5GADU 2U1AA 1YIJS 4QU7A 3VF0B 5IM0B 1YWXA 2M4MA 5DM6Q 1BY9A 1WWHA 4ED5A 2JVRA 1OWXA 3BO4A 3OW2R 2E44A 4C4WA 2X1BA 3ZZZA 3TYTA 5DM7Q 2MKCA 3CULA 3VAIA 1U6BA 2M70A 3LPYA 3CCLS 2RS8A 2XB2D 3H2UB 1B7FA 1CVJA 2DHAA 2BZ2A 2JX2A 1VQNS 1RKJA 3FEXB 5LJ5Y 3CCMS 1H6KX 3SDEB 4IO9Q 1P27B 4EGLA 1JJ4A 2CPDA 3MD1A 3Q2TC 1R8HA 2DGWA 2DGVA 2L9WA 1SJ3P 3DXBA 1HD0A 3CD6S 2AYEA 3NMRA 4UY8T 3CC7S 4WKRA 4TU9A 3MI7X 2X1AA 2EK1A 2E5GA 2MKKA 5D78A 2KYXA 1FXLA 2YH0A 1FJ7A 1FNXH 1DZ5A 1KOOA 2AD9A 2M7SA 3BEGB 4PKDB 2RRBA 3V4MA 5EN1A 3G4SS 2N3OA 2M9KA 3J7ZT 3I56S 1WTBA 4J5OA 3MUTP 3UD3P 2G4BA 5HO4A 2M8DB 3CCQS 5FJ4A 2CQBA 1U1RA 2RQ4A 2KVIA 2YWKA 2KHCA 2KXNB 3CTRA 1XN9A 2BOPA 1X5SA 4Y0FA 1WF0A 1YJWS 1X4GA 1M5PC 5CXTA 2DISA 3CCUS 1YJ9S 2KH9A 2LA6A 1VQOS 2JRSA 2Q79A 2MZ1A 2RUGA 2HGMA 1U2FA 1U1PA 2FY1A 2M0GB 1NO8A 2KXHA 5D77A 3LQVA 3VAFA 1VQMS 3MUMP 1U1MA 3PIPQ 2G0CA 2MHNA 3S7RA 2GO9A 2LMIA 2HGNA 1PGZA 2MYFA 5GAEU 3PIOQ 2OIHA 2DH9A 2MXYA 2F9DA 2HYIB 1NJIT 1WG1A 5GAGU 4C0OC 2MGZA 2XNRA 1H2UX 2NLWA 2I2YA 1WI8A 3CCES 2D9OA 2HVZA 2MKJA 3VAHA 1VQ9S 2KG0A 3N9UC 3HHNB 1KOHA 1M5VC 3EX7B 3I55S 2DHSA 2K3KA 4M5DB 2N82B 3BO2A 1OIAA 4BS2A 3ULHA 2RQCA 3CCJS 3CCSS 1QVGR 4A8XA 3D2WA 4PR6A 2DNMA 2CPHA 2RVJA 2F3JA 3TO8A 5H1SV 2MY7A 1YHQS 2YKAA 4CIOA 4F02A 2KM8C 2CPXA 3CMES 2QEXS 1URNA 1X5TA 1WG5A 3IWNC 3MDFA 4PRFA 4FXVA 3THTA 4TU8A 2E5JA 1K8AT 2DNYA 2O3DA 1N54B 1S79A 4CH1A 4LMZA 3CXCR 4U67Q 3R1LA 2ADCA 1FO1A 4CH0S 2DNKA 1WG4A 3CCRS 2MZRA 2HGLA 4TLQA 2B0GA 2MQQA 5DDRC 2MQLA 1FJCA 3CF5Q 2E5IA 2M2BA 1X4EA 2MKHA 2CPYA 2DIVA 4LJMA 3R1HA 2ZJQQ 2MKSA 1H2TZ 2J8AA 2K8GA 2U2FA 1U1OA 1M5OC 1WF1A 2V94A 5GVQA 2MQNA 1U1KA 1VQ6S 2OTJS 2XS2A 2J76E 5MLCV 2AYMA 2MQOA 3VALA 2ZJRQ 2MSSA 3CCVS 1X4CA 2CJKA 3UCGA 2KU7A 2CQ4A 2DNLA 2NZ4A 4IOCQ 2RT3A 3CC4S 2FHOB 2LA4A 1A7GE 3R27A 2JWNA 1Q86T 2J0QD 2CQ2A 1N52B 1ZH5A 1VQ4S 2MZTA 1HA1A 1KQSR 2OJ3A 4QQBA 2CQ3A 3S8SA 3NNAA 1WI6A 5LJ3Y 5IM0A 2XS5A 4QPTA 2MQPA 1K73T 4Y00A 3EGZA 1P1TA 3G8TA 2DH7A 2DGTA 3EGNA 4F25A 1W2BR 3K0JA 2VOOA 2M88A 2X1GA 1H2VZ 3G96A 2AYBA 4P6QA 1RK8A 1DBDA 1WHWA 2D9PA 1YJNS 2CQIA 5ITHA 1U1QA 2MJUA 1VBZA 4IOAQ 2DNGA 2HZCA 1QVFR 1SJ4P 5HL7Q 2LQ5A 3SDEA 3G71S 3J7YU 2OSQA 2RNEA 2DHGA 1F9FA 1WELA 2KRBA 3MUVP 2G1DA 3H2VE 4WFNQ 1UAWA 2SXLA 3RW6A 2A3JA 3BO3A 2KM8B 3VAMA 3P5TL 2LECA 2MKIA 2RRAA 3P49B 5LSLA 4W90B 4WCEQ 1D8ZA 3TP2A 1KD1T 1FT8A 1WHVA 2CPIA 2MZQA 3NS6A 3S6EA 2M8HA 2L08A 2EK6A 1OO0B 1UP1A 2MPUA 3S01A 5DDPC 4V19X 2X1FA 5LXRA 2DNOA 1VQPS 3DLLQ 2MMYA 3L3CA 2LCWA 3CC2S 1VQ7S 1JJHA 4RU2A 2UP1A 4OZ0A 4YUDA 3VAJA 2AYGA 2ERRA 3CPWR 1FJEB 2RS2A 4TU7A 1VC6A 1DRZA 2XSFA 5LSOA 1VQLS 2CQ0A 1KC8T 1U1LA 1O0PA 3G9CA 3MURP 2D3OR 1K9MT 1HD1A 2DGSA 4OZ1A 1U6FA 2DO0A 1VBXA 1VC0A 2DNPA 1OPIA 2N7CA 1D9AA 2KN4A 3CUNA 1M90T 1IQTA 5CA5A 2LXUA 2DB1A 1HL6A 2DNQA 2MQMA 3Q2SC 1SJFA 4ZKAA 1WF2A
chains in the Genus database with same CATH superfamily
4A4JA 3A13A 3OXLA 4IUFA 2ZJPQ 5JUMA 1YGYA 2BABA 1S57A 1GX6A 3SFUA 1O51A 3Q8PB 4ED1A 3MMAA 2W4CA 1CJUB 1F5CA 2V2ZA 2QLJB 1FDBA 5LL6d 3K5LA 1U2RA 1YVFA 4AXJA 2XMMA 3HFZB 3OVSA 2XSJA 3PYFA 1HBUA 1LXJA 4EO8A 1X4BA 3N5FA 5L9NA 4P2XA 1AUDA 5KFBA 5I4MA 4N8OA 4QOTA 4RU9A 3UD4P 2OSRA 4RW4A 1QLNA 4P74A 4PPDA 3N01A 5J2MB 2JEFA 1MN7A 2MY8A 2VA3A 1W2IA 2XNQA 3VAKA 2V67A 1B0VA 1MLAA 2CPJA 4QJVA 3IRWP 4OYAA 1PC5A 3K57A 1VQ8S 4K4UA 3EE3A 5C2CA 2OPSB 4TLRA 2AP6A 2XI3A 3KJVA 2W01A 2BACA 1SI9A 4EYIB 1SB6A 1K47A 4DQSA 1N36F 1S1TB 3D6FB 1HNVB 3M8ZA 2PMHA 2BZ2A 1VISA 2Z2LA 3CCMS 2IM0A 1BMQB 1N34J 3CJQA 1JLBB 1AFJA 4ZCLA 1QAYA 4ZIWA 4L72B 2DGVA 4CLWA 3RR7A 3KJFB 3QRRA 3PEJA 1FX4A 2FJEB 3ENVA 4LF7F 1SQGA 4YS2A 4IRCA 4L3KA 5ETQA 4DL4A 4P75A 4DUYJ 1H38A 2YBVA 2QLWA 4QWBA 2HMIB 1XERA 5KAKA 2EBEA 3GIMA 3DI6B 3BQ0A 1IR1A 1M1HA 4YB7A 2ZH8A 1SQFA 3MTJA 1S1WB 5KOXA 2LA6A 2JRSA 3BN7A 1RAFB 4ZK7M 1U1PA 3AT1B 1T9WA 2G0CA 1FDAA 3RR8A 2H1YA 2FDNA 2ASDA 3AOBA 2J7KA 2YQ3A 3ZTPA 5D4NA 2YKQA 3H5UA 3PYEA 1O5JA 1FWKA 2MGZA 2VG5A 2I2YA 1HBOB 4XPCA 5L1IA 2E29A 1GMWA 4P71A 3GJRB 2RQCA 4YB6A 4USJC 3A1YG 3GV5B 5CCLA 1T05A 4LR8A 1U8WA 4RBVA 3TZXA 2OUGA 2DR6A 2HWHA 3ZFVA 2HBZB 3P45B 4PXBA 4Q45A 2O3DA 4N7TA 4LSNA 4AL5A 1TZ0A 5KG6A 4G1IA 5KFCA 5KFEA 5F0WA 4OYWA 3IGVA 4DV4F 3W2WA 3BH6B 2MKHA 1IBCB 2D74B 3FZBA 2HBYB 3TUZC 3M32A 2HQGA 4NCGA 4C48A 2Z0GA 1TFYA 2KU7A 2X7IA 4FS2A 3QT6A 3GQCA 4CLYA 3QLHA 3NBPB 2JWNA 1N52B 1U2CA 3DKDA 3M6UA 2XY6A 4WK1A 2FGCA 3S8SA 1F3VA 5DG7A 1UW9A 3EGNA 2RF2A 2B4UA 4RNOA 3FK4A 4NMXA 2D3UA 1Y3JA 1GXTA 5ITHA 1SJ4P 1TAQA 4X65F 2V8GA 2CZVC 4M5KA 4MKVA 3QRPA 4OYOA 4HI2A 3MMBA 3GWCA 1HQ2A 5KT7A 4ZP7A 2W7OA 2BM0A 3TOQA 3TVKA 2L08A 1RWOB 2MPUA 5DDPC 3RB3A 3IG1B 3WHIA 2VPWB 1SV5A 5CYQB 3MR6A 4NCBA 3HZGA 1JKHB 4DV6F 1Q8IA 2GHVC 2WB1D 2L3MA 1CLFA 3MEEA 4WK3A 4P52A 4YY3J 3CJKB 1IJFB 3G9CA 3BREA 1K0VA 1TFWA 3WQPA 5B09A 4ID8A 5T41A 2CJQA 3KYLA 4F26A 2GQCA 4HHJA 1ZZNA 3EJMA 3RU0A 3TAMB 1WORA 1S5ZA 3UNYA 1WEYA 3OR1B 3H59A 3HT3A 4I2PB 2RAQA 4NXMJ 2QA4S 3QSIA 2DR7A 3G6XA 1NKEA 2QLBB 5D4LA 3TA0A 2DEIA 4H4MA 3HKWA 3DLGA 3TZZA 5F8IA 1WD6A 2VODA 1FK9B 2HKEA 2UVRA 2B4VA 6FDRA 2CUYA 3MEKA 1RBOB 4LF8J 3AA9A 3BSAA 1VQ5S 2I5JA 2VPXB 3D0GE 4CM2A 2HVDA 1KFSA 4DL3A 2R7VA 5F8MA 3U02A 4ZVTB 1HNIB 1X4FA 4KGZB 2NSBA 3HHLD 1C1CA 3DLEB 1EIYB 2D7SA 3SSSA 2ZH9A 4CQ1A 2DGXA 4IR1A 1L3UA 4HTIA 4OZ5A 1Y3KA 2LEBA 4LBIA 1VRTB 1YRXA 1D9DA 3G6VA 5GAHI 4RBTA 1VLYA 2X1BA 5GMDA 3BBBA 5IT9Y 2UV8A 3PR4A 2RS8A 3HJFA 3H2UB 2FJDB 2DHAA 4RWXA 3FEXB 4KO0A 4X4OA 4NCAA 1JJ4A 2KVQE 3Q2TC 3DXBA 4ELTA 2AYEA 1C0TA 5C25B 4NLYA 3MCOA 4CO1A 2YH0A 5D4PA 2FVCA 3MPDA 1NLKL 2WVFA 3C16A 2GMJA 3G4SS 2JC0A 1MWQA 3PR5B 2HK3A 4KH0B 3DMJA 3K89A 1GT8A 3ISNC 5FJ4A 1CJTB 3DNCA 2YWKA 1N5YB 2ZKTA 3IGNA 4Y65A 4Y0FA 3HSZA 3UFCX 3K7RA 3CCUS 2DCLA 4I6AA 2KH9A 2ZH4A 1H74A 3LF0A 1IKXB 4WKYA 3HSGA 2G2ZA 3UPFA 3S7RA 5KFGA 4JV5F 2UUBF 3IA0A 1CSJA 5G0RB 1DTTA 4DL7A 1M5VC 3EX7B 3OTOF 1G6BA 1QVGR 3DYAB 2B43A 1KONA 2RVJA 4CIOA 1VHFA 1UEKA 4CNZA 2DHHA 3IRXB 3W9IA 5KT5A 4OX9F 4CH1A 3T19A 1M0SA 2ZBPA 1NJXA 3E3XA 4X66J 3R2CJ 3ZZPA 3I0SB 5LMUJ 1KDNA 1R0AB 2VFRA 4Q43A 2FZCB 4HT5A 4Q8FA 3A3OB 1RTIA 5ETPA 2CJKA 2V4QA 4TNOA 1I3OB 2RT3A 3QT8A 4A48A 2E5LJ 1Q86T 2CNNB 5IV4A 1S6PB 4CCHA 2MZTA 1RSCA 5A8WB 3CDUA 3Q89A 4QZVB 3K0JA 4Q44A 1YSJA 3BH7B 2ZC3A 4OHVA 4DR1F 1HHQA 4RPFA 3IR6B 4NLSA 2Y3YA 2OAUA 2DHGA 1WELA 2ZWPA 2ZITA 4KQZA 1H72C 2KT2A 2LECA 3IAM9 3R5DA 3V4IA 2HHWA 2H54B 3ET6A 3F0NA 2V4RA 3OSNA 1JJHA 1HNWJ 3TVYA 2QTWA 3UD5A 4Q0BA 3F56A 1HR0J 2KDOA 1JXLA 1LW0B 5LSOA 1Y5NB 2Z30B 3AOAA 3PW7A 2KJVA 3DGPB 1VYAA 1VC0A 3JQJA 3AXMA 4PQUB 3LGNA 3OFFA 4IG3B 1SC4B 3N5BA 2L48A 2KI2A 2J0XA 1Q78A 2LQJA 5DDOC 2MLZA 5GAHU 3QATA 2CNOB 2D3ZA 5B0GA 3J81Y 5CYJA 1YI2S 1HQUB 4KHPJ 4F2RA 5L39A 2LDYA 3BV8A 2MJNA 3PW5A 5IFMA 4L73A 4ZOSA 5E2QA 4YFUA 3R5BA 3SCJE 3DLKB 1QTNB 3FRYA 4PPZA 2Y1JA 2HNYA 3MD3A 4C8ZA 1ZM2A 3CCZA 2FC9A 1Y9OA 2FC8A 5KFTA 3BGUA 3OR2B 2QYCA 4AXIA 1BQNA 3C6UA 2CPFA 4YB1P 2B6AB 2BA9A 3VQSA 2L41A 1FWPA 2Z8QA 1IWAA 2J9CA 4B3MJ 4ANEA 2DTJA 2COLA 2HLUA 3BDEA 1E6VB 2OPRB 2CQ1A 4OHYA 4ZCKA 2HQCA 2RQMA 5M2PA 4ANCA 4ZPWR 5KFRA 5B0DA 1R8PA 2DITA 1GMUA 2QFJA 4QIGA 5B7WA 1X9MA 3HP6A 5KFSA 3UR3C 2APOA 5EX3A 1H98A 3EMTA 3L9ZA 5KG5A 2O67A 4F3OA 1F5BA 4J37A 2M70A 2RUSA 2XO7A 4NEYA 1B7FA 1CVJA 1TL3A 4C11B 1DQ8A 4BCAA 2RB7A 4X4RA 4LVOP 1X8DA 1GQEA 3MTKA 2LQ8A 3MI7X 3SEOA 1TK8A 3SI8A 1FXLA 4TY8B 2EFOA 4LR9A 3UDLA 2AD9A 1WUUA 4F4KA 4F4AA 2P9CA 2DXFA 2NQPA 4PWDB 1GNKA 4NLUA 2ZH6A 4R8UA 1UEVA 2KHCA 1UWBA 2OMLA 3TUJC 1O8BA 4I4BA 1TV6B 4YDDB 2D69A 2XYHB 4ECTA 5CD4A 1YJTA 1N6QB 3IC1A 2QJ3A 3LQVA 2CKWA 3MUMP 4K2XA 3TUPA 4ICLA 2HGNA 5EWFA 2HYIB 2ZDPA 2NLWA 2XYPB 1NBEB 3BR8A 1Q79A 5I3UB 5D4OA 1HFEL 1KOHA 4OI2A 2N82B 2BMBA 1OIAA 2FZGB 4U7UK 4DLGA 4ECQA 3EXCX 4PR6A 2CPHA 4DR3F 3W2VB 4RNHA 4I2QB 1MROA 4UTGA 3ISND 2VC0A 4K4SA 5J2NB 3I0RA 5JXSA 5GMEA 1URNA 4ZLNA 3THTA 2NCKL 1K8AT 2RMLA 4LMZA 3DRPB 1TL1B 2IC3B 1KTVA 2MZRA 2B7CB 2B0GA 5EUHA 1XWLA 5EDWA 3TQEA 2DIVA 1KBRA 2U2FA 1WF1A 5GVQA 2DJWA 4NXNF 2HS4A 2ZBIA 4IYQA 4B9TA 1F0XA 4J9LA 5KT4A 5CYMA 2WVBA 3UCGA 1D8YA 4WFZA 1EARA 3BYPA 2RKIA 3EVOA 5F3ZA 2VG7B 7FD1A 4OZNA 4JYAJ 2W25A 2XMKA 1S7HA 2DR8A 3ZTRA 2ZHOA 2C2OB 3NCPA 3HT0A 1BD6A 1H2VZ 1X0PA 2AYBA 4QW8A 1TMMA 4X4SA 3R5AA 3LPEA 1MWZA 2C42A 4FPIA 4ZP6A 2V8HA 2ASLA 2B4PA 2YKMB 1NCLA 4OQJA 1S1VA 4OIXA 2YKNA 1S7IA 3K59A 3P5BP 2R2UA 2RD5C 2UVWA 5A8RB 3P49B 4ZCIA 3V6DA 4DUZF 5L8RC 1RISA 1S0MA 4ES3A 4V19X 3DM2A 3BGOP 4P7TA 4B3OA 2W8KA 1QY7A 4OJ1A 4NYPA 4OZ0A 4CO4A 3RBDA 3C6TB 4WP8A 2IYIA 4S0MA 1IBMF 2P8IA 2DNPA 1OPIA 5DZ6A 1D9AA 1GXLA 1UVNA 1UFKA 3ADAC 1M90T 2XI2A 2DNQA 3E01A 5L1KA 3GV7B 4QWDA 3HVRA 2B51A 2QLXA 3VHQA 1VQYA 3MM8A 3SCKE 2VDHA 2IYGA 1RUSA 4URQU 1HHTP 1XBWA 4A8WA 1J5EJ 1CC7A 1KN6A 1U8SA 4B3SJ 2AZ3A 1N33J 1H73A 1YK9A 2HHTA 2XY7A 1TVRA 5HJYA 4ELVA 3UI3A 3CJ8A 2F63A 3HM9A 2GFFA 2VFSA 3M8QA 1JLQA 3ZZUA 1WKLA 4HLBA 1DURA 3J7YI 2ZE2B 3IS9B 3FBEA 1M5KC 3JYTB 4YOEA 2VV5A 4CTAB 3C14B 1SJQA 4X4VA 2DIUA 1S4FA 5FDLB 1NPPA 3FEYB 4ECVA 4M5HA 3OHBA 4JI3F 3OTEA 3BS9A 4EWTA 2UUTA 3W3SA 4RW8A 2B9EA 4RNFA 5J1EB 1B99A 4CP5A 1FEEA 4Q7AA 4GKJF 1L3SA 4BC7A 4KPYA 1CG2A 2CXEA 5DETA 2IFXA 1YITS 1NSAA 1BWVA 3K5PA 3OFEA 1WHXA 1RU2A 1Q81T 1U1NA 1NNDA 2JEJA 4F4WA 4KHRA 4U9RA 1YIJS 2KFNA 4QU7A 1KP6A 2OMOA 3VF0B 3GG1A 1ITPA 5DM6Q 1EJ7L 3L4BC 4C4WA 5KFKA 3H2LA 1Q8BA 1Z2LA 1J2VA 2GNKA 4GKKF 1U6BA 3LPYA 4MIAA 3BPSP 4FF1A 3T6BA 3L09A 2OKQA 3EZOA 5F9LA 7AT1B 3AOCA 4DSEA 4OJ3A 4R0JA 4DS5A 3UVJA 4K4VA 1V3RA 4MKBA 3NLCA 2M7SA 4R25A 3K5OA 3FCVA 3V4MA 2M9KA 1RTDB 5HROB 4X4TA 3J7ZT 4MJKA 3M2VB 5KT2A 1VQSA 1VK3A 4ZCMA 1IWGA 2QRRA 3MPYA 2OD4A 4KGMA 1FRJA 1DAXA 1M5PC 4OZ3A 2RE1A 3T6JA 2CVEA 2YKOA 2K7KA 3KK1B 1V6HA 1ACMB 1U1MA 1UJ5A 1RT2A 5C42B 3NGSA 4LF4J 2J6TA 1H2UX 3PW4A 5KFHA 2MKJA 3I82A 1NPRA 2KG0A 4K4ZA 2PEBA 3Q8YA 2UXDF 1YRUA 4DQIA 4DSKA 4KC5A 4M5DB 3V6JA 3TANA 5CZXA 1RT3B 2JL9A 4PG4A 4A8XA 3D2WA 3TNVA 1R6VA 4UUWA 1OJ4A 4PUOB 2HHHJ 3EICA 3MM6B 4QIWD 4DFKA 3H0PA 3FBFA 1IKVB 2RF2B 1ZAVA 1N54B 1G7CB 2VJUA 1FE0A 2BANA 1RAGB 2RIJA 3PX0A 4ZLPA 4AQYF 2VBYA 2LLZA 2WHOA 1ELOA 3GV8B 4LJMA 1DTQA 4DV2F 2A6OA 2J8AA 3J80Y 2RHSB 1MWYA 1VQ6S 3CDBA 1CJVB 1OQ6A 3VALA 4CO2A 2O01C 3Q8UA 1P8GA 1MMDA 4NPOA 4O3QA 5E3AA 4LRCA 4G6VB 4DV0F 1VQ4S 4IFYB 2V5HG 3DRXA 4OZ2A 1B0PA 4XTTA 1S12A 4G1QB 3A8IA 1HIYA 4C2MA 1RAOA 1JXEA 3PKMA 4ZVQB 1QSLA 4NASA 3O6QA 3X1LB 3LOUA 4KFBA 2CQIA 5GAGI 4ECUA 1QVFR 3J7YU 1EETA 1PBUA 2K2PA 3SV4A 1BQMB 4DR5J 1JNZB 4N56A 3DOLA 5C24B 2NSCA 5D8HB 4B9LA 1RQ0A 5DQIA 2ZH2A 3NS6A 4K2JA 1QAIA 3MCSA 2HG4A 1RT7A 4FXDA 1UP1A 4DOZA 1LV5A 1QSYA 2LCWA 1FXDA 4RU2A 2KT3A 4FDFA 3ICLA 1Y7PA 3JTNA 1FJEB 4EZ9A 4LFCF 4LBHA 2QA1A 4LVNP 2QYGA 3W5XA 4ED3A 2HIQA 5J2QA 1EP4A 1AYEA 1RKIA 2MQMA 4EZ6A 2HNZB 4PAAA 1NJZA 2ASJA 4PCQA 1FI4A 3CJ2A 4LSLA 2B8PA 1RGVA 1GH8A 1H0HB 2KFZA 4DX5A 4DS4A 3UCZP 1HBMB 4MIWA 3DU6A 1GAOA 1NHUA 2J9DA 4OHWA 4GRSA 1LKZA 4HI1A 4B9MA 3GZ7A 2PEHA 5THWA 3M6VA 2KT5A 4OI4A 5ADZA 3DRSA 3CGIA 2F4FA 4QPXA 2MSTA 4KV8B 3UDVA 3HD1A 5AE1A 1AZSB 1C2PA 1VBYA 2GZOA 4OJGA 4FF4A 3ENWA 5IWAF 4WTYA 2RDIA 4B02A 4J9KA 2HNDB 2XO6A 2ROGA 2FY8A 1SL2A 3QMQA 2CPZA 4OYBA 4OHZA 2DNNA 1HKAA 1NH8A 1TTHB 3MMCB 2JFDA 1T02A 1SJRA 2EFNA 4DL6A 4F0KA 4QU6A 2V9KA 3NOCA 3C3LA 1XQIA 3SYZA 5HANA 1RAHB 4B3TJ 4QR0A 3BO4A 4DU7A 1LW2B 3HHLB 5A6PA 1QD1A 3EDQB 2EPIA 2GJFA 1VHIA 1IKWA 1FFSB 4E2FB 3C46A 1RTJA 1LEOA 4KGVB 3OHAA 1SC6A 3CD6S 5K20B 4X84A 2AJQA 4WKRA 1FDNA 5AXMA 2EK1A 2VC1A 3RB0A 3AB4B 3LP0A 1NSQA 1TKXB 1YQHA 4HKQA 2O66A 4CO5A 4MKYA 2PGCA 2WONB 2DRBA 2MEWA 1KQGB 5D3GB 3PJWA 2AGOA 2M8DB 1K1SA 3HPOA 3POTA 3RAQA 1R27B 3M4XA 1X4GA 3PYGA 3JSMB 1SKWA 1S76D 1CJKA 3GR1A 2Q79A 2B7BB 3K5NA 4L6V3 2QA2A 4HDHA 1FKAF 3K58A 2CDRB 2B9XA 1JLGB 3AJ2A 5CZVA 4ZLJA 2C28A 5GAGU 4RW7B 2C3UA 3IM8A 1RHQB 4I68A 2XZWA 3R3TA 1LWEB 2K3KA 4HT7A 3ULHA 5LMNF 4OV1A 2F3JA 3HO1A 3SV3A 2YY3A 4ZN3A 4WFYA 2A2DA 4F7VA 2W2PP 1X5TA 3JTPA 2XMUA 4FXVA 1GTHA 4DU8A 4ZPBA 1RWVB 1Q0NA 4FKXA 2Z4PA 4P2SA 1YJUA 1FO1A 1HARA 1RXOB 2FQQB 1WG4A 4TLQA 5L1LA 4IG0A 4L3NA 2LDIA 1PG5B 5U47A 2ROEA 2Q66A 3CEDA 2PSZA 2J76E 2MQOA 3MM9B 3GSDA 4WE1A 4ZHRB 4ATNA 1IM4A 2XMWA 4IOCQ 2HVHA 3MR5A 3R27A 1EAYC 3FMBA 3M2RA 2EFPA 2AX1A 2EW9A 2CQ3A 3NCRA 3NGKA 1S9FA 4XPEA 4WTOB 2VZ9A 1ZA1B 4JI1J 4JI0J 2IJRA 4JI5F 1HNXJ 2G13A 3CD7A 2V4JB 3NRBA 1NRKA 4TYBA 2DNGA 3DHWC 3G71S 1REVB 1UA1A 3KNGA 3MM7B 2FJBB 1VCTA 3VVTA 4IDKA 3DFEA 3T5HA 4EBEA 1GTEA 4CLKA 1IBKF 2ZNZA 3RUBL 3FVYA 2H48B 3OLBA 1E6YA 4LFBF 1XK8A 2BJ1A 1RB0A 4CLPA 2AQ4A 3L3CA 2YNFA 2I9SA 5A8KB 3Q83A 2C2NA 1S9GB 2AYGA 2C3MA 3NCQA 3CSKA 3A8EA 3KG0A 5DGBA 1HD1A 1Y5IB 1VBXA 2BJ3A 3CUNA 1FCAA 4V19J 3OL6A 4QYZJ 1TL7B 1LK7A 4KR0B 4DPWA 3CT9A 4KBIA 4R5PA 1VDHA 3TZYA 4WIIA 4EBCA 3T1AA 2ZBCA 3MECB 3O44A 2CJ9A 1B0TA 4U6PA 2CQGA 4F3QA 4H4OB 4O4RA 2XY5A 2UUAF 2FYXA 4WJBA 4OMFG 2DVIA 4JP8A 4ECRA 2BVZA 3GJSB 3RAMA 1TUVA 3I32A 5KFOA 2P9EA 3IWXA 5B0CA 3CCTA 4RNNA 2DO4A 3PFEA 2AJFE 5A6WA 1U47A 2JDJA 2DH8A 2RU9A 2YNIB 1QAJA 2E5HA 2BJ8A 3SQGB 3HFVA 1C1BA 4NZ7A 2FLPA 1XMQF 1S1UB 1UW4A 3R6LB 2QMUB 4DL0C 2HQ3A 3D0HE 3PRBA 2FVQA 4HHHA 2NXNA 1N36J 3LW5C 1KLNA 3BYRA 3GILA 2RDJA 3QRQA 4G1PA 1WEZA 2IMOA 5KFFA 4CLFA 4RBUA 1A6LA 2RRNA 2AWZA 2EC0A 4DZ6A 3QZ8A 2WSCC 4LF7J 4RW9A 4ZVHA 3W1YC 5IS2A 2GGPA 2RSQA 1HYSA 3FFIA 2LYVA 4FNHA 3K8WA 1WOOA 4LIRA 2W9CA 2IBKA 2LU2A 8ATCB 4O4GA 3M8SA 1Q4RA 2KYZA 4E0DA 4IR9A 5D0RA 1NK8A 2W9AA 1U24A 2YWFA 1UTAA 4RUBA 2FTRA 2FHKA 4U7CA 4ED5A 1UPPA 1WDDA 4FZVA 3D66A 3TRGA 4MT1A 3CULA 1RLCL 2DPIA 4DR7F 4RR5A 3LP2B 2K1RA 4LQ3A 1WC5A 1MW7A 3ITHB 3IXQA 3KLEB 1RWKB 1QE1A 4QYRA 2DGWA 2WBMA 1FKOA 4RWWA 2G1HA 4LF2A 1NJYA 5CHCB 1FJ7A 4YY3F 1DZ5A 2V50A 2Z2YB 1Y10A 2XHCA 3TWZA 3MUTP 2IHR1 3H40A 3TUIC 3CCQS 3TAQA 1U1RA 3FC9A 2BJEA 1T95A 3G87A 4M95A 3T5KA 2AHOB 2VPZB 2UZAA 3EZUA 4O3RA 2ZM6J 2QL7B 3VZHA 2QGFB 3IBWA 3GTYX 1AFIA 3WIUA 4WP3A 1OYEA 1DLOB 3ZTOA 1JLAA 3QT5A 3PM9A 4DV4J 2GO9A 3OL8A 2AEFA 4NLRA 4ILRA 2QN6B 4CLSA 2MXYA 5K14A 3KHHA 3JSRA 2DR9A 2B5JB 3QO9B 2XYGB 3BSNA 2QL9B 2ZZNA 3V81A 1YHQS 2HLTA 3MAAA 2DRDA 4LF8F 3IWNC 4O44B 4CH7A 5CABA 2JLEA 3LALA 3QIDA 4QR1A 3PRVA 1Y00A 4DMZA 2E5IA 2PN6A 1RAAB 1RA6A 1VOMA 3TEGA 1H2TZ 2ILZA 1T7PA 5ETTA 3BSOA 4X65J 2HVEA 3K2YA 4IFVA 2CRLA 4X64J 5HLFB 3CJ0A 2EBGA 4FP9A 3DXSX 2YVSA 3OL9A 2QLFB 3GIKA 4I56A 5HJXA 3BKTA 4J9SA 2WZ1A 1FKPB 2NPIA 2WW4A 1CULB 3IR7B 4DV6J 3A8KA 5T7LA 1NZ8A 1TUGB 2IRUA 5HMXA 5KFWA 2EI5A 2HZCA 1V3SA 5HATA 2G1DA 3H2VE 2BXJA 4W98A 4NWBA 4ILLA 1R89A 3BO3A 1X9SA 2IVMA 5IV3A 2MKIA 3JSBA 2UVUA 4IRKA 1FRLA 5HBMA 3GFHA 1I1GA 3E2EA 3NGDA 4NI2B 2BYCA 1VQ7S 3M2UB 3KK3A 5HSPA 2PDAA 2ERRA 4YMEA 4F36A 2VFVA 2YWGA 1OSCA 2VUGA 1TKZA 3DDNA 5BR8J 2KL8A 4C8MA 3QPIA 4WZQA 3HVWA 1KLMB 4N8NA 4M94A 5HMWA 5HP1B 4ZKAA 1KTQA 4OI0A 1RBAA 4RW6A 1JWWA 3W60A 1Q5VA 5LM7E 3DDKA 3HKZD 2F40A 3LANA 4X62J 3G8SA 1SXLA 1WSRA 2KFYA 5DG8A 4ZA1A 1XMOJ 4DFPA 3SXLA 4LT6A 3FNNA 5J1PA 5BYQA 3HMJG 3QIPB 4QW9A 1FVSA 4J9OA 2KG1A 4LF9F 3EZ5A 4C3KA 2MB0B 2R7WA 4I6WA 3RYLA 2LEAA 5LMUF 2GO8A 4MYUA 3MEGB 1C0UB 3SMZA 3KG1A 1U09A 3KKFA 1S6QA 3QNWB 3QYYA 3FCHA 3BGRB 4W92B 3OQ2A 4C8KA 2XZDB 1F60B 2GAHC 1U0SA 2G9OA 4YR2A 3N6LA 2Z58B 3B4DA 1C4CA 2KRRA 1HBNA 1XC9A 4A8QA 1Q7YT 4LFAF 3NEKA 1IXKA 3US5A 2VOPA 3MGJA 2XLJA 2CNLB 3JB9k 2QC3A 4OYZA 2R7RA 4RL1A 1ZS6A 1S99A 2H5JB 3MWBA 3WZ0A 1DARA 5KG7A 4MTPA 4DN9A 1YWXA 3WIVA 2Y0BB 1WACA 1MU2B 5DO2A 4RKUC 1KHWA 3CE8A 3K8VA 3ZZZA 1KHVA 3VAIA 2M5YA 3RAXA 5ETKA 4DG1A 6FD1A 1H6KX 3GB0A 2FZKB 1R8HA 4C8LA 2L9WA 5KFZA 3CB4A 1SJ1A 1IKYB 2W8LA 3D3BJ 3I5BA 3NGRA 5E33A 4JV5J 4TU9A 2X1AA 4F4XA 2UUBJ 2E5GA 3KDNA 1HR0F 2KYXA 4K8RA 2RILA 1HWLA 1JLCB 2CJXB 1WOPA 3KFWX 5AE2A 2KZZA 4J9NA 1TKTB 4KGXB 1CEZA 1TKDA 2FGOA 3VVUA 4ZVFA 4P2MA 1UVIA 4CNYA 5KFPA 1F2HA 4ZPCA 3EPGA 2HQIA 4OX9J 1PJ5A 3KDOA 4DR2F 4KHPF 5K8MA 1CJUA 1VQ9S 3CD0A 1HI0P 2PT0A 4BS2A 2VQFF 1RACB 4ECZA 1C4AA 1T3OA 4EUVA 3TO8A 1DFDA 5EGYA 2UXBF 2HEKA 2GV1A 2N4DA 3VGTA 3CWJA 1FXRA 4GC6A 1N4LA 3I5AA 4UOHA 3MEDB 2YX7A 1IQZA 2OFGX 1J5OB 5E3QA 4FYWB 3KK2B 4IH7A 4DFMA 1SC1B 4ETXA 1U7LA 1RT6B 3D9BA 5J2MA 4DBQA 2YWHA 4DR1J 3GCXP 1K1QA 3C19A 3BF4A 2MQNA 4JI6J 3AFGA 5K8NA 1UJ6A 2XMVA 4EYHB 1KR4A 3Q24A 3FGVA 2ZKUA 2OFHX 3CC4S 1VIXA 2HPUA 1FRXA 2A2CA 2C3OA 2ZVIA 4EMDA 2OPSA 3FCWA 4YN3B 5LJ3Y 2JFKA 2MQPA 5E7OB 3W66A 2WVCA 3CJTA 5F8GA 3UW1A 1S1TA 1HWIA 4P6QA 1N32F 4H54A 1NKBA 9ATCB 4OYIA 2E7WA 1JLBA 2RNEA 2J7UA 2XLKA 1GK8A 3M1VB 1GX5A 2GS8A 2AJ4A 3V6KA 4DR6F 4F0HA 2IM3A 1VRUB 1NH7A 1S9EB 3DHXA 2HQDA 4AE5A 3G82B 3FUYA 3OTBA 2HMIA 3KLIB 2GIRA 1VQPS 4FYYB 1UCNA 3LWLA 4Z7CA 1Q1KA 1WJ9A 2YNHB 4YUDA 1RYRA 3DI6A 1LK5A 2RS2A 1VS3A 1VC6A 4Q8EA 1O0PA 4JOUA 1FESA 1S1WA 2R2RA 1U6FA 2N7CA 3TJAA 2ASYA 1IQTA 2DB1A 3OVBA 1GMWD 2X3GA 5E0OA 3KLHB 1HNZF 2AU0A 4EO6A 3RZAA 1WF2A 1CQNA 1N8RT 4OI6A 2W4PA 2DR5A 1T03B 3G86A 3SZ2A 2F9JA 3UWTA 1LWCB 2GA7A 1OSDA 2DRAA 1HBOA 4DX6A 3CIZA 4HEA9 2GCFA 3QSYB 2VG6B 3CMAS 2PO4A 4P10A 1WC1A 1FJGJ 4I7FB 3NY0A 2FD2A 4RZRA 4ETZA 1JMTA 2PMWA 3RRGA 3BB5A 2NUUG 3DLJA 4Z37A 5K5MA 2J9DE 2H4YB 3EPIA 2RU3A 3AQOA 2NUHA 2EVZA 4KRWA 2HRYA 1ZZFA 3ILIA 4RUHA 3ZC4A 2PI4A 4OV6A 2HW3A 1DHMA 3DOMB 4LF5F 1S1XB 4FYDA 4CYUB 2VA2A 2ZFHA 5D0EA 3J7AN 5GMKa 1D9FA 3M8PB 3P3DA 1XJWB 1XMBA 4JYAF 4TY9A 3NBPA 1AXQA 2IVYA 2LQBA 4FPRA 1JJ2R 4J9RA 1VR6A 3UCUP 2GJ2A 2DXDA 4C7QA 1TMJA 3KJQB 2ZD1A 5KFYA 2R4FA 5IM0B 4OYXA 2YXLA 2N4CA 2ATCB 1I6JA 2ZH3A 1JQGA 3TYTA 1T9VA 1EKRA 1RT1B 1JNRB 1RKJA 1PBAA 3ZXWA 1FA0A 1RWMB 5KFDA 3DOKB 4JUZA 3LAMA 4USWA 5HQLA 3I9V9 4FVCA 4LRDA 2VBXA 3TA1A 2ZVSA 2NR0A 3GMGA 5KFXA 3CC7S 3IG1A 2A10A 5CYQA 2MKKA 4BWMA 3CDAA 1JKHA 2UXCF 4LBPA 1FNXH 3N79A 4Y2AA 2E1CA 2MHEA 4PKDB 4NZ0A 1RT5B 3PXGa 2KJWA 1JJCB 3H8YA 3CJKA 4OI3A 4ZPTR 2HFZA 1FEHA 1HMVB 3QGHA 4DR3J 2MKYA 4J9PA 1CS4B 2BE2B 1XR6A 1YJWS 4D3HA 1TR0A 2IBOA 3OXGA 1M1GA 4JBCA 3QGPA 5HMYA 4F50A 2ZH7A 1U2FA 4MFBB 4CT9A 2H51B 1J5EF 2M0GB 5D77A 4A8OA 3VAFA 3TAMA 1FF2A 5K9FA 1N33F 4I67A 1KVKA 3OR1A 4OX7A 5KFUA 4IO1A 1XEZA 1RTHB 1SH3A 1NJIT 5I42B 4I2PA 1HPZB 5HQ8A 4NXNJ 4Q2LA 1UETA 3KLGB 4GVBB 4O3SA 2BJDA 3LH2S 2A1BA 2GW8A 4ED6A 4F67A 1FK9A 3M2RB 1BE4A 1G4CA 1YX2A 2JOQA 3DRRB 3LUYA 1WC4A 2ALZA 2HHSA 3IMQJ 4F04B 2IA6A 4J9UE 3CD5A 4CH0S 2CG8A 1P9YA 3Q8SB 5LSRA 2H5EA 4TQSA 2ZZTA 3M6WA 3HK2A 3KHRA 4OYPA 1T94A 3AJDA 1PIEA 1HNIA 3VCDA 3IWLA 1LFWA 2AYMA 3TAPA 1SKRA 4H4KC 1SIWB 2OELA 3CCVS 3C15B 3DLEA 3R6GB 3P8BB 2HQFA 2BKNA 2VH7A 3D54A 5I3QA 3T9ZA 2P6TA 4DZDA 4USMA 2CQ2A 1LWFB 3KNAA 1VRTA 1SUQB 3NWGA 2HBQB 4DCPB 1PILA 1RTZA 1HQEB 1W2BR 2M88A 1ICEB 1Q16B 1X7VA 5GAEI 5D15A 1FD8A 5B0EA 4IQXA 1D09B 5KFVA 2R2TA 3H7HB 1X60A 3M05A 2A6MA 4GC7A 3DC2A 4DUTA 3H90A 4AUKA 4BBYA 1T9YA 3PJXA 4CT8A 5C25A 4KAIA 2VDIA 1RYSA 2W9BA 2RRAA 4KH1B 2W2MP 1FT8A 4NYZA 3Q8RB 3MAQA 1U45A 2EK6A 1OO0B 3S01A 2X1FA 5LXRA 1JK9B 1RCXB 1NSPA 2MMYA 3MM5B 1RABB 1CJTA 2UP1A 3GIRA 2HHVA 2OEJA 1N5YA 1NM2A 3KHGA 1DRZA 4LREA 3QFWA 1CBKA 3RG6A 1KC8T 2VQEF 1K9MT 3OTCA 7FDRA 3OFGA 4G3IA 2IRXA 2OPQB 1IKXA 2V2QA 4NX9A 2DEJA 2NXEA 1ROFA 2YWWA 4JI4J 1V9OA 2V8PA 4F4ZA 2JEIA 5G0RA 3QWUA 1WEXA 4UF4A 2XG8A 4LF1A 1UL3A 4GKJJ 3ZZRA 2OPPB 2PMZD 5G4DA 3DYAA 3B6BA 2IRYA 5LT5A 3IRXA 2C2KB 1ZM9A 4O4GB 2WK4A 4ID5B 3NNHA 3GYXB 2H9ZA 3I0SA 1R0AA 1QM9A 4X4NA 5E3RA 4GKKJ 3AA8A 4PXDA 1QE1B 2EXUA 4MH8A 2HZAA 2MQ8A 2ZUAA 4CWBA 3M30B 1U0HB 3PYDA 1S6PA 3BQ1A 4M5IA 1W26A 4A46A 5A8WA 2BBEA 4XO0A 1XNQF 3FRZA 1HWKA 3PO5A 3P6YC 2CZ9A 2Y8YA 2B9YA 1DJ0A 1GFWB 4ED0A 4MK9A 5A0YB 2J8SA 4LIWA 1JLFB 5ETRA 2GVDB 4U7UD 1TK0A 2MKCA 1IBLF 4USHA 2KTQA 2XWYA 5ETVA 2N7YA 2IJFA 3WBZA 4ENOA 2DBBA 1HW9A 4HTJA 2P6SA 3J7A1 4YHHF 4PXCA 3EYZA 5D78A 3GE9A 4UT4A 1Z1ZA 1F1BB 2BRLA 2CWKA 1EZZB 1LW0A 2AMCB 1W25A 2ZBRA 1CPZA 3HVTB 5HO4A 1MNEA 5KFMA 2EG2A 3DGPA 5DG9A 4NLOA 1ZPVA 4DI6A 4PQUA 3CVKA 4J7CA 1FD2A 5IT4A 5BYRA 1WF0A 3KUGA 4IG3A 2C1EB 2HRUA 3TZWA 1K44A 3D6HB 3KUEA 2KXHA 3PNIA 3AHPA 2F4VF 1HQUA 2IAJB 5GAEU 2EEYA 2QV6A 4DV2J 2X3DA 1KVJA 2XHWA 4HVZA 1U49A 3VAHA 4DV3F 2IDLA 3N9UC 3KHLA 1S4EA 1JLEB 3I55S 2DHSA 3DLKA 1OS5A 2FLLA 5H1SV 1I94F 3THVA 5HAOA 1S48A 1F9EB 4DV0J 3CMES 4ZP9A 4L74A 4ECXA 4DV1J 3OR2A 4RO0A 5J2PB 2VICA 1S79A 1S10A 2YWEA 4O3OA 2ZZMA 2DNKA 3VGSA 2B6AA 3DU5A 2MQQA 4NMLA 5KFNA 1E6VA 2VL1A 2OPRA 2DT9A 1U1KA 4ZP8A 1AROP 2AX0A 3JXOA 2PIIA 4Y2MA 1X4CA 3AY0A 4DFJA 1U48A 1ULRA 1N48A 2GVZB 2AF6A 1KRPA 1A7GE 2XMAA 3HDSA 4B3TF 3CO9A 1ZBTA 2C2DA 4QQBA 3FMWA 2YNGB 1QUVA 2CG4A 1R7IA 4QIEA 4UY85 1RA7A 1P1TA 3GJQB 1Z4UA 2ZOGA 2HAIA 4M63A 3HD2A 1YJNS 3WX4A 2R8HA 4IOAQ 4IOBA 4C11A 4PWUA 1Q53A 3JSYA 3UN5A 3CO0P 2B3TB 4ZJLA 2AJ2A 2SXLA 2A3JA 3OSPA 1L5UA 2FJXA 2YX4A 1L3TA 4WCEQ 4P2FA 4TY8A 1WHVA 2ROPA 2VU5A 3NOGA 1MSWD 3GPAA 4PWDA 4Q2MA 2FIUA 5B0FA 2C2EA 3VAJA 5FIIA 3W63A 3Q23A 2V2KA 1YJRA 3H25A 1TV6A 4WIQA 3HULA 5EWGA 4W4MA 2DO0A 1KEKA 4CLZA 3VGVA 3ZZTA 2LXFA 1N6QA 4KKOB 5IC6B 4KPCA 4P73A 2DNHA 3MR3A 2QFIA 1ZTWA 2WSEC 3HSDA 5I3UA 3P4UB 4WWSA 5IOLA 4KB7A 3W2VA 1RCOB 2V0NA 4HR2A 4I2QA 3K17A 4AYBD 3B4MA 1YBUA 2HS0A 2GX8A 5J2NA 1X31C 3NS5A 5F41A 4RNMA 4U96A 4JI8F 3DRPA 1TL1A 1X5PA 2IC3A 4JI2F 3HX9A 2ZEJA 4H4KA 2WBRA 4WF9Q 1VQKS 4ZVEA 1PSDA 2Z2ZA 1WHYA 2YTCA 4HACB 3E8OA 2DNZA 3AJ1A 2FVRA 3CNQP 4NA2A 2HURA 5IQQA 1O6XA 4WXOA 2G2OA 4CO0A 2EC2A 1FTCA 4ZDNA 3SCIE 4B3RJ 3ISZA 5FD1A 3W5ZA 1YTYA 3OUYB 2VG7A 2KXFA 3IN5A 4C8NA 1M1KT 1SIZA 1UKUA 1YZ7A 3NAIA 1X4DA 3TJ8A 1UJ4A 2FPHX 2C2MB 2U1AA 2JVRA 1NK7A 3KLFB 2YKMA 4FF2A 3RB6A 5SZTA 4OLPA 1ZA2B 1WC3A 3E51A 1HI8A 3SDEB 4IO9Q 2UUCF 5A8RA 1RT4B 4ED2A 2ABYA 3LP1B 2H4WB 4N76A 3MOZA 3T1YJ 3NMRA 3HHLC 3BBCA 2AJ0A 3MHYA 2AJ1A 5C2GA 4A8FA 4I1TA 5EN1A 3C6TA 3UD3P 5LMNJ 4ZLLA 2Q1LA 4NLDA 4WYLA 4NRTA 4MMOA 3IBCB 2R7SA 3FKBA 5EWEA 3CW2C 1RE1B 1YJ9S 1L3VA 3W9JA 3TW0A 4QWAA 5E41A 2BEFA 1PAEX 3BQ2A 3PIOQ 1FTRA 1N0UA 2F9DA 4LF6F 3NP5A 4CRJA 4C0OC 4ILMA 4DX7A 3TA2A 1WI8A 1NDKA 3OL7A 3CCJS 3MMAB 4J9MA 2DNMA 1XR7A 2VHGA 2ZE2A 1FWLA 3IS9A 3RBZA 2CPXA 3JYTA 4CTAA 4PRFA 3C14A 2XSJB 2D1CA 5IT9U 1HBUB 5FDLA 1EKSA 2RQKA 2PI5A 1RJJA 1EB0A 2GQ2A 4JI5J 3AQPA 4KTQA 5J1EA 2XZTB 4KYZA 4DN0A 3AD7C 3FDSA 1IR2A 3I96A 3JQKA 3H4BA 1M5OC 4RW4B 2ZOFA 2XS2A 2Q6CA 1B7YB 4C98A 1R43A 2Y1RI 4ITSA 2DNLA 2CAJA 1SKUB 2F7VA 2XWXA 2OO4A 2GMLA 1IBKJ 1I51B 4CO3A 1IJEB 4CLUA 1ZH5A 3JS9A 4LFBJ 3M7VA 2AEMA 1T8EA 3B82A 2EKYA 4Y00A 3BGFA 2DGTA 4Y2IA 1GMVA 4C0HA 4M5JA 1WHWA 2GIQA 4DV7F 3KJVB 1U1QA 4L76A 2QSWA 3DLBA 4DSFA 1F9FA 4PZVA 3PV8A 4DEZA 4KY3A 2HIYA 3P5TL 3BPDA 3TJ9A 4K4XA 1VJQA 4W90B 2HFVA 3D4JA 1UVKA 3OTDA 2M8HA 2R7UA 1RTDA 5HROA 3M2VA 4FNIA 4RJVA 2ZM6F 1YBTA 1FFWB 2UUAJ 1OQ3A 3CPWR 2FB0A 4MK7A 3IM9A 2FVPA 2QX0A 2E1AA 1HHSA 3MURP 5E5NA 4Y2CA 3KUHA 5KG3A 3KK1A 5F3TA 1F9HA 4M1KA 1R0CB 2V8VA 4NRUA 1XMQJ 5C42A 2FLOA 3TX0A 4QYZK 3MPWA 1U26A 1N88A 2DGUA 5F0UA 2E1PA 3PX4A 3BDPA 4X2BA 4M5DA 1REGX 4PQAA 1G3OA 1RT3A 2EFGA 1R8AA 2MGZB 2VG5B 4WFBQ 2J0SD 1B70B 3OFHA 1FVQA 5H9FJ 3KMSA 4PUOA 3M9MB 2MZSA 2ZC4A 2QG9B 4J90A 4ZVGA 3FBCA 3MM6A 3N0VA 1YLXA 1Q82T 1IKVA 2ZD1B 2VFUA 1T05B 1IVZA 2KZMA 2EFVA 6AT1B 2HHPA 1BXNA 4UQTA 2BQRA 4FBTA 4LSNB 5F8LA 3NNCA 3GFZA 4ZPDA 1AUSL 1YZ6A 4X64F 2IY5B 5LXYA 1CJVA 4M5NA 3W2WB 1NHKL 4DR7J 3NS7B 1NXIA 4CDIA 2I8EA 4K59A 1FHTA 3IP0A 5DGAA 3M32B 3BKFA 4PWWA 4CM0A 3NXZA 4NCGB 4NLQA 4IFYA 4ERDA 3ZZYA 2R7QA 2JEGA 4G1QA 3QLHB 3U1NA 4FN5A 2HK2A 3QJLA 3ETOA 3SSQA 5AJ3F 2FHMA 3GIIA 1NDLA 4WYWA 4P9SA 5DM7Q 3TQ1A 3CCLS 3J81U 1BQMA 5A2QY 1VQNS 4PG7A 3PW2A 3A12A 4PEOA 5C24A 3T5JA 1P27B 2CPDA 4GO7X 1NZAA 1H3DA 3LGMA 2JH3A 2UU9F 1Y4ZB 3R97A 4TVAB 1HD0A 3MMBB 5K8PA 3QT7A 4J91A 3T1HF 4BWJA 2ACMA 4IH6A 5KFLA 1LOUA 5BR8F 1SV5B 4JI7J 3I56S 2JLGA 2DD8S 2CQBA 4FVMA 5EX0A 2KXNB 2J6SA 1BLUA 4F8RA 3MEEB 2BOPA 2IPOB 1M5SA 5D0HA 2HNZA 3N6MA 2O1PA 1PJ7A 2K06A 3AAWB 2R42A 4YDXA 3RJMB 4X62F 1NO8A 3R5CA 2ZH5A 1ZM3A 1EHWA 3T5LA 1UVMA 4G65A 1XMOF 1HBMA 5KFQA 3G2XA 2KKHA 2R7XA 1MN9A 2XNRA 2BR0A 2HVZA 3H5YA 1XNRF 1TL4A 1HLWA 4DX8H 5T14A 4MK8A 4DPTA 1R8BA 3M9OB 4DCJB 1NUEA 2XLIA 4H4MB 3TX8A 3DLGB 1WG5A 2NXUA 4DV5F 8RUCA 4BC9A 1VK8A 4KV8A 1Q7LB 1AZSA 3H42A 5D0GA 3D7SB 1FJCA 1T11A 3MCNA 4NYOA 3CDWA 2HNDA 1WKJA 2I5JB 1T9TA 2QO3A 2NXJA 2W9BB 4FKYA 1SVDA 5AT1B 4BLGA 4NLXA 3MMCA 1MG7A 1N5SA 2NZ4A 3NGTA 1NSKL 4KJIA 1TQLA 2GC8A 1C1CB 1I5OB 1KQSR 1H7XA 3MMJA 3HSJA 2QL5B 3G8QA 2BW7A 4M5GA 4K0KF 2B56A 4HHUA 1K73T 1F5AA 2DH7A 5F8JA 1LXNA 2XGPA 1LW2A 3HHLA 1DBDA 2D9PA 4ZVOB 2ZNYA 4I64A 3MZIA 1QJHA 3X3UA 3A3NB 3VZIA 3VV2B 3A3PB 3D28A 4KO0B 1UA0A 1YRTA 4XAKA 4FBUA 1BC6A 4YEAA 3TP2A 4DR4J 1TKXA 3CCWA 5LOQA 1C0TB 2WONA 4DL5A 5D3GA 4ER8A 3MPUB 4LQ9A 2DNOA 2IM1A 1TP7A 4OFZA 2DCUB 3H5XA 3RGIA 3C16B 1U25A 2BQUA 4I0WA 2AIRB 3D67A 4DL2A 4FYXB 2CYYA 2JJ4D 3DMJB 3JSMA 4N77A 3RBEA 4LF9J 2E9TA 1TU0B 4USIA 2Q43A 1ZAXA 1S0VA 4N5SA 2WW8A 2NZCA 3Q2SC 1R6YA 3C66A 1GXUA 2EFQA 1JLGA 3IO1A 4DSJA 4QCLA 2UVVA 1G2EA 1AB8A 1RHRB 4RW7A 2R3VA 3GP9A 2CPEA 2P5VA 5B0BA 1H7WA 2RH3A 3PHTA 1LWEA 3QGIA 1X5OA 4Y34A 4M5LA 1KSPA 4OX6A 1DTTB 5M2RA 4FXWA 5RUBA 4QWEA 3WC2A 4LFAJ 3U1LA 4P72A 1UFWA 2Z57B 4C3MA 4X4UA 4MAKA 4FF3A 3SQOP 4JI6F 2DNRA 5AXKA 2CQHA 2FUG9 2CJAA 3L7PA 3MM9A 4ZHRA 3PRDA 1S6UA 4B9VA 3W65A 1X0FA 3S1TA 4HDGA 1X4AA 2ZOMA 1V3ZA 2LEPA 5CCMA 1VI7A 2C22A 1RTIB 1X4HA 4CLTA 4HL9A 2YH1A 1RP5A 3VAGA 2LP4A 1SH2A 3R2DJ 2Y1IA 1PYSB 4WZMA 5KG1A 4ZIVA 2GIFA 2V4JA 4DSLA 3FEZA 4UOFA 1PKUA 1WSVA 2E44A 1NB7A 4QR2A 3EWGA 3EXYA 2F1FA 3ZTSA 3KJNB 1REVA 1U4BA 3V2UC 2C2RA 1LNQA 3MM7A 5ETMA 3MD1A 4DR2J 3R8YA 3H98A 4ZVSB 3B8HA 1DY3A 3UR0A 5A8KA 4E98A 1S9GA 3V4IB 2RRBA 3ET6B 2E1RA 2BE7D 2VQFJ 3UN3A 4Q0BB 4YP3A 3R5GA 2UXBJ 4B17A 2AT1B 3LO3A 1F6TA 1TL7A 2DISA 3R5JB 3Q8QB 4K7QA 3ZNJ1 1N34F 2HZVA 4A8YA 4WPAA 5JMNA 1WC0A 1J27A 1VQMS 3PIPQ 3GLJA 5AXLA 4OLOA 1HWJA 2JSXA 2MYFA 3MECA 2QA4G 1P1LA 1FJGF 2DH9A 4ECWA 3EDRB 4QBUA 4H4OA 1RU1A 4UQGA 2NYIA 1FRKA 4DUYF 3AXKA 3HHNB 5HVHA 3H4DA 1FRMA 1S49A 3NKYA 4OHXA 4QIVA 1QSSA 3C2PA 5KT6A 1KS2A 2WCXA 4DCOB 4IH5A 5KOWA 2KM8C 2QEXS 2YNIA 2AGQA 2DY9A 3SQGA 2DNYA 2HNYB 3H20A 3V5RA 1S1UA 5AE3A 4UUXA 3D6TB 2KHDA 2MQLA 3K5MA 1N32J 3WX8A 5HN0A 4U95A 1BQNB 3C6UB 3R1HA 2ATLA 1KQKA 5AXNA 2K8GA 5F8HA 4OZJA 4ZS6A 1JIHA 4X4QA 3RB4A 2VKZG 1LFPA 2V63A 1T9XA 3T9NA 5KG0A 2J7WA 2A0FB 4C8YA 4Z7YA 1Y11A 1LQ9A 2GAGC 2WOMA 4KHMA 4DR6J 1YJVA 4K5RA 3O3LA 1JX4A 4RUCA 5DRKA 1WDTA 2JLFA 1YG0A 1AW0A 2RDDA 3GFXA 4ANDA 1VGYA 5KFIA 3HVAA 5C7PA 1SBRA 4O3NA 3A8JA 3LP2A 1KKHA 2GHWA 2LQ5A 3ITHA 3FSIA 2OSQA 3PDNA 2MLYA 3KLEA 1HNZJ 1AA1B 3BN4A 1SL1A 3OPKA 1TL3B 3HLUA 1UFLA 5LSLA 2VBWA 2XBPA 2HFOA 2ALYB 2CPIA 5J1NA 3PEHA 2WVEA 3ILLA 4N47A 1M5HA 2VIHA 2OLWA 1R3NA 4RLEA 1NKCA 2R7TA 3RRHA 5IXUA 2ZH1A 2K3IA 4TU7A 3ZNUA 2ILYA 4A8KA 5A2QU 4R8UB 3BKUA 4E8UA 2HVIA 1DLOA 3ONQA 1MMLA 1BUXA 1UWBB 4URGA 3J80U 3DRYA 3I5CA 3WDOA 4IRDA 1Y0HA 5JVGQ 4LF5J 3HF5A 3SBMA 4BDPA 2B5JA 4ICLB 4K4YA 5KTQA 2MZJA 3QO9A 4DJBA 4R0EA 4PG6A 4O0NA 4UZCA 3QJPA 2QIFA 3HCXA 2BDPA 1UZDA 2QZ8A 3W5YA 2OTLS 2OGUA 2HFUA 3FSXA 4N41A 4LRBA 3O1LA 4O44A 4EFAC 1MROB 2HHUA 2HSEB 1ZETA 4B9UA 3I0RB 4ELUA 4QWCA 1D3WA 3N4WA 4Y2KA 3KTQA 2GHPA 1OY9A 3GU0A 2OD6A 1UVLA 3U7JA 4ZN1A 4WFAQ 4XIUA 5HLFA 1NK0A 1L3KA 1Q8KA 2XS7A 4NXMF 3PVXA 3UE2A 2LXIA 3HHEA 3SFGA 5CYMB 1FKPA 1CULA 2UXCJ 4KT0C 2RKIB 2F5GA 3G6ES 2LVWA 3BBFA 1ZTTA 4DXLA 4MKAA 3F41A 4CZCA 3MR7A 1BY9A 3UDEA 1FNMA 1U6ZA 5L38A 1FRHA 1IUJA 4ZMMA 1LWXA 2V6AA 5HI7A 4EBDA 2F8EX 3KXDA 1S1VB 2YKNB 4MYTA 4K5SA 2ZDOA 4NI2A 4MIBA 5CAAA 3M2UA 4WXWA 3V6DB 4C6AA 4DF8A 3DM2B 3JAMY 4B3OB 3TVZA 2K7JA 3DCAA 1KLMA 4JI4F 1X5SA 1R8CA 3QFHA 5HP1A 4UOCA 1SPBP 5L46A 2MZ1A 3TARA 3BJYA 3E01B 1NK9A 4LR7A 2OEKA 3OVAA 2MHNA 2LMIA 3IBFB 5E3PA 3MM8B 4ZPAA 5EHHA 2FLNA 3CCES 1RWNB 2DYAA 3CJ5A 8AT1B 2Y0SD 2W2OP 4PYDA 3QIPA 2CA9A 1B4SA 1JB0C 1TVRB 4FS1A 1RADB 4I6YA 4F02A 5H9EK 2VJVA 3M8QB 4RX6A 1WNEA 1JLQB 2GJIA 2E5JA 3MFHA 4GVLA 1NAQA 3MEGA 1C0UA 1URRA 3GYGA 3CXCR 2ADCA 4O3PA 4U8VA 2EG1A 3CCRS 2HGLA 4NA3A 5DDRC 1MMNA 3BZQA 4PG5A 2CPYA 4LUBA 2ZJQQ 2E1MC 1U1OA 3BGRA 4EU0A 4O0IA 2JNJA 1RWUA 2DKOB 3D1QA 4RW8B 2ZJRQ 1U02A 2MSSA 3PG9A 1S0OA 3PACA 2ZHBA 1BWEA 3QAEA 2PFDA 4D3GA 1S59A 2DY1A 1RWPB 5B0AA 3QJJA 3HXMA 4ED7A 1MU2A 1RHUB 4IQMA 2A18A 2YQ1A 2KO1A 4ES2A 4X66F 2I1RA 2Q6BA 5I3PA 2VQEJ 1RHJB 1ZAWA 3CJSA 3A4TA 1TAUA 3MUVP 4DQPA 2CDQA 1IKYA 3RW6A 5K8OA 5DLGA 1FERA 1JLCA 2MZQA 4JB8B 2E5LF 3T41A 5FLXY 3UVJB 4AFFA 4AD6A 1TKTA 3BGLA 3DLLQ 3C8YA 3UQSA 3F44A 1RLDA 2XULA 2BM1A 1SH0A 3P96A 3D6MB 3D1OA 2CJYB 3MPVA 3CJ3A 3D0IE 2HBRB 1AT1B 4A8SA 2AGPA 1F2GA 2CZ4A 2QMXA 4X4PA 3OXFA 1RT2B 4Y6IA 1KWMA 1HNWF 3D68A 3MOJB 4DV1F 3NAHA 2I38A 1R31A 4USUA 2BE9B 1OYDA 2QE5A 3Q86A 2E7XA 4RUAA 1XNQJ 2H3EB 3OTOJ 3RTVA 3MEDA 2XM3A 1J5OA 1V5VA 2V34A 1B3TA 3KK2A 2D41A 5MAOA 2VKRA 3FZ2A 1NK5A 1RT6A 4BHQA 1D1UA 2J5AA 5SUHA 1SKSA 1FE4A 1PO6A 2BANB 3HI9A 4DWIA 1IBLJ 1ZPWX 2M3DA 1DTQB 1NHVA 2VONA 5HMZA 1IR0A 5M2UA 1UMJA 3R7NB 4Q5VA 1T3NA 3J81j 3MAHA 2DK2A 2WTFA 2E9RX 4YHHJ 1XIQA 1NDCA 3RW7A 4EI2A 5F8NA 2CQCA 2DGQA 1NU4A 5DDQC 2V68A 1F3FA 3VTIA 2XGQA 1EX8A 1N5TA 2BJ9A 2Y8WA 2Y9HA 1WWHA 2XMTA 3GFYA 3M6XA 1NPKA 3M1VA 4B3MF 4K4WA 4NEZA 4CI0B 4KFBB 4WFXA 5LJ5Y 2XEXA 3SCLE 4ES1A 1Z2ZA 1EETB 1VRUA 3UN2A 2F4VJ 1S9EA 4B08A 4L75A 2BQ3A 4NLGA 4AT1B 4DSIA 3G82A 5BYSA 3DOLB 2PFFB 1UPMB 3KLIA 4YR0A 4I69A 2NXCA 2C2ZB 4EK2A 2YNHA 3BEGB 4DV3J 1RT7B 2UV8G 4M5MA 2MDAA 1WTBA 5L9XA 1I94J 4NA1A 3KLHA 3Q0AA 3IFEA 1CC8A 1T03A 5J2QB 1EP4B 1HI1A 1FRIA 2RUGA 1HNVA 4B9SA 1Q8LA 1LWCA 4PYAA 4ZJQA 3GCWP 4B9NA 1PGZA 4LSLB 3I4PA 2VG6A 5IZHA 3PW0A 2NYHA 4I7FA 2D9OA 2Y1LB 1RHKB 4LRAA 1SC3B 2HHXA 3CCSS 1N5QA 1WOSA 3EM1A 4Y3CA 2W2QP 2QT7A 3I31A 4DQRA 1Y5LB 1SCJB 2FJAB 3R1LA 4K50A 3DOMA 1S1XA 2LU1A 3DRSB 4CYUA 4LSZB 2M2BA 4B3RF 3IR5B 3PKYA 1BQXA 3M8PA 3B54A 3PY8A 2NPFA 3EVMA 1K0TA 1S6OA 2Z2MA 1G1XA 4OI1A 4OYMA 1XR5A 3CDEA 3KOAA 4UZBA 1BHNA 3W61A 1VJWA 2P9GA 4KE5A 2FHOB 1WKKA 3OJUA 4JV0A 4IKAA 5ETOA 3W9HA 5DS7A 3HHDA 4USTA 1WI6A 3ZZOA 5IM0A 3R7SB 2GMHA 2PD1A 2NS1B 4F25A 2VOOA 2AW0A 2I6WA 3G96A 3DGVA 1VRQC 4NL5A 1KVIA 3M8WA 1RT1A 3DDIA 2W7PA 3J7Z5 2B9WA 3T1YF 2ZHAA 3DOKA 1UAWA 3UNGC 1D0EA 2L9DA 1IKWB 1TUWA 1RZMA 2IVFB 1RTJB 3TI0A 4TQRA 2XQCA 1KD1T 9RUBA 5HVFA 3S6EA 1RT5A 4TYAA 2YX1A 3I9ZA 3LP0B 2VD3A 3W8PA 1HMVA 3GG0A 1UVJA 2IMWP 2B4OA 5KG4A 1N5VA 1CS4A 2BE2A 2XSFA 2J9EA 2UUWA 1VQLS 2CQ0A 4ZVUB 1XTZA 3POTB 3AB2B 4ZVPB 4MFBA 4JI8J 3PFOA 4XDDA 4JI2J 5B08A 4AL7A 4GMKA 1CJKB 2LKZA 5BJRA 4F4YA 2ADBA 1YDLA 1RTHA 5I42A 1HPZA 4A47A 3EGVA 3V6HA 3H5SA 4JV1A 3NGUA 5JJBA 2CQDA 3JAMU 2R8KA 2N3LA 2JHEA 2ZWOA 3KLGA 5F9NA 2R2SA 4GVBA 3ILOA 2IM2A 2XMJA 3GONA 4TN2A 3DRRA 4V1Ak 2CWXA 1APSA 2XC9A 2FVSA 5KFAA 2JVOA 2W7AA 3QGGA 2C3PA 1X9WA 1PJ6A 2L9NA 2JZ5A 2HFNA 4P7VA 3JQMA 3ENQA 4C9DA 1PYTA 2BW2A 2JC1A 1P6TA 2HFSA 5JVHQ 4IG0B 3EVWA 2BV3A 4B3SF 2ZBQA 3C15A 1S0NA 2DGOA 3MR2A 2UUCJ 3LWMA 1TELA 2XTJP 4NLTA 1VBKA 3U27A 1VC5A 4WE1B 2DHXA 1LWFA 3D5MA 2R9LA 4YR3A 4YB5A 1HW8A 2MTLA 5H9EJ 1SUQA 4PXEA 1N56A 3LA0A 2O5DA 1HQEA 3L7OA 4FYVB 2E66A 1QTMA 1RWXB 1JXVA 3D3CJ 5IQ6A 1PAUB 4CLLA 3I4HX 3JTOA 3OW2R 3HJVA 4QIFA 2XB2D 2VB6A 3AD9C 4ED4A 3NMAA 2JX2A 1QDUB 5A76A 1V5IB 4UY8T 4NLPA 3M9NB 4LF6J 4IDKB 2C3YA 2RHQB 3MM5A 4USVA 2CIMA 1KOOA 1E6YB 4DUZJ 2YNFB 2HRTA 2XCAA 2KVIA 3PTWA 3CTRA 1XN9A 1R0BG 2OPQA 3DLHA 4OZLA 3VWSA 2OP5A 1GEHA 2W24A 2DXEA 1VQOS 2HWTA 2BX6A 3Q22A 1WTFA 1IBMJ 1FDDA 2NREA 2OEMA 5FLXU 4WU3A 1B64A 1PC4A 3QZ7A 2OIHA 1UEUA 4R5PB 3L95X 2OPPA 2POKA 3OD2A 1A0OB 2WOMB 5GADI 2IDEA 1RAEB 4XDCA 2J6UA 3N28A 1EQMA 3RBXA 1OMSA 4USKA 2MY7A 2YKAA 2Z56B 3O2IA 4ID5A 4DLEA 4TU8A 3AH6A 3BR9A 3AODA 5ETSA 4U67Q 2HAFA 3ILJA 2YPYA 2VBZA 3W64A 3CF5Q 1C1BB 5KFJA 3L7UA 4DV7J 4O23A 4LF4F 4C97A 4HH1A 5HK4A 5IC4B 2FHJD 4M8LA 1N0VC 4A8MP 5MLCV 3M30A 4JI3J 1U0HA 4Y28C 3I87A 2CQ4A 3LTOA 2H5IB 3N6NA 2LA4A 3QAUA 2LQ9A 2HHHF 2J0QD 1RDRA 2WSFC 4RW9B 1VMBA 3WC0A 3NNAA 2GGPB 1HYSB 5HQMA 3FFIB 3O8WA 4QPTA 2R8GA 5A0YA 4WU2A 2X51A 3EGZA 1JLFA 2W9CB 2X1GA 2GVDA 5CD4H 1UZHA 4HYKA 3RRKA 3NWRA 2WB4A 2AV5A 2MJUA 5BXIA 5HL7Q 3GIJA 3SIPB 2EKNA 2KRBA 4ZITA 3MF5A 2I0XA 3DN9A 5DJBA 2GQQA 2RJZA 1NDPA 1NMEB 4KSEB 3W8GA 2K1RB 1WC6A 1FFGB 3ENAA 5KT3A 2OI2A 2VASA 2CVIA 1D8ZA 3PO4A 4JI7F 2CJBA 3ZO7A 4F3MA 4WP9A 4NE9C 1FKOB 5DZ7A 5DQHA 2EWHA 3HVTA 3W62A 4DPOA 4ZPVR 2HS3A 3KWMA 3ZTQA 2W2NP 2FHJA 4ZJOA 4YQWA 1KNZA 4U8YA 1U1LA 4DDFA 2DGSA 3MCMA 2IIHA 2P2CB 5CA5A 1RBLA 1HL6A 3QQCD 4DR5F 4NLVA 2BKPA 2IAJA 2J0WA 3I6PA 3U1MA 1JLAB 4UOGA 2PA8D 1BGXT 2MLXA 2CQPA 2E7VA 4KIAA 3GYNA 4AL6A 3W7BA 4J9VA 1YBAA 1JLEA 3FJ2A 5K14B 3OJSA 4EEYA 2PE8A 3G6YA 2CADA 1A9NB 2YQ0A 2QSFA 3CIMA 2LFVA 2ACYA 5ETLA 2AEJA 1T9UA 3CMQA 4UW2A 3B78A 2UXDJ 2M52A 2F65A 5J2PA 3F73A 3V81B 1S72S 5H9FK 2D3O1 3MAAB 5CQGA 5AJ3J 3PX6A 3MXHP 5C5JA 2FJVA 3THPA 1TK5A 3HHKA 5ETNA 1OY8A 2V8DA 4NLWA 3VQTA 3TEHB 2AZ1A 4ECYA 1TL5A 4TXSA 4DPUA 4AQYJ 5D6GA 2IJNA 1EQ0A 3FQLA 3R9LA 2GVZA 2W1BA 4IFVB 1PCAA 2BOAA 1ZOTA 3SSRA 1Q95G 2UU9J 1QUPA 2V69A 5KG2A 3PZPA 3KMQA 3T1HJ 2YNGA 3MFIA 1T0TV 4OJHA 2PC6A 3KG4A 2R7OA 4Z2XA 1YKWA 5GADU 4OL8A 2WVDA 4C3LA 5T7LB 2M4MA 1OWXA 1QAXA 3KLVA 1Q5YA 3QWPA 4KGKA 2G2YA 4DF4A 1FNOA 4JV2A 3D1HA 1NK6A 4DR4F 3LAKA 2B8QA 4EGLA 2WAQD 3OBIA 1SJ3P 4PG8A 3ETMA 2BJ7A 2R8JA 4URSA 4F0MA 3FQKA 3CJ4A 2H65B 5HBMB 2IA0A 3GSIA 3UDCA 5DLFA 1PYOB 3AD8C 2F8HA 1S97A 1XNRJ 5HVGA 2N3OA 1RWWB 4J5OA 2G4BA 1HWUA 3KK3B 3GJTB 3EUNA 2RQ4A 3LGHA 1CQMA 4KKOA 3VR1A 1VLOA 1TKZB 5CXTA 3BSCA 4DV5J 1RAJA 2E9ZA 4LFCJ 2BRKA 2F8MA 3Q8VA 2HGMA 3NG8A 2FY1A 2FJWA 1SL0A 1KQFB 4K4TA 3ZZ0A 4PABA 3HFKA 4RW6B 2VPYB 1NEEA 2R8IA 2WRMA 3PCOB 5DQGA 1WG1A 2HWIA 3M8YA 4WBFA 2HHQA 4DQQA 4DHVA 3BM7A 4C0BA 4TKTA 1ZM4A 2PA3A 3BO2A 4GO5X 2G0JA 3HZEA 2Q3PA 3EGWB 3M8RA 2YPZA 1RHMB 3NL0A 5CH7B 4ALZA 3MDFA 2VF3A 4OX8A 3OLAA 2CFXA 5E3CA 3QBCA 4HACA 4K0KJ 2V2VA 1FX2A 1ZYQA 3UO0A 1RI7A 3FSYA 1X4EA 4NZ6A 2MKSA 1S6QB 4DPYA 3PJ9A 4ZVRB 2V94A 2VFTA 1IM6A 2OTJS 2BKOA 5IT0A 3VGUA 3OUYA 4ED8A 5L1JA 4LRFA 5IWAJ 2XCPA 1OPZA 4ECSA 2AKWB 1IN0A 3O5TB 1UWAA 4XK8C 2KB2A 1HBNB 1VFJA 1HA1A 2OJ3A 3CJRA 1DQ9A 1DQAA 2XS5A 4J9QA 3G8TA 3KLFA 3R7BB 1NJWA 3IAS9 1RK8A 1YJ7A 2G0IA 2YKPA 1VBZA 1W7WA 3SDEA 3T3FA 3GR0A 1RT4A 1VIOA 3LP1A 4WFNQ 2OHDA 1P9QC 4DG1B 2V9WA 2KM8B 3VAMA 3ELHA 4F2SA 1S77D 1NK4A 4HH0A 2DPJA 3OV7A 4DPXA 3FBBA 2OH2A 1NB2A 3CC2S 2BUNA 4JI1F 4C8OA 2W4DA 4JI0F 1HNXF 3TR5A 2D3OR 3PHEA 4OZ1A 4NOHA 2ZUGA 1SQEA 2KN4A 1KFDA 1OY6A 2LXUA 3OT9A 1RAIB 2CNKB 1SJFA 2QMWA
chains in the Genus database with same CATH topology
1NJZA 3DRYA 3I5CA 1V9OA 4PCQA 2ASJA 3CJ2A 4A4JA 3WDOA 4IRDA 1Y0HA 5JVGQ 4LSLA 1RGVA 1GH8A 4F4ZA 1H0HB 3OXLA 2JEIA 2KFZA 4IUFA 2ZJPQ 5JUMA 4DS4A 3HF5A 5G0RA 3UCZP 4BDPA 3QWUA 1WEXA 2B5JA 4ICLB 4K4YA 1YGYA 1HBMB 2BABA 2XG8A 3DU6A 1GAOA 4MIWA 5KTQA 1NHUA 1GX6A 2MZJA 3SFUA 3QO9A 4DJBA 1UL3A 4R0EA 4PG6A 1O51A 3Q8PB 2J9DA 2QIFA 3ZZRA 4ED1A 3QJPA 2OPPB 2PMZD 3MMAA 4OHWA 2W4CA 5G4DA 3DYAA 1F5CA 2IRYA 1LKZA 1FDBA 5LL6d 3K5LA 2BDPA 4HI1A 2QZ8A 4B9MA 1U2RA 1YVFA 4AXJA 5LT5A 3GZ7A 2PEHA 2OTLS 3FSXA 3IRXA 4N41A 2XMMA 5THWA 1ZM9A 3O1LA 3OVSA 2XSJA 4O44A 4O4GB 1HBUA 4EFAC 1MROB 2HHUA 2WK4A 3M6VA 1LXJA 2KT5A 1ZETA 4EO8A 4ID5B 3I0RB 4B9UA 3NNHA 1X4BA 3GYXB 3N5FA 5L9NA 4OI4A 4ELUA 4QWCA 1D3WA 5ADZA 3DRSA 3CGIA 3N4WA 4QPXA 2MSTA 1AUDA 2H9ZA 4KV8B 5KFBA 5I4MA 4Y2KA 4N8OA 3I0SA 3KTQA 4QOTA 5AE1A 1R0AA 4RU9A 1QM9A 3UD4P 1C2PA 1VBYA 2GHPA 2OSRA 4OJGA 4X4NA 4RW4A 2OD6A 1UVLA 4FF4A 1QLNA 3ENWA 5E3RA 3U7JA 3AA8A 5IWAF 4WFAQ 4WTYA 4PPDA 3N01A 4XIUA 4PXDA 5HLFA 1QE1B 1L3KA 2RDIA 5J2MB 1NK0A 2JEFA 4B02A 4J9KA 2MY8A 2VA3A 1W2IA 4MH8A 2HNDB 2XS7A 2ROGA 4NXMF 3PVXA 1SL2A 3UE2A 2LXIA 3HHEA 3QMQA 2XNQA 2CPZA 3M30B 3SFGA 4OHZA 2DNNA 1NH8A 5CYMB 3VAKA 1S6PA 3BQ1A 1B0VA 1FKPA 2JFDA 3MMCB 1T02A 4A46A 2CPJA 2BBEA 5A8WA 1SJRA 4XO0A 4QJVA 3IRWP 4KT0C 1XNQF 2RKIB 3FRZA 3G6ES 1HWKA 2LVWA 2EFNA 4DL6A 3PO5A 1PC5A 3K57A 1VQ8S 3P6YC 1ZTTA 4K4UA 4QU6A 2V9KA 3C3LA 2OPSB 4MKAA 3SYZA 2B9YA 1DJ0A 4TLRA 2AP6A 4ED0A 4MK9A 3F41A 4CZCA 5A0YB 2XI3A 1BY9A 4LIWA 1FNMA 1U6ZA 3KJVA 2BACA 4QR0A 1JLFB 3BO4A 1SI9A 4EYIB 1SB6A 5L38A 1FRHA 1LW2B 4DQSA 1IUJA 1TK0A 3HHLB 1S1TB 2MKCA 1N36F 5A6PA 1IBLF 1HNVB 4ZMMA 4USHA 2PMHA 2KTQA 2XWYA 2EPIA 2BZ2A 2N7YA 2IJFA 5HI7A 2Z2LA 3CCMS 2IM0A 1JLBB 1AFJA 4ZCLA 1IKWA 1QAYA 4EBDA 3WBZA 3C46A 2F8EX 2DBBA 1RTJA 1S1VB 4L72B 2YKNB 2DGVA 1HW9A 4HTJA 4MYTA 3OHAA 1SC6A 2P6SA 3RR7A 3J7A1 3CD6S 3PEJA 4YHHF 2FJEB 3ENVA 4X84A 4LF7F 4PXCA 4K5SA 2AJQA 4WKRA 1FDNA 5AXMA 2EK1A 2ZDOA 2VC1A 3EYZA 3RB0A 4IRCA 5D78A 3AB4B 3LP0A 4MIBA 3GE9A 3M2UA 1TKXB 1YQHA 4HKQA 2O66A 4DL4A 4WXWA 4CO5A 1Z1ZA 4MKYA 3V6DB 1H38A 2PGCA 2BRLA 4DF8A 2QLWA 4QWBA 2WONB 2DRBA 2HMIB 1KQGB 1LW0A 3DM2B 5D3GB 3JAMY 1XERA 1W25A 3PJWA 1CPZA 5KAKA 3HVTB 2AGOA 3TVZA 4B3OB 5HO4A 2M8DB 1MNEA 5KFMA 1K1SA 2EBEA 2K7JA 3HPOA 2EG2A 3POTA 3DGPA 5DG9A 3RAQA 4NLOA 3GIMA 1ZPVA 3DCAA 3DI6B 3BQ0A 4PQUA 1KLMA 3CVKA 4JI4F 1X5SA 1R8CA 1FD2A 5IT4A 4YB7A 5BYRA 1R27B 1WF0A 3M4XA 2ZH8A 1X4GA 3MTJA 4IG3A 4UOCA 5HP1A 3JSMB 1SKWA 1S76D 2HRUA 1S1WB 5KOXA 3GR1A 2LA6A 2JRSA 2Q79A 3BN7A 2MZ1A 2B7BB 4ZK7M 3TARA 1U1PA 3BJYA 3K5NA 3E01B 2QA2A 2KXHA 4HDHA 4L6V3 3PNIA 3AHPA 1NK9A 1FKAF 3K58A 2F4VF 2G0CA 1FDAA 2B9XA 3OVAA 3RR8A 1JLGB 1HQUA 2MHNA 3AJ2A 5CZVA 2FDNA 2IAJB 2LMIA 2ASDA 5GAEU 2J7KA 2YQ3A 2QV6A 5E3PA 3MM8B 4ZPAA 5D4NA 5GAGU 2YKQA 3H5UA 5EHHA 2XHWA 4RW7B 2C28A 1O5JA 2FLNA 1KVJA 2MGZA 2VG5A 2I2YA 4HVZA 1U49A 1HBOB 4XPCA 3CCES 5L1IA 3VAHA 2C3UA 2E29A 4DV3F 4I68A 2XZWA 3CJ5A 3N9UC 3KHLA 3R3TA 2Y0SD 1JLEB 3I55S 1LWEB 2DHSA 2K3KA 3DLKA 4HT7A 3QIPA 3ULHA 1OS5A 2RQCA 5LMNF 4YB6A 4USJC 3A1YG 4OV1A 3GV5B 1JB0C 2FLLA 1TVRB 2F3JA 5CCLA 1T05A 3SV3A 3HO1A 2YY3A 5H1SV 4FS1A 4RBVA 1I94F 4I6YA 4WFYA 2A2DA 3THVA 4F02A 1S48A 2HWHA 4ZP9A 3ZFVA 3CMES 1X5TA 3JTPA 4ECXA 2XMUA 3M8QB 3OR2A 4FXVA 4RX6A 1WNEA 1GTHA 1JLQB 2GJIA 2E5JA 4ZPBA 3MFHA 1NAQA 4PXBA 5J2PB 4Q45A 2O3DA 3MEGA 4LSNA 1S79A 4AL5A 1TZ0A 2YWEA 1S10A 2Z4PA 1C0UA 4O3OA 1URRA 4P2SA 3CXCR 2ADCA 1YJUA 1FO1A 1HARA 5KG6A 2DNKA 2ZZMA 2B6AA 4O3PA 4G1IA 1WG4A 2EG1A 3CCRS 2HGLA 4TLQA 5KFCA 4NA3A 3DU5A 5F0WA 5KFEA 2MQQA 5L1LA 4NMLA 5DDRC 3IGVA 4DV4F 4IG0A 3W2WA 4L3NA 2LDIA 1MMNA 5KFNA 3BZQA 4PG5A 2MKHA 2CPYA 5U47A 4LUBA 2ROEA 2ZJQQ 1E6VA 2D74B 2E1MC 3FZBA 2VL1A 2OPRA 2Q66A 3CEDA 1U1OA 3BGRA 2DT9A 4EU0A 4O0IA 1RWUA 2PSZA 1U1KA 4ZP8A 1AROP 2J76E 2AX0A 3D1QA 3TUZC 2MQOA 4RW8B 3M32A 3MM9B 2ZJRQ 3GSDA 4WE1A 2MSSA 4ZHRB 2PIIA 4NCGA 4ATNA 4Y2MA 2Z0GA 1X4CA 3AY0A 4DFJA 1U48A 2KU7A 1ULRA 1TFYA 1S0OA 1N48A 1IM4A 4FS2A 2XMWA 4IOCQ 2AF6A 1KRPA 3GQCA 3PACA 3QLHA 2ZHBA 2HVHA 3NBPB 3MR5A 1A7GE 1BWEA 3QAEA 3R27A 2JWNA 3HDSA 3FMBA 4B3TF 1N52B 4D3GA 3CO9A 1ZBTA 3M2RA 2C2DA 2EFPA 3M6UA 3FMWA 4QQBA 4WK1A 2XY6A 2FGCA 2AX1A 2EW9A 2CQ3A 2YNGB 3NCRA 3NGKA 1S9FA 3S8SA 4XPEA 5B0AA 1QUVA 3QJJA 2CG4A 3HXMA 1R7IA 4QIEA 4ED7A 4UY85 1RA7A 1MU2A 1P1TA 5DG7A 2VZ9A 1Z4UA 3EGNA 4IQMA 2RF2A 2ZOGA 2A18A 2B4UA 2KO1A 4JI5F 4ES2A 4X66F 4RNOA 2I1RA 2Q6BA 2HAIA 5I3PA 2D3UA 2G13A 4M63A 1ZAWA 1Y3JA 3CD7A 2V4JB 3NRBA 1YJNS 1GXTA 3WX4A 5ITHA 2R8HA 1NRKA 4TYBA 2DNGA 4IOAQ 1SJ4P 3DHWC 4IOBA 3G71S 1TAQA 1TAUA 4C11A 4PWUA 2V8GA 1Q53A 4X65F 3MUVP 4DQPA 3JSYA