1B7HA

Oligo-peptide binding protein complexed with lysyl-norleucyl-lysine
Total Genus 184
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
184
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGO-PEPTIDE BINDING PROTEIN
publication title Relating structure to thermodynamics: the crystal structures and binding affinity of eight OppA-peptide complexes.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 184
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1998-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b7hA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b7hA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b7hA02
3R6UA 2Z8FA 3W15C 1Y3NA 1DTGA 1MG1A 2OWTA 3OO6A 2F78A 5DVJA 3HPIA 1NNFA 4TLLB 4FJPA 4EQ7A 2ZNTA 1QKAA 4FAJA 1JEVA 3PU5A 1LLSA 4JDFA 1QULA 3UN6A 3RYBA 1MXWA 3IOTA 5JTYA 4EQ9A 5LOMA 4BLAA 1B3EA 1FTOA 4ND9A 2F7BA 2ZYMA 3KN7A 3LR1A 1LSTA 3O2AA 3VE1B 3TKDA 3TYHA 1RYXA 2H5YA 3CR9A 3CSGA 3KG2A 4EUOA 1URDA 1RKMA 3CG3A 3IB2A 4YMBA 1Y4CA 3DRHA 3SEWA 3SDFA 2HFBA 3V89B 1MDP1 3MP8A 3TEPA 3SEYA 2DVCA 3S2VA 2ABHA 4U4XA 2DSFA 3U94A 2XXXA 4MF3A 4C1TA 3C36A 1LGBC 1SI0A 3QUFA 4I8CA 3CI8A 1GR2A 2H9BA 3DP4A 3FGSA 2YJPA 4OESA 4ONYA 4MH5A 3U8QA 3MZ1A 4WKMA 3HHGA 4U2RA 4QFKA 1PBQA 2I6EA 3TELA 4DXBA 1SYHA 3RTFB 1GGGA 4OEVA 2NUVA 1US5A 3FJ7A 5H8QB 3RY3A 3RT8A 5EYFA 1JVYA 5AA4A 3G3JA 3TAJA 5AA3A 3B6TA 1I6BA 5EHSA 3H6UA 4KYEA 3VXCA 5AA2D 2GHAA 4JXIA 4Q30B 4JB7A 3LVUA 4BDOA 2B3FA 2HZKA 5CMBA 3N5LA 3FUZA 3SESA 1IXGA 2V3UA 4FATA 5H8FB 2DYXA 2UVJA 2O84X 3SEXA 4M4GA 2DQVA 4DXUA 1YCJA 3IOUA 4ZECA 3K6WA 4IGRA 1MQJA 5ICQA 1UIVA 1P1QA 2RCBA 2Y7WA 2O6AA 4ZZEA 3K1MA 3MP6A 1B5JA 4L17A 5H8QA 1MY4A 1FTJA 1N76A 3RPWA 2I58A 1PBPA 1POTA 1S9TA 1PDAA 2V93A 4IY6A 3DRJA 3O97A 5CRYA 1OQHA 4H1XA 1Q35A 3SKPA 4OWDA 1MH3A 3B6QA 4N07A 3CSBA 4RY1A 2HAVA 3PPQA 1JNFA 4ISUA 1S7YA 3CIJA 1TFDA 4RPOA 4WXJA 1US4A 3O6HA 1FTKA 1YPNA 5H8FA 1EZ9A 4PFYA 3KBRA 1AH5A 3KEIA 3FIRA 4O3CA 3BFUA 3JZJA 1JVXA 4R2BA 3D4GA 4E0WA 3PAMA 1A55A 1PEBA 1SVXB 4G77A 1A54A 5HBCA 4JBZA 5CMMA 3SEUA 3O6GA 1ATGA 3PMXA 4YZZA 4RJZA 3LBSA 2WOPA 2I49A 4X48A 4GF8A 4E0XA 2I0BA 1P1NA 1SW1A 2XX7A 4U1ZA 2UXAA 4DE8A 4YAHX 1R6ZA 1P99A 3MZ9A 3M3FA 4RYAA 3K6VA 4X1DA 3G3GA 3OEMA 4MBPA 3VVDA 1FTMA 5CC2A 3DLNA 4U22A 1I69A 1RYOA 1MXVA 3U92A 4KFQA 1SD3A 2QS1A 4F1YA 3T9UA 3FV1A 3MVXA 1O7TA 1NNKA 2DE3A 4BDLA 1XVXA 1LB9A 1SYIA 3S4UA 2R9JA 3FXRA 5CMKA 3E4RA 4ZEDA 3C31A 1B3FA 3O29A 4JWYA 2VHAA 3LSFB 4ZE9A 4YU0A 1GTKA 4Q0CA 4G8HA 2XXWA 3DM0A 1ZU0A 4LQ2A 4MFIA 1MDQA 3TCGA 4GL0A 1ZMGA 4RA1A 4PFTA 2H4IA 3FASA 3IO4A 3O9PA 1MQDA 1EH3A 2XD3A 3TZAA 3HCQA 4R6YA 1OVBA 2ONRA 3IO6A 4QFNA 3GZGA 3FXUA 3CFLA 4DCYA 2OLBA 4R6KA 2HEUA 2DS9A 3N6UA 2XXHA 3CHGA 1POY1 3RT6B 2YPNA 4NMYA 5AE4A 4G8NA 1VE4A 2O69A 5H8HB 2UYFA 3Q28A 3LSWA 3OMBA 3PMVA 3USDA 1B1HA 1DSNA 4P0IA 1D9VA 1FW0A 3H6WA 3OOAA 5DEXA 4BDNA 1AMFA 1M5EA 1MM6A 2M8CA 3IJXB 3UIFA 3KSJA 1B05A 3S9NC 4TLMB 3FVNA 3D4CA 3PUYE 3V83A 1BIYA 5TP9B 4FEDA 2GFEA 2O68A 2REGA 4XKNA 3VXBA 3QIMA 5ELVA 2P1SA 1I6QA 3OO9A 4DDDA 2VP1A 4X1BA 1MM7A 3IR1A 5M2VA 4ZZAA 2NWJA 5J1DA 2I4BA 1LBBA 1L5TA 3RNNA 3K1PA 3K1NA 3FZVA 1LFHA 5B7DA 1MY1A 2F7CA 4IY5A 2I0CA 1URSA 4R6HA 2Q89A 2VD3A 1S50A 2ONKE 3MC2A 4AQ4A 4ESXA 4G8MA 5H8NB 2P2AA 4YKKA 3M8UA 4O3AA 4IO5A 4OEUA 4F39A 4LVQA 3TCFA 4DZ1A 2NVUB 3T66A 4OMBA 3U93A 5A5XB 4OHNA 3G7WA 3MP1A 5TP9A 2KLFA 4F1VA 1M5FA 1MPCA 3A3UA 3TMGA 2FYIA 4EXKA 4F18A 2PBWA 2ZNUA 3ECRA 3B7DA 4H67A 2X7PA 3FATA 4IO7A 4XXUA 1M5BA 3N6TA 1QJMA 2QPQA 4YICA 1TXFA 5ITOA 4ECFA 4H65A 4F22A 1B6HA 3ILUB 2Q88A 1MXYA 3VDFA 4EF2A 4YB6A 4IO2A 5H8NA 5L9OA 2R6GE 1XS5A 1JETA 1FQAA 5IKBA 4GFRA 3PUXE 2W7YA 1JQFA 2Y7RA 3L6HA 1DPPA 3KN3A 2QMWA 4KR5A 2AIXA 5A5XA 1R1NA 5KCJB 2OZZA 1H44A 2AL5A 3GXAA 1USYH 1BLFA 4RK9A 1B3HA 5TU0A 2CMOA 1YAEA 2PX1A 2B65A 3K01A 3OD7A 3RGYA 1SW2A 5JK4A 3VVFA 2O1LA 4THIA 4NF5B 2QS3A 4KCDA 3IJOB 5DTBA 2ZNSA 1H43A 1B52A 3G3FA 3MVYA 1I6AA 5I56B 4TOZA 1AOVA 1OQGA 1B5HA 3KN8A 1SBPA 3PPNA 4DLDA 3PMWA 4F2OA 5EHMA 3U72A 3HV1A 3Q26A 4NWDA 5KCJA 3TODA 2I3WA 2XX8A 2Q8JA 3MBPA 4LUBA 3FD3A 2PMSA 3VLVA 3PUWE 1NNPA 3PUZE 1ZTYA 2F6PA 3QXMA 3P7IA 3MVWA 2PT2A 3K2DA 1BKAA 4U23A 3W9VA 2ESNA 2RF1A 4NF5A 1FTLA 5I56A 2XD2A 5F1QA 2ZYNA 3FJMA 1MY0A 3OEKA 3O6PA 1URGA 2I48A 3PGFA 3E9XA 1B7ZA 4U4SA 3VVEA 1SW5A 1PC3A 3H3GA 4P11A 3H4ZA 3IX1A 2E0SA 4BDMA 1Y20A 1UIUA 1ZKBA 4Z0IA 1XT8A 1FQFA 3R26A 1MY3A 3OSRA 4GOTA 2XXYA 1HSLA 1A99A 2D5WA 1N7WA 4H6DA 1UTBB 1B58A 1LBCA 5I2NB 4OQOA 1QVSA 3IB1A 5FTHA 4RK2A 4QSEA 3IORA 1FQBA 4PQJA 1VR5A 4PFUA 1JW4A 3EPEA 4OFLA 3KOTA 2OJTA 5ISUA 2Z23A 2F5XA 3QAXA 1O64A 2QL3A 5DYHA 2RC9A 3K02A 4LZ8A 2RINA 1MS7A 1VSOA 3TDJA 5L9SA 5JEIA 2A5TB 1JW5A 3MAMA 2THIA 4LZ7A 4IGTA 1B4HA 1MXZA 1XHYA 5DVIA 2F35A 4PETA 4LP2B 4RXLA 3RN8A 1P1OA 1PB9A 4RNSA 5L9MA 2IEEA 3KSXA 1B32A 3LUYA 2H99A 3S9MC 3DRFA 1BP5A 1OLCA 5I2NA 1LAHE 1DPEA 3TTRA 3V8XB 2RC7A 3O6IA 1Y3QA 5B70A 3PD8A 1WVJA 1H45A 4NF8B 4LATA 1A8EA 2BJJX 4R72A 3MW0A 4KD5A 4OENA 4OXVA 1IIWA 3RLFE 3U1OA 3TUSA 3N26A 2DXYA 1Y9UA 2A5TA 4C0RA 4HTGA 2YLNA 4GLIA 3TTMA 4DXCA 2P0SA 3ILTB 4GWOA 1OVTA 2ALUA 2QSXA 2PT1A 2AL4A 2DWJA 4GVOA 1SDXA 2IA4A 1TT1A 3DRGA 4UA8A 1R9LA 1P1UA 3SEVA 2GHBA 1MQHA 1IZ1A 1LFIA 2XXQA 2DWAA 1ZBMA 5HPQA 2LAOA 3K4UA 4OVJA 5TPAB 1EZOA 1SI1A 3A09A 3EN3A 4KQPA 2RC8A 2H25A 2RKMA 1A40A 3V5AA 4XKRA 1MQGA 3OELA 4HCWA 4OERA 1D4NA 2CZLA 4O3BA 5CMCA 2HQ0A 5FTIA 1VFDA 2O51A 3FVKA 3BKIB 3E13X 2V84A 3G3HA 1DTZA 1VFEA 3TTLA 2UVGA 4LQ5A 4JWXA 1AL3A 1ZLQA 3KOSA 4GL8A 2R71A 2ZXTA 5TPAA 1NKXA 1HSEA 1NH7A 3OO7A 1EU8A 2HAUA 3TQLA 4I62A 2DWIA 4KI0E 4N6PA 4YKIA 3I5OA 4WEDA 1FCKA 4F1UA 1ANFA 5H8HA 3VV5A 1FQCA 3ZSFA 1LCFA 5CM6A 4YKJA 2VD2A 3K6XA 3F11A 2UVIA 3OO8A 2VGQA 4FORA 4GD5A 1B3LA 1IUDA 1Y1ZA 1PB7A 2X7QA 4OYVA 4R2FA 4AB5A 3M3LA 2OBGA 1II5A 1QUKA 4ZEFA 2XXPA 3ODBA 4NEDA 1QKBA 3FJGA 3K00A 2DP8A 2HCAA 4POXA 3IOWA 4NF4B 2DE4A 3T9VA 4GIZA 3Q27A 4LONB 5AA2B 4ZE8A 1T0KA 3MZBA 4I1DA 3TTKA 4EF1A 1IQ7A 1IXHA 2H98A 4GXAA 3GLBA 5K2YA 4ELQA 1J1NA 1TWYA 3W9WA 3N94A 1CB6A 3PUVE 1Y1MA 4G68B 3KZGA 4R9FA 1F9BA 1IXIA 3GBAA 1UQWA 1DMBA 4NF6B 4EXLA 4QSDA 4PP0A 2XXVA 3MPKA 2Q2CA 4F31B 3T96B 3DELB 2A5SA 3HN0A 3HHFA 2XX9A 1YTVA 1SQYA 3IOVA 4NWCA 2QS4A 1Z7ME 4I9DA 4ELRA 3I6VA 3MVZA 1B46A 2WKYA 4NF4A 1FQEA 3VLWA 1B2HA 3FVGA 2XXTA 5AA2A 2V25A 2XXRA 3MJNA 3O28A 4YB5A 1AIVA 2HXWA 1XVYA 2ONSA 4F29A 2REJA 2D3IA 4F3PA 4POWA 2Q9TA 1B7UA 1MXUA 4C1UA 4IO4A 2DVZA 4G68C 3PPRA 4G68A 5AA1A 2NXOA 1LAXA 4H0WA 5BUUA 4YB7A 5I84A 3GBBA 1NL5A 1ZIUA 4NF6A 5AA4B 3SERA 1Z7NE 1A8FA 4F3SA 3OXNA 1SW4A 2QS2A 4WEPA 1GV8A 2Z22A 1IITA 4F3BA 3TCHA 4OZ9A 1QW0A 2AYSA 3ZKLA 2PVUA 3DRIA 2WOKA 4XKPA 1B5IA 4JSDA 4H5FA 1XOCA 3LSLA 4HCYA 1H3DA 1LCTA 3T9HB 3EHSA 4QRZA 5ICTA 4FE8A 1XC1A 2QJEA 3RQTA 2V3TA 3IL1B 2Y7IA 4RPNA 1B0HA 3DRKA 3FTOA 1OIBA 2O1MA 4LA9A 4QFLA 4KHZE 3OSQA 1UTHB 5KDTB 4QSCA 1O63A 1MH4A 1CE2A 2V3QA 3SETA 4QFOA 3IB0A 4KPTA 5L8DA 5CBSA 4EDPA 1NNTA 4ESWA 2F34A 2B4MA 3PV0E 2I4CA 3PPPA 1HSJA 4GQOA 3L6GA 4IB2A 4K3FA 4YKPA 3RYAA 4X9TA 4N13A 3VFJA 2O7UA 2VOZA 2Z8EA 3VLUA 4OETA 5DVFA 4ZEKA 5FHOA 1JEUA 3QUJA 2OK2A 4Q5TA 3FVOA 4UACA 1N0TA 3Q25A 2B4LA 4IO3A 3MQ9A 1Y4TA 1NFTA 2Y84A 3A3CA 4M1VA 1N84A 3TPAA 1B0LA 2DXRA 4OFOA 1UTHA 4QHQA 3H03A 3I3VA 5KDTA 3C9HA 4OFJA 3DP8A 2DWHA 2FA7A 1M5DA 2F97A 3EHUA 2ZYKA 1LAFE 3G3KA 3JV9A 2NOOA 2O7IA 3H06B 2I3VA 3QK6A 4PFWA 5HM4B 4BDRA 5KZTA 4P0GA 1QUJA 1B51A 2Y7KA 3T22A 3C4MA 3UK4A 2F36A 2PYYA 4F3GA 2QRYA 3E3KA 5H8SA 3ONMA 1MQIA 4ZDMA 2B3BA 3ZKKA 3PPOA 1QUIA 1ELJA 2HZLA 4YMAA 3EHTA 4G2ZA 1UTBA 3RTWB 3MWBA 3FV2A 3QYTA 3LSXA 1N04A 3RUMA 4IO6A 5K2XA 2GH9A 2XXIA 3PD9A 1N3WA 2UVHA 4R73A 1MXXA 4R9GA 5I58B 1M5CA 3WAEA 2Z8DA 3H6TA 4FEBA 1LB8A 5I59B 4AB6A 1R9QA 2DOJA 2ZYOA 3S9LC 3JYRA 4MLVA 3KJTA 3H6VA 2G29A 4JSOA 3OENA 3B6WA 4LZ5A 1WDNA 2GRVA 1PB8A 2F8DA 4HS7A 1MPBA 1GVCA 3S9EA 3KFMA 3BBRA 2ANJA 4NE4A 4XIGQ 2XHDA 1N7XA 4FECA 1D3KA 3K0VA 5DT6A 2F7AA 1P1WA 3CG1A 2RCAA 1DOTA 2ZMBA 5DEXB 3CVGA 4R75A 1Y3PA 2DE2A 3AXFA 4NF8A 5I58A 1A7LA 1B4ZA 5I59A 4F19A 2E1SA 4HW8A 3C33A 4G4PA 5ITPA 2FNCA 3UORA 4NTLA 4XKQA 1MRPA 4F2QA 1MPDA 4EQBA 3O66A 4ELPA 1LAGE 3UGWA 3LC8A 2Q2AA 1TFAA 3ZS6A 4U1OA 1B3GA 3EF7A 3IK6B 3QSLA 3IAZA 4Z7EA 3DP6A 4QFPA 3TFLA 3KJ7A 4QF9A 3CFZA 1B9JA 4ZEIA 1JW1A 1OMPA 3M3KA 1Q1KA 4Q8RA 1B40A 4U21A 3CFXA 3HSTA 4TQUQ 1KWHA 4KYDA 3C35A 1NH8A 4OTEA 3BFTA 2OWSA 3C34A 1B1XA 4H8IA 2QMXA 4ZEBA 1BTJA 4KCCA 3Q29A 4XTCQ 3UA8A 1LFGA 5I2KB 3T93B 4BDQA 4DCXA 1N3XA 1IEJA 4MLQA 3FXQA 3CRBA 5I57B 3K6UA 2G93A 2OCUA 2F6GA 1D9YA 5CBRA 4KYSA 4ZS9A 4PE5B 5F7VA 4GRKA 4JWOA 3MPLA 1WODA 1B7HA 1NMUA 5JTYB 5CI5A 1FQDA 1OLAA 3C32A 1USYE 3UP9A 2UYEA 3TQWA 3WAFA 4R74A 3MUQA 1MY2A 4FIMA 3TTNA 2WOLA 1ZJLA 4H8JA 3H7MA 3G3IA 2D21A 4H5GA 5BWJA 3R7XA 3EQ1A 2X26A 4GXSB 3THIA 4ELOA 1EZPA 5I2KA 1IXCA 3KGCA 3HO7A 3T9XB 1H76A 2XXUA 5FHMA 5I57A 2Y7PA 4DIGA 5IAIA 5FHNA
chains in the Genus database with same CATH superfamily
3R6UA 2Z8FA 3W15C 4JVDA 4GWYA 1Y3NA 1DTGA 1MG1A 2OWTA 3OO6A 2F78A 5DVJA 3HPIA 1NNFA 4TLLB 4FJPA 4EQ7A 2ZNTA 1QKAA 4FAJA 1JEVA 3PU5A 1LLSA 3MSTA 4JDFA 4GWXA 1QULA 3UN6A 3RYBA 1MXWA 3IOTA 5JTYA 4EQ9A 5LOMA 4BLAA 1B3EA 1FTOA 4ND9A 2F7BA 2ZYMA 3KN7A 3LR1A 1LSTA 3O2AA 3VE1B 3TKDA 3TYHA 1RYXA 2H5YA 4HE0A 3CR9A 3CSGA 2MKZA 4NN3A 3KG2A 4EUOA 1URDA 1RKMA 5I7IA 1FSAA 3CG3A 3IB2A 4YMBA 1Y4CA 3RPLB 4PAFA 3DRHA 3SEWA 3SDFA 1SPIA 2HFBA 3V89B 1MDP1 3QMFA 3MP8A 2QVRA 4N6KA 3TEPA 2PCRA 3SEYA 2DVCA 3S2VA 4O8MA 2ABHA 4U4XA 2DSFA 3U94A 2XXXA 4MF3A 4C1TA 3C36A 1LGBC 1SI0A 3QUFA 4I8CA 3CI8A 1GR2A 2H9BA 3DP4A 3FGSA 2YJPA 4OESA 4XFEA 4ONYA 4MH5A 5LTCA 3U8QA 3MZ1A 4WKMA 2CZKA 3HHGA 4U2RA 4QFKA 1PBQA 2I6EA 3TELA 4DXBA 1SYHA 3RTFB 1GGGA 4OEVA 3RPLA 5EYHA 2NUVA 1US5A 2F3BA 1NV5A 3FJ7A 5H8QB 3RY3A 3RT8A 1NV1A 5EYFA 1JVYA 5AA4A 3G3JA 3TAJA 5EQAA 5AA3A 3B6TA 1I6BA 1LBZA 4NG7A 5EHSA 3H6UA 4KYEA 3VXCA 5AA2D 1YZ0A 2GHAA 4JXIA 4Q30B 4JB7A 3LVUA 4BDOA 2B3FA 2HZKA 5CMBA 3N5LA 3FUZA 1Q9DA 3SESA 2R8TA 1IXGA 2V3UA 3LV0A 4GWSA 5H8FB 2DYXA 4OVTA 4FATA 4GWUA 2UVJA 2O84X 3SEXA 4M4GA 2WYKA 2DQVA 4DXUA 4GWZA 1YCJA 4N8GA 3IOUA 4ZECA 3K6WA 4IGRA 5DW8A 1QGXA 3FXBA 1MQJA 3BIGA 5ICQA 1UIVA 1P1QA 2RCBA 2Y7WA 2O6AA 5IZ1A 4MMPA 4ZZEA 3K1MA 5ESYA 3MP6A 1B5JA 4L17A 5H8QA 1MY4A 1NUXA 1FTJA 1N76A 3RPWA 2I58A 1FBCA 1PBPA 1POTA 1S9TA 1PDAA 2V93A 4IY6A 3DRJA 3O97A 5CRYA 1OQHA 4H1XA 1Q35A 1KZ8A 3SKPA 4OWDA 1MH3A 3B6QA 4MAGA 2P3VA 4N07A 4GX6A 3CSBA 4RY1A 2HAVA 3PPQA 1JNFA 4ISUA 1S7YA 3CIJA 1TFDA 4RPOA 4WXJA 1US4A 3O6HA 4P1EA 1FTKA 1YPNA 5H8FA 1EZ9A 4PFYA 3KBRA 1AH5A 3KEIA 2XWVA 3FIRA 4O3CA 1IMDA 3BFUA 3JZJA 3SZPA 1JVXA 4R2BA 3D4GA 4E0WA 3PAMA 4P8BA 1A55A 1PEBA 5ET5A 2KR0A 1SVXB 4G77A 1A54A 5HBCA 4JBZA 5CMMA 3SEUA 3O6GA 1ATGA 3PMXA 4YZZA 4RJZA 3LBSA 4PE3A 2WOPA 2I49A 4X48A 4GF8A 1FPFA 4E0XA 2I0BA 1P1NA 1SW1A 2XX7A 4O94A 4U1ZA 2UXAA 4DE8A 4YAHX 1R6ZA 4PGPA 1P99A 3MZ9A 3M3FA 4RYAA 3K6VA 3G3GA 3OEMA 4X1DA 4MBPA 3VVDA 1FTMA 5CC2A 3DLNA 4U22A 1I69A 1RYOA 1MXVA 3U92A 4KFQA 1SD3A 2QS1A 4F1YA 2XXKA 3T9UA 3FV1A 3MVXA 1O7TA 1NNKA 2DE3A 4BDLA 1XVXA 1LB9A 5ET7A 1SYIA 2DDKA 3S4UA 2R9JA 3T0JA 3FXRA 5CMKA 1EYIA 3E4RA 4ZEDA 1FRPA 3C31A 1B3FA 3O29A 4JWYA 2VHAA 3LSFB 4ZE9A 4YU0A 1GTKA 4O7IA 4Q0CA 2WYPA 4G8HA 2XXWA 5IZZA 3DM0A 1ZU0A 4LQ2A 4MFIA 5EQ7A 1MDQA 3TCGA 4GL0A 1ZMGA 4RA1A 4PFTA 2H4IA 1FPEA 3D1RA 3FASA 3IO4A 3O9PA 2CEXA 1MQDA 1EH3A 2XD3A 3TZAA 3HCQA 4R6YA 1OVBA 2ONRA 3IO6A 4QFNA 2XWKA 4PAIA 3GZGA 3MYUA 3FXUA 3CFLA 3KC1A 4DCYA 2OLBA 4R6KA 2HEUA 2DS9A 3N6UA 2XXHA 3CHGA 1POY1 4O7MA 3RT6B 2YPNA 4NMYA 5AE4A 4G8NA 1VE4A 2O69A 5H8HB 5I3SA 2UYFA 3Q28A 2Y5LA 3LSWA 4N8YA 3OMBA 3PMVA 3USDA 1B1HA 4GX4A 1DSNA 4GX3A 4P0IA 1D9VA 1FW0A 3BIHA 3H6WA 3OOAA 5DEXA 4BDNA 1AMFA 1M5EA 1MM6A 2M8CA 3IJXB 3UIFA 2OX3A 3KSJA 1B05A 3S9NC 4TLMB 3FVNA 3D4CA 3PUYE 3V83A 1BIYA 4PCDA 5TP9B 4FEDA 4HE2A 2GFEA 2O68A 2REGA 2WEFA 2XA5A 2HPGA 4XKNA 2ZZWA 3VXBA 4N15A 3QIMA 5ELVA 2P1SA 1I6QA 3OO9A 4DDDA 2VP1A 4X1BA 1MM7A 3IR1A 5M2VA 4ZZAA 2NWJA 1FPBA 5J1DA 2I4BA 1LBBA 1L5TA 3RNNA 3K1PA 3K1NA 3FZVA 1LFHA 5B7DA 1MY1A 2F7CA 4IY5A 2I0CA 1URSA 4R6HA 2Q89A 2VD3A 1S50A 2ONKE 3MC2A 4AQ4A 4ESXA 4G8MA 5H8NB 2P2AA 4YKKA 4I3YA 4MHFA 3M8UA 4O3AA 4IO5A 4OEUA 4MCOA 4F39A 4LVQA 3TCFA 4DZ1A 2NVUB 3T66A 4OMBA 3U93A 5A5XB 4OHNA 3G7WA 3MP1A 5TP9A 2KLFA 4F1VA 1M5FA 4GWWA 1MPCA 3A3UA 3TMGA 2FYIA 4EXKA 1FPIA 2BJIA 4F18A 2PBWA 2ZNUA 3ECRA 3B7DA 4H67A 4OVSA 1DCUA 2VT5A 2X7PA 3FATA 4IO7A 4XXUA 4PDHA 1M5BA 3N6TA 5IM2A 2GQ1A 1QJMA 2QPQA 4YICA 1TXFA 3A29A 5ITOA 1FTAA 4I3EA 4ECFA 4H65A 4F22A 1B6HA 4XEQA 1BK4A 3ILUB 2Q88A 1MXYA 3VDFA 4EF2A 4YB6A 4IO2A 5H8NA 5L9OA 2R6GE 1XS5A 1IMAA 1JETA 1FQAA 5IKBA 4GFRA 3PUXE 2W7YA 1JQFA 2Y7RA 3L6HA 1DPPA 3KN3A 2QMWA 4KR5A 2AIXA 5A5XA 1R1NA 5KCJB 2OZZA 1H44A 2AL5A 2FVZA 3GXAA 4OVRA 2PFYA 1USYH 1BLFA 4RK9A 1B3HA 5TU0A 2CMOA 1YAEA 2PX1A 2FIEA 2B65A 1LBWA 3K01A 5ET6A 3OD7A 3RGYA 1SW2A 5JK4A 4MJOA 3VVFA 2O1LA 4THIA 1NV3A 4NF5B 2QS3A 4KCDA 3IJOB 5DTBA 2ZNSA 1H43A 1B52A 3G3FA 3MVYA 1I6AA 5I56B 4TOZA 1AOVA 1OQGA 1B5HA 3KN8A 1SBPA 3PPNA 1IMFA 4N6DA 4DLDA 3PMWA 4F2OA 5EHMA 3U72A 2QFLA 3HV1A 3Q26A 4NWDA 5KCJA 3TODA 2I3WA 2XX8A 3B50A 2Q8JA 3MBPA 4LUBA 1FBGA 3FD3A 2PMSA 4HXVA 3VLVA 4H46A 3PUWE 1NNPA 3PUZE 1ZTYA 1NV0A 2F6PA 5IZ3B 3QXMA 3P7IA 1IMBA 3MVWA 2PT2A 3GYYA 3K2DA 1BKAA 1G0HA 4OVPA 2JJKA 4IR8A 4U23A 3W9VA 2ESNA 2RF1A 4NF5A 1FTLA 5I56A 2XD2A 5F1QA 1K9YA 2ZYNA 3FJMA 1MY0A 2WBDA 3OEKA 3O6PA 1URGA 2I48A 3PGFA 3E9XA 1B7ZA 4U4SA 3VVEA 1SW5A 1PC3A 3H3GA 4NAPA 4P11A 1CNQA 3H4ZA 3IX1A 2E0SA 4BDMA 1Y20A 1UIUA 4KXPA 2F3DA 1NV7A 1ZKBA 4N17A 4Z0IA 5ET8A 1XT8A 1FQFA 3R26A 5IZ3A 3E78A 1MY3A 3OSRA 4GOTA 2KQZA 2XXYA 1HSLA 1NUWA 1A99A 2D5WA 4NF0A 1N7WA 4H6DA 1UTBB 1B58A 1LBCA 1INPA 5I2NB 4OQOA 1QVSA 3IB1A 5FTHA 4RK2A 4QSEA 3IORA 1FQBA 4PQJA 4PC9A 1VR5A 3IFCA 4PFUA 1JW4A 3EPEA 4OFLA 3KOTA 4NQ8A 2OJTA 5ISUA 2Z23A 2F5XA 4X04A 3QAXA 1O64A 2QL3A 5DYHA 2RC9A 3K02A 1LBVA 5A5LA 4LZ8A 2RINA 1MS7A 1VSOA 3TDJA 5L9SA 5JEIA 2A5TB 1JW5A 3MAMA 2THIA 4LZ7A 4IGTA 1B4HA 2L5VA 1MXZA 4NGUA 1XHYA 5DVIA 2Y5KA 2F35A 4PETA 4LP2B 4PFBA 4RXLA 3RN8A 1P1OA 1PB9A 4RNSA 5L9MA 4PF6A 2IEEA 3KSXA 1VDWA 1B32A 3LUYA 2H99A 3S9MC 3DRFA 1BP5A 4UABA 1OLCA 5I2NA 1LAHE 1DPEA 3TTRA 3V8XB 2RC7A 3O6IA 1Y3QA 5B70A 3PD8A 1WVJA 1H45A 4NHBA 4NF8B 4LATA 1A8EA 2BJJX 1DK4A 4R72A 3MW0A 4KD5A 4OENA 4PAKA 4OXVA 1IIWA 3RLFE 3U1OA 3TUSA 1FBDA 3N26A 4PGNA 1EYKA 2DXYA 1Y9UA 2A5TA 3NOHA 4C0RA 4HTGA 2YLNA 4GLIA 3TTMA 4DXCA 2P0SA 4HE1A 3ILTB 4GWOA 4P1LA 1OVTA 2ALUA 2QSXA 2PT1A 1NUZA 2AL4A 2DWJA 4GVOA 1SDXA 1D9QA 2IA4A 1TT1A 3DRGA 4UA8A 1R9LA 1P1UA 3SEVA 2GHBA 1FJ6A 1MQHA 1IZ1A 1KA0A 1LFIA 2XXQA 2DWAA 1ZBMA 5HPQA 2LAOA 3K4UA 4OVJA 5TPAB 1EZOA 1SI1A 3A09A 3EN3A 4KQPA 2RC8A 2H25A 2RKMA 1A40A 3V5AA 3KBZA 4XKRA 1MQGA 1RDYA 3OELA 4HCWA 4OERA 1D4NA 2CZLA 4O3BA 5CMCA 2HQ0A 5FTIA 1VFDA 2O51A 3FVKA 1AWBA 3BKIB 3IFAA 3E13X 2V84A 3G3HA 4P3LA 1DTZA 1VFEA 1DBZA 1G0IA 3TTLA 2UVGA 4LQ5A 4JWXA 1FPDA 1AL3A 1ZLQA 3KOSA 4GL8A 2HHMA 2R71A 4NX1A 2ZXTA 5TPAA 1NKXA 1HSEA 4MX6A 1NH7A 3OO7A 1EU8A 2HAUA 1FBEA 3FBPA 3TQLA 4I62A 2DWIA 2FBPA 4KI0E 4N6PA 4YKIA 3I5OA 4WEDA 1FCKA 3RYDA 4F1UA 1ANFA 4PBHA 5H8HA 5EQ8A 3VV5A 1FQCA 3ZSFA 1LCFA 5CM6A 4YKJA 2VD2A 3K6XA 3F11A 2UVIA 3B8BA 3OO8A 2VGQA 4FORA 4GD5A 1B3LA 1IUDA 1Y1ZA 5F24A 3ROJA 4DI4B 1PB7A 2X7QA 4OYVA 4R2FA 4AB5A 3M3LA 2OBGA 1II5A 4OANA 4MIJA 1NUYA 1QUKA 4ZEFA 5I5PA 2XXPA 3ODBA 4PFRA 4NEDA 1QKBA 3FJGA 3K00A 2DP8A 4LN5A 2HCAA 4POXA 3IOWA 4NF4B 4QXDA 2DE4A 3T9VA 4GIZA 3Q27A 4LONB 5AA2B 4ZE8A 1T0KA 3MZBA 4I1DA 3TTKA 4EF1A 1IQ7A 5EYGA 1IXHA 2H98A 4GXAA 3GLBA 5K2YA 4ELQA 1J1NA 1TWYA 3W9WA 3N94A 4N91A 1CB6A 3PUVE 1Y1MA 4G68B 2WBBA 3KZGA 4R9FA 1F9BA 4MNPA 2QVVA 1IXIA 3GBAA 1UQWA 1DMBA 4NF6B 4EXLA 4JVCA 4QSDA 4I40A 2QVUA 4PP0A 2XXVA 3MPKA 2CEYA 2Q2CA 4F31B 3T96B 4DI3D 3DELB 2A5SA 1FPJA 3HN0A 3HHFA 2XX9A 3LUZA 1YTVA 1SQYA 3IOVA 4NWCA 2QS4A 1Z7ME 4I9DA 4MEVA 4ELRA 1NV2A 3I6VA 3MVZA 1B46A 2WKYA 4NF4A 1FQEA 3VLWA 1B2HA 1NV6A 4MNIA 3FVGA 2XXTA 5AA2A 2V25A 2XXRA 3MJNA 3O28A 4YB5A 1AIVA 2HXWA 2XWOA 1XVYA 2ONSA 4F29A 2REJA 2D3IA 4F3PA 4POWA 2Q9TA 1B7UA 1MXUA 4C1UA 4N4UA 4IO4A 2DVZA 4G68C 4H45A 3PPRA 4G68A 5AA1A 2NXOA 1LAXA 4H0WA 5BUUA 4YB7A 2ZZXA 5I84A 3GBBA 1NL5A 1ZIUA 4NF6A 5AA4B 3SERA 1Z7NE 1A8FA 4F3SA 3OXNA 1SW4A 2QS2A 4WEPA 1GV8A 2Z22A 1IITA 4F3BA 1NI9A 3TCHA 4OZ9A 2XWIA 4G61A 1QW0A 2AYSA 3ZKLA 2PVUA 3DRIA 2WOKA 2WX9A 4XKPA 1B5IA 4JSDA 4H5FA 1XOCA 3LSLA 4HCYA 4OA4A 1FPGA 1H3DA 1LCTA 3T9HB 3EHSA 4PBQA 4QRZA 5ICTA 4FE8A 1XC1A 2QJEA 3RQTA 2V3TA 3IL1B 2Y7IA 1FJ9A 4RPNA 1B0HA 3DRKA 3FTOA 1OIBA 2O1MA 4LA9A 4QFLA 4KHZE 3OSQA 1UTHB 4XF5A 5KDTB 4QSCA 1YXIA 1O63A 1MH4A 1CE2A 2V3QA 3SETA 4QFOA 3IB0A 4KPTA 5L8DA 5CBSA 4EDPA 1LEVA 1NNTA 4ESWA 2F34A 2B4MA 3PV0E 2I4CA 1LBXA 3PPPA 1HSJA 4GQOA 3L6GA 4IB2A 4K3FA 4YKPA 4FBPA 3RYAA 4X9TA 4N13A 3VFJA 2O7UA 2VOZA 2Z8EA 3VLUA 5FBPA 4OETA 5DVFA 4ZEKA 5FHOA 1JEUA 3QUJA 2OK2A 2Q8MA 1YYZA 4Q5TA 3FVOA 4UACA 1N0TA 3Q25A 2B4LA 5J16A 4IO3A 2P3NA 3MQ9A 1Y4TA 1NFTA 2Y84A 3A3CA 4M1VA 1N84A 3TPAA 1B0LA 2DXRA 4GBWA 4OFOA 1UTHA 4QHQA 3H03A 3I3VA 5KDTA 3C9HA 4OFJA 3DP8A 2DWHA 2FA7A 3HFUA 1M5DA 2F97A 3U65A 3EHUA 4X8RA 2ZYKA 1LAFE 5T3JA 3G3KA 3JV9A 2NOOA 1JP4A 2O7IA 1FBHA 3H06B 4MNCA 2I3VA 3QK6A 4PFWA 1FPKA 3PTYA 5HM4B 4BDRA 5KZTA 4AS5A 4P0GA 1QUJA 1B51A 2Y7KA 3T22A 3C4MA 3UK4A 2F36A 2PYYA 4F3GA 5EQ9A 2QRYA 3E3KA 1IMCA 5H8SA 3ONMA 4PFIA 1MQIA 4ZDMA 2B3BA 3ZKKA 3PPOA 1QUIA 1ELJA 2HZLA 4P47A 4YMAA 3EHTA 4G2ZA 1UTBA 1RDZA 3RTWB 3MWBA 2PFZA 3FV2A 3QYTA 3LSXA 1N04A 3RUMA 4IO6A 5K2XA 2GH9A 2XXIA 3PD9A 1N3WA 1FBFA 2UVHA 4R73A 1MXXA 4R9GA 5I58B 1M5CA 3WAEA 2Z8DA 3H6TA 4FEBA 1LB8A 4PTKA 5I59B 4AB6A 1R9QA 2DOJA 2ZYOA 3S9LC 3JYRA 4MLVA 1RDXA 4N81A 3KJTA 3H6VA 2G29A 4JSOA 3OENA 3B6WA 4LZ5A 1WDNA 2GRVA 1PB8A 2F8DA 4HS7A 3EKIA 1MPBA 4QBAA 1GVCA 3S9EA 3KFMA 5LDZA 3BBRA 2ANJA 4NE4A 4XIGQ 2XHDA 1N7XA 4FECA 1D3KA 3K0VA 4OVQA 3T1BA 5DT6A 1LBYA 3KC0A 2F7AA 1P1WA 3CG1A 2RCAA 1DOTA 2ZMBA 5DEXB 3CVGA 4R75A 1Y3PA 2DE2A 1KA1A 3AXFA 4NF8A 5I58A 1A7LA 1B4ZA 5I59A 4F19A 2E1SA 3E79A 4HW8A 3C33A 4G4PA 2VPOA 5ITPA 4PDDA 2FNCA 3UORA 4NTLA 4XKQA 2V4CA 1MRPA 4F2QA 1MPDA 4P56A 3O66A 4EQBA 4ELPA 2ZZVA 1LAGE 3UGWA 3LC8A 2Q2AA 1TFAA 3ZS6A 4U1OA 1B3GA 3EF7A 3IK6B 3QSLA 4AS4A 3IAZA 4Z7EA 3DP6A 4QFPA 3TFLA 2HXRA 3KJ7A 4QF9A 3CFZA 1B9JA 2CZHA 4ZEIA 1JW1A 1OMPA 3M3KA 1K9ZA 1Q1KA 4Q8RA 1B40A 4U21A 3CFXA 3HSTA 4TQUQ 1KWHA 4KYDA 3C35A 1NH8A 4OTEA 1IMEA 3BFTA 2OWSA 3C34A 1B1XA 4H8IA 2QMXA 1FPLA 4ZEBA 1BTJA 4KCCA 1NV4A 3Q29A 4XTCQ 3UA8A 1LFGA 5I2KB 3T93B 1FBPA 4BDQA 4DCXA 1N3XA 1IEJA 4MLQA 3FXQA 1XI6A 3CRBA 5I57B 3K6UA 2G93A 2FIXA 2OCUA 2F6GA 2OWZA 1D9YA 3ISPA 5CBRA 4KYSA 4ZS9A 4PE5B 5F7VA 4GRKA 4JWOA 4JVIA 3MPLA 1EYJA 1WODA 1B7HA 4PF8A 4GBVA 1NMUA 5JTYB 5CI5A 1FQDA 1OLAA 3C32A 1USYE 3UP9A 2UYEA 3TQWA 2VPNA 4P9KA 3WAFA 4R74A 3MUQA 1MY2A 4FIMA 3TTNA 2WOLA 1ZJLA 2FHYA 4H8JA 5IGAA 3H7MA 3G3IA 2D21A 4H5GA 5BWJA 3R7XA 3EQ1A 2X26A 4GXSB 3THIA 4ELOA 1EZPA 5I2KA 1IXCA 2CZIA 3KGCA 3HO7A 3T9XB 1H76A 2XXUA 5FHMA 5I57A 2Y7PA 4DIGA 5IAIA 2Q74A 5FHNA
chains in the Genus database with same CATH topology
3R6UA 2Z8FA 3W15C 1Y3NA 1DTGA 1MG1A 2OWTA 3OO6A 2F78A 5DVJA 3HPIA 1NNFA 4TLLB 4FJPA 4EQ7A 2ZNTA 1QKAA 4FAJA 1JEVA 3PU5A 1LLSA 4JDFA 1QULA 3UN6A 3RYBA 1MXWA 3IOTA 5JTYA 4EQ9A 5LOMA 4BLAA 1B3EA 1FTOA 4ND9A 2F7BA 2ZYMA 3KN7A 3LR1A 1LSTA 3O2AA 3VE1B 3TKDA 3TYHA 1RYXA 2H5YA 3CR9A 3CSGA 3KG2A 4EUOA 1URDA 1RKMA 3CG3A 3IB2A 4YMBA 1Y4CA 3DRHA 3SEWA 3SDFA 2HFBA 3V89B 1MDP1 3MP8A 3TEPA 3SEYA 2DVCA 3S2VA 2ABHA 4U4XA 2DSFA 3U94A 2XXXA 4MF3A 4C1TA 3C36A 1LGBC 1SI0A 3QUFA 4I8CA 3CI8A 1GR2A 2H9BA 3DP4A 3FGSA 2YJPA 4OESA 4ONYA 4MH5A 3U8QA 3MZ1A 4WKMA 3HHGA 4U2RA 4QFKA 1PBQA 2I6EA 3TELA 4DXBA 1SYHA 3RTFB 1GGGA 4OEVA 2NUVA 1US5A 3FJ7A 5H8QB 3RY3A 3RT8A 5EYFA 1JVYA 5AA4A 3G3JA 3TAJA 5AA3A 3B6TA 1I6BA 5EHSA 3H6UA 4KYEA 3VXCA 5AA2D 2GHAA 4JXIA 4Q30B 4JB7A 3LVUA 4BDOA 2B3FA 2HZKA 5CMBA 3N5LA 3FUZA 3SESA 1IXGA 2V3UA 4FATA 5H8FB 2DYXA 2UVJA 2O84X 3SEXA 4M4GA 2DQVA 4DXUA 1YCJA 3IOUA 4ZECA 3K6WA 4IGRA 1MQJA 5ICQA 1UIVA 1P1QA 2RCBA 2Y7WA 2O6AA 4ZZEA 3K1MA 3MP6A 1B5JA 4L17A 5H8QA 1MY4A 1FTJA 1N76A 3RPWA 2I58A 1PBPA 1POTA 1S9TA 1PDAA 2V93A 4IY6A 3DRJA 3O97A 5CRYA 1OQHA 4H1XA 1Q35A 3SKPA 4OWDA 1MH3A 3B6QA 4N07A 3CSBA 4RY1A 2HAVA 3PPQA 1JNFA 4ISUA 1S7YA 3CIJA 1TFDA 4RPOA 4WXJA 1US4A 3O6HA 1FTKA 1YPNA 5H8FA 1EZ9A 4PFYA 3KBRA 1AH5A 3KEIA 3FIRA 4O3CA 3BFUA 3JZJA 1JVXA 4R2BA 3D4GA 4E0WA 3PAMA 1A55A 1PEBA 1SVXB 4G77A 1A54A 5HBCA 4JBZA 5CMMA 3SEUA 3O6GA 1ATGA 3PMXA 4YZZA 4RJZA 3LBSA 2WOPA 2I49A 4X48A 4GF8A 4E0XA 2I0BA 1P1NA 1SW1A 2XX7A 4U1ZA 2UXAA 4DE8A 4YAHX 1R6ZA 1P99A 3MZ9A 3M3FA 4RYAA 3K6VA 4X1DA 3G3GA 3OEMA 4MBPA 3VVDA 1FTMA 5CC2A 3DLNA 4U22A 1I69A 1RYOA 1MXVA 3U92A 4KFQA 1SD3A 2QS1A 4F1YA 3T9UA 3FV1A 3MVXA 1O7TA 1NNKA 2DE3A 4BDLA 1XVXA 1LB9A 1SYIA 3S4UA 2R9JA 3FXRA 5CMKA 3E4RA 4ZEDA 3C31A 1B3FA 3O29A 4JWYA 2VHAA 3LSFB 4ZE9A 4YU0A 1GTKA 4Q0CA 4G8HA 2XXWA 3DM0A 1ZU0A 4LQ2A 4MFIA 1MDQA 3TCGA 4GL0A 1ZMGA 4RA1A 4PFTA 2H4IA 3FASA 3IO4A 3O9PA 1MQDA 1EH3A 2XD3A 3TZAA 3HCQA 4R6YA 1OVBA 2ONRA 3IO6A 4QFNA 3GZGA 3FXUA 3CFLA 4DCYA 2OLBA 4R6KA 2HEUA 2DS9A 3N6UA 2XXHA 3CHGA 1POY1 3RT6B 2YPNA 4NMYA 5AE4A 4G8NA 1VE4A 2O69A 5H8HB 2UYFA 3Q28A 3LSWA 3OMBA 3PMVA 3USDA 1B1HA 1DSNA 4P0IA 1D9VA 1FW0A 3H6WA 3OOAA 5DEXA 4BDNA 1AMFA 1M5EA 1MM6A 2M8CA 3IJXB 3UIFA 3KSJA 1B05A 3S9NC 4TLMB 3FVNA 3D4CA 3PUYE 3V83A 1BIYA 5TP9B 4FEDA 2GFEA 2O68A 2REGA 4XKNA 3VXBA 3QIMA 5ELVA 2P1SA 1I6QA 3OO9A 4DDDA 2VP1A 4X1BA 1MM7A 3IR1A 5M2VA 4ZZAA 2NWJA 5J1DA 2I4BA 1LBBA 1L5TA 3RNNA 3K1PA 3K1NA 3FZVA 1LFHA 5B7DA 1MY1A 2F7CA 4IY5A 2I0CA 1URSA 4R6HA 2Q89A 2VD3A 1S50A 2ONKE 3MC2A 4AQ4A 4ESXA 4G8MA 5H8NB 2P2AA 4YKKA 3M8UA 4O3AA 4IO5A 4OEUA 4F39A 4LVQA 3TCFA 4DZ1A 2NVUB 3T66A 4OMBA 3U93A 5A5XB 4OHNA 3G7WA 3MP1A 5TP9A 2KLFA 4F1VA 1M5FA 1MPCA 3A3UA 3TMGA 2FYIA 4EXKA 4F18A 2PBWA 2ZNUA 3ECRA 3B7DA 4H67A 2X7PA 3FATA 4IO7A 4XXUA 1M5BA 3N6TA 1QJMA 2QPQA 4YICA 1TXFA 5ITOA 4ECFA 4H65A 4F22A 1B6HA 3ILUB 2Q88A 1MXYA 3VDFA 4EF2A 4YB6A 4IO2A 5H8NA 5L9OA 2R6GE 1XS5A 1JETA 1FQAA 5IKBA 4GFRA 3PUXE 2W7YA 1JQFA 2Y7RA 3L6HA 1DPPA 3KN3A 2QMWA 4KR5A 2AIXA 5A5XA 1R1NA 5KCJB 2OZZA 1H44A 2AL5A 3GXAA 1USYH 1BLFA 4RK9A 1B3HA 5TU0A 2CMOA 1YAEA 2PX1A 2B65A 3K01A 3OD7A 3RGYA 1SW2A 5JK4A 3VVFA 2O1LA 4THIA 4NF5B 2QS3A 4KCDA 3IJOB 5DTBA 2ZNSA 1H43A 1B52A 3G3FA 3MVYA 1I6AA 5I56B 4TOZA 1AOVA 1OQGA 1B5HA 3KN8A 1SBPA 3PPNA 4DLDA 3PMWA 4F2OA 5EHMA 3U72A 3HV1A 3Q26A 4NWDA 5KCJA 3TODA 2I3WA 2XX8A 2Q8JA 3MBPA 4LUBA 3FD3A 2PMSA 3VLVA 3PUWE 1NNPA 3PUZE 1ZTYA 2F6PA 3QXMA 3P7IA 3MVWA 2PT2A 3K2DA 1BKAA 4U23A 3W9VA 2ESNA 2RF1A 4NF5A 1FTLA 5I56A 2XD2A 5F1QA 2ZYNA 3FJMA 1MY0A 3OEKA 3O6PA 1URGA 2I48A 3PGFA 3E9XA 1B7ZA 4U4SA 3VVEA 1SW5A 1PC3A 3H3GA 4P11A 3H4ZA 3IX1A 2E0SA 4BDMA 1Y20A 1UIUA 1ZKBA 4Z0IA 1XT8A 1FQFA 3R26A 1MY3A 3OSRA 4GOTA 2XXYA 1HSLA 1A99A 2D5WA 1N7WA 4H6DA 1UTBB 1B58A 1LBCA 5I2NB 4OQOA 1QVSA 3IB1A 5FTHA 4RK2A 4QSEA 3IORA 1FQBA 4PQJA 1VR5A 4PFUA 1JW4A 3EPEA 4OFLA 3KOTA 2OJTA 5ISUA 2Z23A 2F5XA 3QAXA 1O64A 2QL3A 5DYHA 2RC9A 3K02A 4LZ8A 2RINA 1MS7A 1VSOA 3TDJA 5L9SA 5JEIA 2A5TB 1JW5A 3MAMA 2THIA 4LZ7A 4IGTA 1B4HA 1MXZA 1XHYA 5DVIA 2F35A 4PETA 4LP2B 4RXLA 3RN8A 1P1OA 1PB9A 4RNSA 5L9MA 2IEEA 3KSXA 1B32A 3LUYA 2H99A 3S9MC 3DRFA 1BP5A 1OLCA 5I2NA 1LAHE 1DPEA 3TTRA 3V8XB 2RC7A 3O6IA 1Y3QA 5B70A 3PD8A 1WVJA 1H45A 4NF8B 4LATA 1A8EA 2BJJX 4R72A 3MW0A 4KD5A 4OENA 4OXVA 1IIWA 3RLFE 3U1OA 3TUSA 3N26A 2DXYA 1Y9UA 2A5TA 4C0RA 4HTGA 2YLNA 4GLIA 3TTMA 4DXCA 2P0SA 3ILTB 4GWOA 1OVTA 2ALUA 2QSXA 2PT1A 2AL4A 2DWJA 4GVOA 1SDXA 2IA4A 1TT1A 3DRGA 4UA8A 1R9LA 1P1UA 3SEVA 2GHBA 1MQHA 1IZ1A 1LFIA 2XXQA 2DWAA 1ZBMA 5HPQA 2LAOA 3K4UA 4OVJA 5TPAB 1EZOA 1SI1A 3A09A 3EN3A 4KQPA 2RC8A 2H25A 2RKMA 1A40A 3V5AA 4XKRA 1MQGA 3OELA 4HCWA 4OERA 1D4NA 2CZLA 4O3BA 5CMCA 2HQ0A 5FTIA 1VFDA 2O51A 3FVKA 3BKIB 3E13X 2V84A 3G3HA 1DTZA 1VFEA 3TTLA 2UVGA 4LQ5A 4JWXA 1AL3A 1ZLQA 3KOSA 4GL8A 2R71A 2ZXTA 5TPAA 1NKXA 1HSEA 1NH7A 3OO7A 1EU8A 2HAUA 3TQLA 4I62A 2DWIA 4KI0E 4N6PA 4YKIA 3I5OA 4WEDA 1FCKA 4F1UA 1ANFA 5H8HA 3VV5A 1FQCA 3ZSFA 1LCFA 5CM6A 4YKJA 2VD2A 3K6XA 3F11A 2UVIA 3OO8A 2VGQA 4FORA 4GD5A 1B3LA 1IUDA 1Y1ZA 1PB7A 2X7QA 4OYVA 4R2FA 4AB5A 3M3LA 2OBGA 1II5A 1QUKA 4ZEFA 2XXPA 3ODBA 4NEDA 1QKBA 3FJGA 3K00A 2DP8A 2HCAA 4POXA 3IOWA 4NF4B 2DE4A 3T9VA 4GIZA 3Q27A 4LONB 5AA2B 4ZE8A 1T0KA 3MZBA 4I1DA 3TTKA 4EF1A 1IQ7A 1IXHA 2H98A 4GXAA 3GLBA 5K2YA 4ELQA 1J1NA 1TWYA 3W9WA 3N94A 1CB6A 3PUVE 1Y1MA 4G68B 3KZGA 4R9FA 1F9BA 1IXIA 3GBAA 1UQWA 1DMBA 4NF6B 4EXLA 4QSDA 4PP0A 2XXVA 3MPKA 2Q2CA 4F31B 3T96B 3DELB 2A5SA 3HN0A 3HHFA 2XX9A 1YTVA 1SQYA 3IOVA 4NWCA 2QS4A 1Z7ME 4I9DA 4ELRA 3I6VA 3MVZA 1B46A 2WKYA 4NF4A 1FQEA 3VLWA 1B2HA 3FVGA 2XXTA 5AA2A 2V25A 2XXRA 3MJNA 3O28A 4YB5A 1AIVA 2HXWA 1XVYA 2ONSA 4F29A 2REJA 2D3IA 4F3PA 4POWA 2Q9TA 1B7UA 1MXUA 4C1UA 4IO4A 2DVZA 4G68C 3PPRA 4G68A 5AA1A 2NXOA 1LAXA 4H0WA 5BUUA 4YB7A 5I84A 3GBBA 1NL5A 1ZIUA 4NF6A 5AA4B 3SERA 1Z7NE 1A8FA 4F3SA 3OXNA 1SW4A 2QS2A 4WEPA 1GV8A 2Z22A 1IITA 4F3BA 3TCHA 4OZ9A 1QW0A 2AYSA 3ZKLA 2PVUA 3DRIA 2WOKA 4XKPA 1B5IA 4JSDA 4H5FA 1XOCA 3LSLA 4HCYA 1H3DA 1LCTA 3T9HB 3EHSA 4QRZA 5ICTA 4FE8A 1XC1A 2QJEA 3RQTA 2V3TA 3IL1B 2Y7IA 4RPNA 1B0HA 3DRKA 3FTOA 1OIBA 2O1MA 4LA9A 4QFLA 4KHZE 3OSQA 1UTHB 5KDTB 4QSCA 1O63A 1MH4A 1CE2A 2V3QA 3SETA 4QFOA 3IB0A 4KPTA 5L8DA 5CBSA 4EDPA 1NNTA 4ESWA 2F34A 2B4MA 3PV0E 2I4CA 3PPPA 1HSJA 4GQOA 3L6GA 4IB2A 4K3FA 4YKPA 3RYAA 4X9TA 4N13A 3VFJA 2O7UA 2VOZA 2Z8EA 3VLUA 4OETA 5DVFA 4ZEKA 5FHOA 1JEUA 3QUJA 2OK2A 4Q5TA 3FVOA 4UACA 1N0TA 3Q25A 2B4LA 4IO3A 3MQ9A 1Y4TA 1NFTA 2Y84A 3A3CA 4M1VA 1N84A 3TPAA 1B0LA 2DXRA 4OFOA 1UTHA 4QHQA 3H03A 3I3VA 5KDTA 3C9HA 4OFJA 3DP8A 2DWHA 2FA7A 1M5DA 2F97A 3EHUA 2ZYKA 1LAFE 3G3KA 3JV9A 2NOOA 2O7IA 3H06B 2I3VA 3QK6A 4PFWA 5HM4B 4BDRA 5KZTA 4P0GA 1QUJA 1B51A 2Y7KA 3T22A 3C4MA 3UK4A 2F36A 2PYYA 4F3GA 2QRYA 3E3KA 5H8SA 3ONMA 1MQIA 4ZDMA 2B3BA 3ZKKA 3PPOA 1QUIA 1ELJA 2HZLA 4YMAA 3EHTA 4G2ZA 1UTBA 3RTWB 3MWBA 3FV2A 3QYTA 3LSXA 1N04A 3RUMA 4IO6A 5K2XA 2GH9A 2XXIA 3PD9A 1N3WA 2UVHA 4R73A 1MXXA 4R9GA 5I58B 1M5CA 3WAEA 2Z8DA 3H6TA 4FEBA 1LB8A 5I59B 4AB6A 1R9QA 2DOJA 2ZYOA 3S9LC 3JYRA 4MLVA 3KJTA 3H6VA 2G29A 4JSOA 3OENA 3B6WA 4LZ5A 1WDNA 2GRVA 1PB8A 2F8DA 4HS7A 1MPBA 1GVCA 3S9EA 3KFMA 3BBRA 2ANJA 4NE4A 4XIGQ 2XHDA 1N7XA 4FECA 1D3KA 3K0VA 5DT6A 2F7AA 1P1WA 3CG1A 2RCAA 1DOTA 2ZMBA 5DEXB 3CVGA 4R75A 1Y3PA 2DE2A 3AXFA 4NF8A 5I58A 1A7LA 1B4ZA 5I59A 4F19A 2E1SA 4HW8A 3C33A 4G4PA 5ITPA 2FNCA 3UORA 4NTLA 4XKQA 1MRPA 4F2QA 1MPDA 4EQBA 3O66A 4ELPA 1LAGE 3UGWA 3LC8A 2Q2AA 1TFAA 3ZS6A 4U1OA 1B3GA 3EF7A 3IK6B 3QSLA 3IAZA 4Z7EA 3DP6A 4QFPA 3TFLA 3KJ7A 4QF9A 3CFZA 1B9JA 4ZEIA 1JW1A 1OMPA 3M3KA 1Q1KA 4Q8RA 1B40A 4U21A 3CFXA 3HSTA 4TQUQ 1KWHA 4KYDA 3C35A 1NH8A 4OTEA 3BFTA 2OWSA 3C34A 1B1XA 4H8IA 2QMXA 4ZEBA 1BTJA 4KCCA 3Q29A 4XTCQ 3UA8A 1LFGA 5I2KB 3T93B 4BDQA 4DCXA 1N3XA 1IEJA 4MLQA 3FXQA 3CRBA 5I57B 3K6UA 2G93A 2OCUA 2F6GA 1D9YA 5CBRA 4KYSA 4ZS9A 4PE5B 5F7VA 4GRKA 4JWOA 3MPLA 1WODA 1B7HA 1NMUA 5JTYB 5CI5A 1FQDA 1OLAA 3C32A 1USYE 3UP9A 2UYEA 3TQWA 3WAFA 4R74A 3MUQA 1MY2A 4FIMA 3TTNA 2WOLA 1ZJLA 4H8JA 3H7MA 3G3IA 2D21A 4H5GA 5BWJA 3R7XA 3EQ1A 2X26A 4GXSB 3THIA 4ELOA 1EZPA 5I2KA 1IXCA 3KGCA 3HO7A 3T9XB 1H76A 2XXUA 5FHMA 5I57A 2Y7PA 4DIGA 5IAIA 5FHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R6U A;  2Z8F A;  3W15 C;  1Y3N A;  1DTG A;  1MG1 A;  2OWT A;  3OO6 A;  2F78 A;  5DVJ A;  3HPI A;  1NNF A;  4TLL B;  4FJP A;  4EQ7 A;  2ZNT A;  1QKA A;  4FAJ A;  1JEV A;  3PU5 A;  1LLS A;  4JDF A;  1QUL A;  3UN6 A;  3RYB A;  1MXW A;  3IOT A;  5JTY A;  4EQ9 A;  5LOM A;  4BLA A;  1B3E A;  1FTO A;  4ND9 A;  2F7B A;  2ZYM A;  3KN7 A;  3LR1 A;  1LST A;  3O2A A;  3VE1 B;  3TKD A;  3TYH A;  1RYX A;  2H5Y A;  3CR9 A;  3CSG A;  3KG2 A;  4EUO A;  1URD A;  1RKM A;  3CG3 A;  3IB2 A;  4YMB A;  1Y4C A;  3DRH A;  3SEW A;  3SDF A;  2HFB A;  3V89 B;  1MDP 1;  3MP8 A;  3TEP A;  3SEY A;  2DVC A;  3S2V A;  2ABH A;  4U4X A;  2DSF A;  3U94 A;  2XXX A;  4MF3 A;  4C1T A;  3C36 A;  1LGB C;  1SI0 A;  3QUF A;  4I8C A;  3CI8 A;  1GR2 A;  2H9B A;  3DP4 A;  3FGS A;  2YJP A;  4OES A;  4ONY A;  4MH5 A;  3U8Q A;  3MZ1 A;  4WKM A;  3HHG A;  4U2R A;  4QFK A;  1PBQ A;  2I6E A;  3TEL A;  4DXB A;  1SYH A;  3RTF B;  1GGG A;  4OEV A;  2NUV A;  1US5 A;  3FJ7 A;  5H8Q B;  3RY3 A;  3RT8 A;  5EYF A;  1JVY A;  5AA4 A;  3G3J A;  3TAJ A;  5AA3 A;  3B6T A;  1I6B A;  5EHS A;  3H6U A;  4KYE A;  3VXC A;  5AA2 D;  2GHA A;  4JXI A;  4Q30 B;  4JB7 A;  3LVU A;  4BDO A;  2B3F A;  2HZK A;  5CMB A;  3N5L A;  3FUZ A;  3SES A;  1IXG A;  2V3U A;  4FAT A;  5H8F B;  2DYX A;  2UVJ A;  2O84 X;  3SEX A;  4M4G A;  2DQV A;  4DXU A;  1YCJ A;  3IOU A;  4ZEC A;  3K6W A;  4IGR A;  1MQJ A;  5ICQ A;  1UIV A;  1P1Q A;  2RCB A;  2Y7W A;  2O6A A;  4ZZE A;  3K1M A;  3MP6 A;  1B5J A;  4L17 A;  5H8Q A;  1MY4 A;  1FTJ A;  1N76 A;  3RPW A;  2I58 A;  1PBP A;  1POT A;  1S9T A;  1PDA A;  2V93 A;  4IY6 A;  3DRJ A;  3O97 A;  5CRY A;  1OQH A;  4H1X A;  1Q35 A;  3SKP A;  4OWD A;  1MH3 A;  3B6Q A;  4N07 A;  3CSB A;  4RY1 A;  2HAV A;  3PPQ A;  1JNF A;  4ISU A;  1S7Y A;  3CIJ A;  1TFD A;  4RPO A;  4WXJ A;  1US4 A;  3O6H A;  1FTK A;  1YPN A;  5H8F A;  1EZ9 A;  4PFY A;  3KBR A;  1AH5 A;  3KEI A;  3FIR A;  4O3C A;  3BFU A;  3JZJ A;  1JVX A;  4R2B A;  3D4G A;  4E0W A;  3PAM A;  1A55 A;  1PEB A;  1SVX B;  4G77 A;  1A54 A;  5HBC A;  4JBZ A;  5CMM A;  3SEU A;  3O6G A;  1ATG A;  3PMX A;  4YZZ A;  4RJZ A;  3LBS A;  2WOP A;  2I49 A;  4X48 A;  4GF8 A;  4E0X A;  2I0B A;  1P1N A;  1SW1 A;  2XX7 A;  4U1Z A;  2UXA A;  4DE8 A;  4YAH X;  1R6Z A;  1P99 A;  3MZ9 A;  3M3F A;  4RYA A;  3K6V A;  4X1D A;  3G3G A;  3OEM A;  4MBP A;  3VVD A;  1FTM A;  5CC2 A;  3DLN A;  4U22 A;  1I69 A;  1RYO A;  1MXV A;  3U92 A;  4KFQ A;  1SD3 A;  2QS1 A;  4F1Y A;  3T9U A;  3FV1 A;  3MVX A;  1O7T A;  1NNK A;  2DE3 A;  4BDL A;  1XVX A;  1LB9 A;  1SYI A;  3S4U A;  2R9J A;  3FXR A;  5CMK A;  3E4R A;  4ZED A;  3C31 A;  1B3F A;  3O29 A;  4JWY A;  2VHA A;  3LSF B;  4ZE9 A;  4YU0 A;  1GTK A;  4Q0C A;  4G8H A;  2XXW A;  3DM0 A;  1ZU0 A;  4LQ2 A;  4MFI A;  1MDQ A;  3TCG A;  4GL0 A;  1ZMG A;  4RA1 A;  4PFT A;  2H4I A;  3FAS A;  3IO4 A;  3O9P A;  1MQD A;  1EH3 A;  2XD3 A;  3TZA A;  3HCQ A;  4R6Y A;  1OVB A;  2ONR A;  3IO6 A;  4QFN A;  3GZG A;  3FXU A;  3CFL A;  4DCY A;  2OLB A;  4R6K A;  2HEU A;  2DS9 A;  3N6U A;  2XXH A;  3CHG A;  1POY 1;  3RT6 B;  2YPN A;  4NMY A;  5AE4 A;  4G8N A;  1VE4 A;  2O69 A;  5H8H B;  2UYF A;  3Q28 A;  3LSW A;  3OMB A;  3PMV A;  3USD A;  1B1H A;  1DSN A;  4P0I A;  1D9V A;  1FW0 A;  3H6W A;  3OOA A;  5DEX A;  4BDN A;  1AMF A;  1M5E A;  1MM6 A;  2M8C A;  3IJX B;  3UIF A;  3KSJ A;  1B05 A;  3S9N C;  4TLM B;  3FVN A;  3D4C A;  3PUY E;  3V83 A;  1BIY A;  5TP9 B;  4FED A;  2GFE A;  2O68 A;  2REG A;  4XKN A;  3VXB A;  3QIM A;  5ELV A;  2P1S A;  1I6Q A;  3OO9 A;  4DDD A;  2VP1 A;  4X1B A;  1MM7 A;  3IR1 A;  5M2V A;  4ZZA A;  2NWJ A;  5J1D A;  2I4B A;  1LBB A;  1L5T A;  3RNN A;  3K1P A;  3K1N A;  3FZV A;  1LFH A;  5B7D A;  1MY1 A;  2F7C A;  4IY5 A;  2I0C A;  1URS A;  4R6H A;  2Q89 A;  2VD3 A;  1S50 A;  2ONK E;  3MC2 A;  4AQ4 A;  4ESX A;  4G8M A;  5H8N B;  2P2A A;  4YKK A;  3M8U A;  4O3A A;  4IO5 A;  4OEU A;  4F39 A;  4LVQ A;  3TCF A;  4DZ1 A;  2NVU B;  3T66 A;  4OMB A;  3U93 A;  5A5X B;  4OHN A;  3G7W A;  3MP1 A;  5TP9 A;  2KLF A;  4F1V A;  1M5F A;  1MPC A;  3A3U A;  3TMG A;  2FYI A;  4EXK A;  4F18 A;  2PBW A;  2ZNU A;  3ECR A;  3B7D A;  4H67 A;  2X7P A;  3FAT A;  4IO7 A;  4XXU A;  1M5B A;  3N6T A;  1QJM A;  2QPQ A;  4YIC A;  1TXF A;  5ITO A;  4ECF A;  4H65 A;  4F22 A;  1B6H A;  3ILU B;  2Q88 A;  1MXY A;  3VDF A;  4EF2 A;  4YB6 A;  4IO2 A;  5H8N A;  5L9O A;  2R6G E;  1XS5 A;  1JET A;  1FQA A;  5IKB A;  4GFR A;  3PUX E;  2W7Y A;  1JQF A;  2Y7R A;  3L6H A;  1DPP A;  3KN3 A;  2QMW A;  4KR5 A;  2AIX A;  5A5X A;  1R1N A;  5KCJ B;  2OZZ A;  1H44 A;  2AL5 A;  3GXA A;  1USY H;  1BLF A;  4RK9 A;  1B3H A;  5TU0 A;  2CMO A;  1YAE A;  2PX1 A;  2B65 A;  3K01 A;  3OD7 A;  3RGY A;  1SW2 A;  5JK4 A;  3VVF A;  2O1L A;  4THI A;  4NF5 B;  2QS3 A;  4KCD A;  3IJO B;  5DTB A;  2ZNS A;  1H43 A;  1B52 A;  3G3F A;  3MVY A;  1I6A A;  5I56 B;  4TOZ A;  1AOV A;  1OQG A;  1B5H A;  3KN8 A;  1SBP A;  3PPN A;  4DLD A;  3PMW A;  4F2O A;  5EHM A;  3U72 A;  3HV1 A;  3Q26 A;  4NWD A;  5KCJ A;  3TOD A;  2I3W A;  2XX8 A;  2Q8J A;  3MBP A;  4LUB A;  3FD3 A;  2PMS A;  3VLV A;  3PUW E;  1NNP A;  3PUZ E;  1ZTY A;  2F6P A;  3QXM A;  3P7I A;  3MVW A;  2PT2 A;  3K2D A;  1BKA A;  4U23 A;  3W9V A;  2ESN A;  2RF1 A;  4NF5 A;  1FTL A;  5I56 A;  2XD2 A;  5F1Q A;  2ZYN A;  3FJM A;  1MY0 A;  3OEK A;  3O6P A;  1URG A;  2I48 A;  3PGF A;  3E9X A;  1B7Z A;  4U4S A;  3VVE A;  1SW5 A;  1PC3 A;  3H3G A;  4P11 A;  3H4Z A;  3IX1 A;  2E0S A;  4BDM A;  1Y20 A;  1UIU A;  1ZKB A;  4Z0I A;  1XT8 A;  1FQF A;  3R26 A;  1MY3 A;  3OSR A;  4GOT A;  2XXY A;  1HSL A;  1A99 A;  2D5W A;  1N7W A;  4H6D A;  1UTB B;  1B58 A;  1LBC A;  5I2N B;  4OQO A;  1QVS A;  3IB1 A;  5FTH A;  4RK2 A;  4QSE A;  3IOR A;  1FQB A;  4PQJ A;  1VR5 A;  4PFU A;  1JW4 A;  3EPE A;  4OFL A;  3KOT A;  2OJT A;  5ISU A;  2Z23 A;  2F5X A;  3QAX A;  1O64 A;  2QL3 A;  5DYH A;  2RC9 A;  3K02 A;  4LZ8 A;  2RIN A;  1MS7 A;  1VSO A;  3TDJ A;  5L9S A;  5JEI A;  2A5T B;  1JW5 A;  3MAM A;  2THI A;  4LZ7 A;  4IGT A;  1B4H A;  1MXZ A;  1XHY A;  5DVI A;  2F35 A;  4PET A;  4LP2 B;  4RXL A;  3RN8 A;  1P1O A;  1PB9 A;  4RNS A;  5L9M A;  2IEE A;  3KSX A;  1B32 A;  3LUY A;  2H99 A;  3S9M C;  3DRF A;  1BP5 A;  1OLC A;  5I2N A;  1LAH E;  1DPE A;  3TTR A;  3V8X B;  2RC7 A;  3O6I A;  1Y3Q A;  5B70 A;  3PD8 A;  1WVJ A;  1H45 A;  4NF8 B;  4LAT A;  1A8E A;  2BJJ X;  4R72 A;  3MW0 A;  4KD5 A;  4OEN A;  4OXV A;  1IIW A;  3RLF E;  3U1O A;  3TUS A;  3N26 A;  2DXY A;  1Y9U A;  2A5T A;  4C0R A;  4HTG A;  2YLN A;  4GLI A;  3TTM A;  4DXC A;  2P0S A;  3ILT B;  4GWO A;  1OVT A;  2ALU A;  2QSX A;  2PT1 A;  2AL4 A;  2DWJ A;  4GVO A;  1SDX A;  2IA4 A;  1TT1 A;  3DRG A;  4UA8 A;  1R9L A;  1P1U A;  3SEV A;  2GHB A;  1MQH A;  1IZ1 A;  1LFI A;  2XXQ A;  2DWA A;  1ZBM A;  5HPQ A;  2LAO A;  3K4U A;  4OVJ A;  5TPA B;  1EZO A;  1SI1 A;  3A09 A;  3EN3 A;  4KQP A;  2RC8 A;  2H25 A;  2RKM A;  1A40 A;  3V5A A;  4XKR A;  1MQG A;  3OEL A;  4HCW A;  4OER A;  1D4N A;  2CZL A;  4O3B A;  5CMC A;  2HQ0 A;  5FTI A;  1VFD A;  2O51 A;  3FVK A;  3BKI B;  3E13 X;  2V84 A;  3G3H A;  1DTZ A;  1VFE A;  3TTL A;  2UVG A;  4LQ5 A;  4JWX A;  1AL3 A;  1ZLQ A;  3KOS A;  4GL8 A;  2R71 A;  2ZXT A;  5TPA A;  1NKX A;  1HSE A;  1NH7 A;  3OO7 A;  1EU8 A;  2HAU A;  3TQL A;  4I62 A;  2DWI A;  4KI0 E;  4N6P A;  4YKI A;  3I5O A;  4WED A;  1FCK A;  4F1U A;  1ANF A;  5H8H A;  3VV5 A;  1FQC A;  3ZSF A;  1LCF A;  5CM6 A;  4YKJ A;  2VD2 A;  3K6X A;  3F11 A;  2UVI A;  3OO8 A;  2VGQ A;  4FOR A;  4GD5 A;  1B3L A;  1IUD A;  1Y1Z A;  1PB7 A;  2X7Q A;  4OYV A;  4R2F A;  4AB5 A;  3M3L A;  2OBG A;  1II5 A;  1QUK A;  4ZEF A;  2XXP A;  3ODB A;  4NED A;  1QKB A;  3FJG A;  3K00 A;  2DP8 A;  2HCA A;  4POX A;  3IOW A;  4NF4 B;  2DE4 A;  3T9V A;  4GIZ A;  3Q27 A;  4LON B;  5AA2 B;  4ZE8 A;  1T0K A;  3MZB A;  4I1D A;  3TTK A;  4EF1 A;  1IQ7 A;  1IXH A;  2H98 A;  4GXA A;  3GLB A;  5K2Y A;  4ELQ A;  1J1N A;  1TWY A;  3W9W A;  3N94 A;  1CB6 A;  3PUV E;  1Y1M A;  4G68 B;  3KZG A;  4R9F A;  1F9B A;  1IXI A;  3GBA A;  1UQW A;  1DMB A;  4NF6 B;  4EXL A;  4QSD A;  4PP0 A;  2XXV A;  3MPK A;  2Q2C A;  4F31 B;  3T96 B;  3DEL B;  2A5S A;  3HN0 A;  3HHF A;  2XX9 A;  1YTV A;  1SQY A;  3IOV A;  4NWC A;  2QS4 A;  1Z7M E;  4I9D A;  4ELR A;  3I6V A;  3MVZ A;  1B46 A;  2WKY A;  4NF4 A;  1FQE A;  3VLW A;  1B2H A;  3FVG A;  2XXT A;  5AA2 A;  2V25 A;  2XXR A;  3MJN A;  3O28 A;  4YB5 A;  1AIV A;  2HXW A;  1XVY A;  2ONS A;  4F29 A;  2REJ A;  2D3I A;  4F3P A;  4POW A;  2Q9T A;  1B7U A;  1MXU A;  4C1U A;  4IO4 A;  2DVZ A;  4G68 C;  3PPR A;  4G68 A;  5AA1 A;  2NXO A;  1LAX A;  4H0W A;  5BUU A;  4YB7 A;  5I84 A;  3GBB A;  1NL5 A;  1ZIU A;  4NF6 A;  5AA4 B;  3SER A;  1Z7N E;  1A8F A;  4F3S A;  3OXN A;  1SW4 A;  2QS2 A;  4WEP A;  1GV8 A;  2Z22 A;  1IIT A;  4F3B A;  3TCH A;  4OZ9 A;  1QW0 A;  2AYS A;  3ZKL A;  2PVU A;  3DRI A;  2WOK A;  4XKP A;  1B5I A;  4JSD A;  4H5F A;  1XOC A;  3LSL A;  4HCY A;  1H3D A;  1LCT A;  3T9H B;  3EHS A;  4QRZ A;  5ICT A;  4FE8 A;  1XC1 A;  2QJE A;  3RQT A;  2V3T A;  3IL1 B;  2Y7I A;  4RPN A;  1B0H A;  3DRK A;  3FTO A;  1OIB A;  2O1M A;  4LA9 A;  4QFL A;  4KHZ E;  3OSQ A;  1UTH B;  5KDT B;  4QSC A;  1O63 A;  1MH4 A;  1CE2 A;  2V3Q A;  3SET A;  4QFO A;  3IB0 A;  4KPT A;  5L8D A;  5CBS A;  4EDP A;  1NNT A;  4ESW A;  2F34 A;  2B4M A;  3PV0 E;  2I4C A;  3PPP A;  1HSJ A;  4GQO A;  3L6G A;  4IB2 A;  4K3F A;  4YKP A;  3RYA A;  4X9T A;  4N13 A;  3VFJ A;  2O7U A;  2VOZ A;  2Z8E A;  3VLU A;  4OET A;  5DVF A;  4ZEK A;  5FHO A;  1JEU A;  3QUJ A;  2OK2 A;  4Q5T A;  3FVO A;  4UAC A;  1N0T A;  3Q25 A;  2B4L A;  4IO3 A;  3MQ9 A;  1Y4T A;  1NFT A;  2Y84 A;  3A3C A;  4M1V A;  1N84 A;  3TPA A;  1B0L A;  2DXR A;  4OFO A;  1UTH A;  4QHQ A;  3H03 A;  3I3V A;  5KDT A;  3C9H A;  4OFJ A;  3DP8 A;  2DWH A;  2FA7 A;  1M5D A;  2F97 A;  3EHU A;  2ZYK A;  1LAF E;  3G3K A;  3JV9 A;  2NOO A;  2O7I A;  3H06 B;  2I3V A;  3QK6 A;  4PFW A;  5HM4 B;  4BDR A;  5KZT A;  4P0G A;  1QUJ A;  1B51 A;  2Y7K A;  3T22 A;  3C4M A;  3UK4 A;  2F36 A;  2PYY A;  4F3G A;  2QRY A;  3E3K A;  5H8S A;  3ONM A;  1MQI A;  4ZDM A;  2B3B A;  3ZKK A;  3PPO A;  1QUI A;  1ELJ A;  2HZL A;  4YMA A;  3EHT A;  4G2Z A;  1UTB A;  3RTW B;  3MWB A;  3FV2 A;  3QYT A;  3LSX A;  1N04 A;  3RUM A;  4IO6 A;  5K2X A;  2GH9 A;  2XXI A;  3PD9 A;  1N3W A;  2UVH A;  4R73 A;  1MXX A;  4R9G A;  5I58 B;  1M5C A;  3WAE A;  2Z8D A;  3H6T A;  4FEB A;  1LB8 A;  5I59 B;  4AB6 A;  1R9Q A;  2DOJ A;  2ZYO A;  3S9L C;  3JYR A;  4MLV A;  3KJT A;  3H6V A;  2G29 A;  4JSO A;  3OEN A;  3B6W A;  4LZ5 A;  1WDN A;  2GRV A;  1PB8 A;  2F8D A;  4HS7 A;  1MPB A;  1GVC A;  3S9E A;  3KFM A;  3BBR A;  2ANJ A;  4NE4 A;  4XIG Q;  2XHD A;  1N7X A;  4FEC A;  1D3K A;  3K0V A;  5DT6 A;  2F7A A;  1P1W A;  3CG1 A;  2RCA A;  1DOT A;  2ZMB A;  5DEX B;  3CVG A;  4R75 A;  1Y3P A;  2DE2 A;  3AXF A;  4NF8 A;  5I58 A;  1A7L A;  1B4Z A;  5I59 A;  4F19 A;  2E1S A;  4HW8 A;  3C33 A;  4G4P A;  5ITP A;  2FNC A;  3UOR A;  4NTL A;  4XKQ A;  1MRP A;  4F2Q A;  1MPD A;  4EQB A;  3O66 A;  4ELP A;  1LAG E;  3UGW A;  3LC8 A;  2Q2A A;  1TFA A;  3ZS6 A;  4U1O A;  1B3G A;  3EF7 A;  3IK6 B;  3QSL A;  3IAZ A;  4Z7E A;  3DP6 A;  4QFP A;  3TFL A;  3KJ7 A;  4QF9 A;  3CFZ A;  1B9J A;  4ZEI A;  1JW1 A;  1OMP A;  3M3K A;  1Q1K A;  4Q8R A;  1B40 A;  4U21 A;  3CFX A;  3HST A;  4TQU Q;  1KWH A;  4KYD A;  3C35 A;  1NH8 A;  4OTE A;  3BFT A;  2OWS A;  3C34 A;  1B1X A;  4H8I A;  2QMX A;  4ZEB A;  1BTJ A;  4KCC A;  3Q29 A;  4XTC Q;  3UA8 A;  1LFG A;  5I2K B;  3T93 B;  4BDQ A;  4DCX A;  1N3X A;  1IEJ A;  4MLQ A;  3FXQ A;  3CRB A;  5I57 B;  3K6U A;  2G93 A;  2OCU A;  2F6G A;  1D9Y A;  5CBR A;  4KYS A;  4ZS9 A;  4PE5 B;  5F7V A;  4GRK A;  4JWO A;  3MPL A;  1WOD A;  1B7H A;  1NMU A;  5JTY B;  5CI5 A;  1FQD A;  1OLA A;  3C32 A;  1USY E;  3UP9 A;  2UYE A;  3TQW A;  3WAF A;  4R74 A;  3MUQ A;  1MY2 A;  4FIM A;  3TTN A;  2WOL A;  1ZJL A;  4H8J A;  3H7M A;  3G3I A;  2D21 A;  4H5G A;  5BWJ A;  3R7X A;  3EQ1 A;  2X26 A;  4GXS B;  3THI A;  4ELO A;  1EZP A;  5I2K A;  1IXC A;  3KGC A;  3HO7 A;  3T9X B;  1H76 A;  2XXU A;  5FHM A;  5I57 A;  2Y7P A;  4DIG A;  5IAI A;  5FHN A; 
#chains in the Genus database with same CATH topology
 3R6U A;  2Z8F A;  3W15 C;  4JVD A;  4GWY A;  1Y3N A;  1DTG A;  1MG1 A;  2OWT A;  3OO6 A;  2F78 A;  5DVJ A;  3HPI A;  1NNF A;  4TLL B;  4FJP A;  4EQ7 A;  2ZNT A;  1QKA A;  4FAJ A;  1JEV A;  3PU5 A;  1LLS A;  3MST A;  4JDF A;  4GWX A;  1QUL A;  3UN6 A;  3RYB A;  1MXW A;  3IOT A;  5JTY A;  4EQ9 A;  5LOM A;  4BLA A;  1B3E A;  1FTO A;  4ND9 A;  2F7B A;  2ZYM A;  3KN7 A;  3LR1 A;  1LST A;  3O2A A;  3VE1 B;  3TKD A;  3TYH A;  1RYX A;  2H5Y A;  4HE0 A;  3CR9 A;  3CSG A;  2MKZ A;  4NN3 A;  3KG2 A;  4EUO A;  1URD A;  1RKM A;  5I7I A;  1FSA A;  3CG3 A;  3IB2 A;  4YMB A;  1Y4C A;  3RPL B;  4PAF A;  3DRH A;  3SEW A;  3SDF A;  1SPI A;  2HFB A;  3V89 B;  1MDP 1;  3QMF A;  3MP8 A;  2QVR A;  4N6K A;  3TEP A;  2PCR A;  3SEY A;  2DVC A;  3S2V A;  4O8M A;  2ABH A;  4U4X A;  2DSF A;  3U94 A;  2XXX A;  4MF3 A;  4C1T A;  3C36 A;  1LGB C;  1SI0 A;  3QUF A;  4I8C A;  3CI8 A;  1GR2 A;  2H9B A;  3DP4 A;  3FGS A;  2YJP A;  4OES A;  4XFE A;  4ONY A;  4MH5 A;  5LTC A;  3U8Q A;  3MZ1 A;  4WKM A;  2CZK A;  3HHG A;  4U2R A;  4QFK A;  1PBQ A;  2I6E A;  3TEL A;  4DXB A;  1SYH A;  3RTF B;  1GGG A;  4OEV A;  3RPL A;  5EYH A;  2NUV A;  1US5 A;  2F3B A;  1NV5 A;  3FJ7 A;  5H8Q B;  3RY3 A;  3RT8 A;  1NV1 A;  5EYF A;  1JVY A;  5AA4 A;  3G3J A;  3TAJ A;  5EQA A;  5AA3 A;  3B6T A;  1I6B A;  1LBZ A;  4NG7 A;  5EHS A;  3H6U A;  4KYE A;  3VXC A;  5AA2 D;  1YZ0 A;  2GHA A;  4JXI A;  4Q30 B;  4JB7 A;  3LVU A;  4BDO A;  2B3F A;  2HZK A;  5CMB A;  3N5L A;  3FUZ A;  1Q9D A;  3SES A;  2R8T A;  1IXG A;  2V3U A;  3LV0 A;  4GWS A;  5H8F B;  2DYX A;  4OVT A;  4FAT A;  4GWU A;  2UVJ A;  2O84 X;  3SEX A;  4M4G A;  2WYK A;  2DQV A;  4DXU A;  4GWZ A;  1YCJ A;  4N8G A;  3IOU A;  4ZEC A;  3K6W A;  4IGR A;  5DW8 A;  1QGX A;  3FXB A;  1MQJ A;  3BIG A;  5ICQ A;  1UIV A;  1P1Q A;  2RCB A;  2Y7W A;  2O6A A;  5IZ1 A;  4MMP A;  4ZZE A;  3K1M A;  5ESY A;  3MP6 A;  1B5J A;  4L17 A;  5H8Q A;  1MY4 A;  1NUX A;  1FTJ A;  1N76 A;  3RPW A;  2I58 A;  1FBC A;  1PBP A;  1POT A;  1S9T A;  1PDA A;  2V93 A;  4IY6 A;  3DRJ A;  3O97 A;  5CRY A;  1OQH A;  4H1X A;  1Q35 A;  1KZ8 A;  3SKP A;  4OWD A;  1MH3 A;  3B6Q A;  4MAG A;  2P3V A;  4N07 A;  4GX6 A;  3CSB A;  4RY1 A;  2HAV A;  3PPQ A;  1JNF A;  4ISU A;  1S7Y A;  3CIJ A;  1TFD A;  4RPO A;  4WXJ A;  1US4 A;  3O6H A;  4P1E A;  1FTK A;  1YPN A;  5H8F A;  1EZ9 A;  4PFY A;  3KBR A;  1AH5 A;  3KEI A;  2XWV A;  3FIR A;  4O3C A;  1IMD A;  3BFU A;  3JZJ A;  3SZP A;  1JVX A;  4R2B A;  3D4G A;  4E0W A;  3PAM A;  4P8B A;  1A55 A;  1PEB A;  5ET5 A;  2KR0 A;  1SVX B;  4G77 A;  1A54 A;  5HBC A;  4JBZ A;  5CMM A;  3SEU A;  3O6G A;  1ATG A;  3PMX A;  4YZZ A;  4RJZ A;  3LBS A;  4PE3 A;  2WOP A;  2I49 A;  4X48 A;  4GF8 A;  1FPF A;  4E0X A;  2I0B A;  1P1N A;  1SW1 A;  2XX7 A;  4O94 A;  4U1Z A;  2UXA A;  4DE8 A;  4YAH X;  1R6Z A;  4PGP A;  1P99 A;  3MZ9 A;  3M3F A;  4RYA A;  3K6V A;  3G3G A;  3OEM A;  4X1D A;  4MBP A;  3VVD A;  1FTM A;  5CC2 A;  3DLN A;  4U22 A;  1I69 A;  1RYO A;  1MXV A;  3U92 A;  4KFQ A;  1SD3 A;  2QS1 A;  4F1Y A;  2XXK A;  3T9U A;  3FV1 A;  3MVX A;  1O7T A;  1NNK A;  2DE3 A;  4BDL A;  1XVX A;  1LB9 A;  5ET7 A;  1SYI A;  2DDK A;  3S4U A;  2R9J A;  3T0J A;  3FXR A;  5CMK A;  1EYI A;  3E4R A;  4ZED A;  1FRP A;  3C31 A;  1B3F A;  3O29 A;  4JWY A;  2VHA A;  3LSF B;  4ZE9 A;  4YU0 A;  1GTK A;  4O7I A;  4Q0C A;  2WYP A;  4G8H A;  2XXW A;  5IZZ A;  3DM0 A;  1ZU0 A;  4LQ2 A;  4MFI A;  5EQ7 A;  1MDQ A;  3TCG A;  4GL0 A;  1ZMG A;  4RA1 A;  4PFT A;  2H4I A;  1FPE A;  3D1R A;  3FAS A;  3IO4 A;  3O9P A;  2CEX A;  1MQD A;  1EH3 A;  2XD3 A;  3TZA A;  3HCQ A;  4R6Y A;  1OVB A;  2ONR A;  3IO6 A;  4QFN A;  2XWK A;  4PAI A;  3GZG A;  3MYU A;  3FXU A;  3CFL A;  3KC1 A;  4DCY A;  2OLB A;  4R6K A;  2HEU A;  2DS9 A;  3N6U A;  2XXH A;  3CHG A;  1POY 1;  4O7M A;  3RT6 B;  2YPN A;  4NMY A;  5AE4 A;  4G8N A;  1VE4 A;  2O69 A;  5H8H B;  5I3S A;  2UYF A;  3Q28 A;  2Y5L A;  3LSW A;  4N8Y A;  3OMB A;  3PMV A;  3USD A;  1B1H A;  4GX4 A;  1DSN A;  4GX3 A;  4P0I A;  1D9V A;  1FW0 A;  3BIH A;  3H6W A;  3OOA A;  5DEX A;  4BDN A;  1AMF A;  1M5E A;  1MM6 A;  2M8C A;  3IJX B;  3UIF A;  2OX3 A;  3KSJ A;  1B05 A;  3S9N C;  4TLM B;  3FVN A;  3D4C A;  3PUY E;  3V83 A;  1BIY A;  4PCD A;  5TP9 B;  4FED A;  4HE2 A;  2GFE A;  2O68 A;  2REG A;  2WEF A;  2XA5 A;  2HPG A;  4XKN A;  2ZZW A;  3VXB A;  4N15 A;  3QIM A;  5ELV A;  2P1S A;  1I6Q A;  3OO9 A;  4DDD A;  2VP1 A;  4X1B A;  1MM7 A;  3IR1 A;  5M2V A;  4ZZA A;  2NWJ A;  1FPB A;  5J1D A;  2I4B A;  1LBB A;  1L5T A;  3RNN A;  3K1P A;  3K1N A;  3FZV A;  1LFH A;  5B7D A;  1MY1 A;  2F7C A;  4IY5 A;  2I0C A;  1URS A;  4R6H A;  2Q89 A;  2VD3 A;  1S50 A;  2ONK E;  3MC2 A;  4AQ4 A;  4ESX A;  4G8M A;  5H8N B;  2P2A A;  4YKK A;  4I3Y A;  4MHF A;  3M8U A;  4O3A A;  4IO5 A;  4OEU A;  4MCO A;  4F39 A;  4LVQ A;  3TCF A;  4DZ1 A;  2NVU B;  3T66 A;  4OMB A;  3U93 A;  5A5X B;  4OHN A;  3G7W A;  3MP1 A;  5TP9 A;  2KLF A;  4F1V A;  1M5F A;  4GWW A;  1MPC A;  3A3U A;  3TMG A;  2FYI A;  4EXK A;  1FPI A;  2BJI A;  4F18 A;  2PBW A;  2ZNU A;  3ECR A;  3B7D A;  4H67 A;  4OVS A;  1DCU A;  2VT5 A;  2X7P A;  3FAT A;  4IO7 A;  4XXU A;  4PDH A;  1M5B A;  3N6T A;  5IM2 A;  2GQ1 A;  1QJM A;  2QPQ A;  4YIC A;  1TXF A;  3A29 A;  5ITO A;  1FTA A;  4I3E A;  4ECF A;  4H65 A;  4F22 A;  1B6H A;  4XEQ A;  1BK4 A;  3ILU B;  2Q88 A;  1MXY A;  3VDF A;  4EF2 A;  4YB6 A;  4IO2 A;  5H8N A;  5L9O A;  2R6G E;  1XS5 A;  1IMA A;  1JET A;  1FQA A;  5IKB A;  4GFR A;  3PUX E;  2W7Y A;  1JQF A;  2Y7R A;  3L6H A;  1DPP A;  3KN3 A;  2QMW A;  4KR5 A;  2AIX A;  5A5X A;  1R1N A;  5KCJ B;  2OZZ A;  1H44 A;  2AL5 A;  2FVZ A;  3GXA A;  4OVR A;  2PFY A;  1USY H;  1BLF A;  4RK9 A;  1B3H A;  5TU0 A;  2CMO A;  1YAE A;  2PX1 A;  2FIE A;  2B65 A;  1LBW A;  3K01 A;  5ET6 A;  3OD7 A;  3RGY A;  1SW2 A;  5JK4 A;  4MJO A;  3VVF A;  2O1L A;  4THI A;  1NV3 A;  4NF5 B;  2QS3 A;  4KCD A;  3IJO B;  5DTB A;  2ZNS A;  1H43 A;  1B52 A;  3G3F A;  3MVY A;  1I6A A;  5I56 B;  4TOZ A;  1AOV A;  1OQG A;  1B5H A;  3KN8 A;  1SBP A;  3PPN A;  1IMF A;  4N6D A;  4DLD A;  3PMW A;  4F2O A;  5EHM A;  3U72 A;  2QFL A;  3HV1 A;  3Q26 A;  4NWD A;  5KCJ A;  3TOD A;  2I3W A;  2XX8 A;  3B50 A;  2Q8J A;  3MBP A;  4LUB A;  1FBG A;  3FD3 A;  2PMS A;  4HXV A;  3VLV A;  4H46 A;  3PUW E;  1NNP A;  3PUZ E;  1ZTY A;  1NV0 A;  2F6P A;  5IZ3 B;  3QXM A;  3P7I A;  1IMB A;  3MVW A;  2PT2 A;  3GYY A;  3K2D A;  1BKA A;  1G0H A;  4OVP A;  2JJK A;  4IR8 A;  4U23 A;  3W9V A;  2ESN A;  2RF1 A;  4NF5 A;  1FTL A;  5I56 A;  2XD2 A;  5F1Q A;  1K9Y A;  2ZYN A;  3FJM A;  1MY0 A;  2WBD A;  3OEK A;  3O6P A;  1URG A;  2I48 A;  3PGF A;  3E9X A;  1B7Z A;  4U4S A;  3VVE A;  1SW5 A;  1PC3 A;  3H3G A;  4NAP A;  4P11 A;  1CNQ A;  3H4Z A;  3IX1 A;  2E0S A;  4BDM A;  1Y20 A;  1UIU A;  4KXP A;  2F3D A;  1NV7 A;  1ZKB A;  4N17 A;  4Z0I A;  5ET8 A;  1XT8 A;  1FQF A;  3R26 A;  5IZ3 A;  3E78 A;  1MY3 A;  3OSR A;  4GOT A;  2KQZ A;  2XXY A;  1HSL A;  1NUW A;  1A99 A;  2D5W A;  4NF0 A;  1N7W A;  4H6D A;  1UTB B;  1B58 A;  1LBC A;  1INP A;  5I2N B;  4OQO A;  1QVS A;  3IB1 A;  5FTH A;  4RK2 A;  4QSE A;  3IOR A;  1FQB A;  4PQJ A;  4PC9 A;  1VR5 A;  3IFC A;  4PFU A;  1JW4 A;  3EPE A;  4OFL A;  3KOT A;  4NQ8 A;  2OJT A;  5ISU A;  2Z23 A;  2F5X A;  4X04 A;  3QAX A;  1O64 A;  2QL3 A;  5DYH A;  2RC9 A;  3K02 A;  1LBV A;  5A5L A;  4LZ8 A;  2RIN A;  1MS7 A;  1VSO A;  3TDJ A;  5L9S A;  5JEI A;  2A5T B;  1JW5 A;  3MAM A;  2THI A;  4LZ7 A;  4IGT A;  1B4H A;  2L5V A;  1MXZ A;  4NGU A;  1XHY A;  5DVI A;  2Y5K A;  2F35 A;  4PET A;  4LP2 B;  4PFB A;  4RXL A;  3RN8 A;  1P1O A;  1PB9 A;  4RNS A;  5L9M A;  4PF6 A;  2IEE A;  3KSX A;  1VDW A;  1B32 A;  3LUY A;  2H99 A;  3S9M C;  3DRF A;  1BP5 A;  4UAB A;  1OLC A;  5I2N A;  1LAH E;  1DPE A;  3TTR A;  3V8X B;  2RC7 A;  3O6I A;  1Y3Q A;  5B70 A;  3PD8 A;  1WVJ A;  1H45 A;  4NHB A;  4NF8 B;  4LAT A;  1A8E A;  2BJJ X;  1DK4 A;  4R72 A;  3MW0 A;  4KD5 A;  4OEN A;  4PAK A;  4OXV A;  1IIW A;  3RLF E;  3U1O A;  3TUS A;  1FBD A;  3N26 A;  4PGN A;  1EYK A;  2DXY A;  1Y9U A;  2A5T A;  3NOH A;  4C0R A;  4HTG A;  2YLN A;  4GLI A;  3TTM A;  4DXC A;  2P0S A;  4HE1 A;  3ILT B;  4GWO A;  4P1L A;  1OVT A;  2ALU A;  2QSX A;  2PT1 A;  1NUZ A;  2AL4 A;  2DWJ A;  4GVO A;  1SDX A;  1D9Q A;  2IA4 A;  1TT1 A;  3DRG A;  4UA8 A;  1R9L A;  1P1U A;  3SEV A;  2GHB A;  1FJ6 A;  1MQH A;  1IZ1 A;  1KA0 A;  1LFI A;  2XXQ A;  2DWA A;  1ZBM A;  5HPQ A;  2LAO A;  3K4U A;  4OVJ A;  5TPA B;  1EZO A;  1SI1 A;  3A09 A;  3EN3 A;  4KQP A;  2RC8 A;  2H25 A;  2RKM A;  1A40 A;  3V5A A;  3KBZ A;  4XKR A;  1MQG A;  1RDY A;  3OEL A;  4HCW A;  4OER A;  1D4N A;  2CZL A;  4O3B A;  5CMC A;  2HQ0 A;  5FTI A;  1VFD A;  2O51 A;  3FVK A;  1AWB A;  3BKI B;  3IFA A;  3E13 X;  2V84 A;  3G3H A;  4P3L A;  1DTZ A;  1VFE A;  1DBZ A;  1G0I A;  3TTL A;  2UVG A;  4LQ5 A;  4JWX A;  1FPD A;  1AL3 A;  1ZLQ A;  3KOS A;  4GL8 A;  2HHM A;  2R71 A;  4NX1 A;  2ZXT A;  5TPA A;  1NKX A;  1HSE A;  4MX6 A;  1NH7 A;  3OO7 A;  1EU8 A;  2HAU A;  1FBE A;  3FBP A;  3TQL A;  4I62 A;  2DWI A;  2FBP A;  4KI0 E;  4N6P A;  4YKI A;  3I5O A;  4WED A;  1FCK A;  3RYD A;  4F1U A;  1ANF A;  4PBH A;  5H8H A;  5EQ8 A;  3VV5 A;  1FQC A;  3ZSF A;  1LCF A;  5CM6 A;  4YKJ A;  2VD2 A;  3K6X A;  3F11 A;  2UVI A;  3B8B A;  3OO8 A;  2VGQ A;  4FOR A;  4GD5 A;  1B3L A;  1IUD A;  1Y1Z A;  5F24 A;  3ROJ A;  4DI4 B;  1PB7 A;  2X7Q A;  4OYV A;  4R2F A;  4AB5 A;  3M3L A;  2OBG A;  1II5 A;  4OAN A;  4MIJ A;  1NUY A;  1QUK A;  4ZEF A;  5I5P A;  2XXP A;  3ODB A;  4PFR A;  4NED A;  1QKB A;  3FJG A;  3K00 A;  2DP8 A;  4LN5 A;  2HCA A;  4POX A;  3IOW A;  4NF4 B;  4QXD A;  2DE4 A;  3T9V A;  4GIZ A;  3Q27 A;  4LON B;  5AA2 B;  4ZE8 A;  1T0K A;  3MZB A;  4I1D A;  3TTK A;  4EF1 A;  1IQ7 A;  5EYG A;  1IXH A;  2H98 A;  4GXA A;  3GLB A;  5K2Y A;  4ELQ A;  1J1N A;  1TWY A;  3W9W A;  3N94 A;  4N91 A;  1CB6 A;  3PUV E;  1Y1M A;  4G68 B;  2WBB A;  3KZG A;  4R9F A;  1F9B A;  4MNP A;  2QVV A;  1IXI A;  3GBA A;  1UQW A;  1DMB A;  4NF6 B;  4EXL A;  4JVC A;  4QSD A;  4I40 A;  2QVU A;  4PP0 A;  2XXV A;  3MPK A;  2CEY A;  2Q2C A;  4F31 B;  3T96 B;  4DI3 D;  3DEL B;  2A5S A;  1FPJ A;  3HN0 A;  3HHF A;  2XX9 A;  3LUZ A;  1YTV A;  1SQY A;  3IOV A;  4NWC A;  2QS4 A;  1Z7M E;  4I9D A;  4MEV A;  4ELR A;  1NV2 A;  3I6V A;  3MVZ A;  1B46 A;  2WKY A;  4NF4 A;  1FQE A;  3VLW A;  1B2H A;  1NV6 A;  4MNI A;  3FVG A;  2XXT A;  5AA2 A;  2V25 A;  2XXR A;  3MJN A;  3O28 A;  4YB5 A;  1AIV A;  2HXW A;  2XWO A;  1XVY A;  2ONS A;  4F29 A;  2REJ A;  2D3I A;  4F3P A;  4POW A;  2Q9T A;  1B7U A;  1MXU A;  4C1U A;  4N4U A;  4IO4 A;  2DVZ A;  4G68 C;  4H45 A;  3PPR A;  4G68 A;  5AA1 A;  2NXO A;  1LAX A;  4H0W A;  5BUU A;  4YB7 A;  2ZZX A;  5I84 A;  3GBB A;  1NL5 A;  1ZIU A;  4NF6 A;  5AA4 B;  3SER A;  1Z7N E;  1A8F A;  4F3S A;  3OXN A;  1SW4 A;  2QS2 A;  4WEP A;  1GV8 A;  2Z22 A;  1IIT A;  4F3B A;  1NI9 A;  3TCH A;  4OZ9 A;  2XWI A;  4G61 A;  1QW0 A;  2AYS A;  3ZKL A;  2PVU A;  3DRI A;  2WOK A;  2WX9 A;  4XKP A;  1B5I A;  4JSD A;  4H5F A;  1XOC A;  3LSL A;  4HCY A;  4OA4 A;  1FPG A;  1H3D A;  1LCT A;  3T9H B;  3EHS A;  4PBQ A;  4QRZ A;  5ICT A;  4FE8 A;  1XC1 A;  2QJE A;  3RQT A;  2V3T A;  3IL1 B;  2Y7I A;  1FJ9 A;  4RPN A;  1B0H A;  3DRK A;  3FTO A;  1OIB A;  2O1M A;  4LA9 A;  4QFL A;  4KHZ E;  3OSQ A;  1UTH B;  4XF5 A;  5KDT B;  4QSC A;  1YXI A;  1O63 A;  1MH4 A;  1CE2 A;  2V3Q A;  3SET A;  4QFO A;  3IB0 A;  4KPT A;  5L8D A;  5CBS A;  4EDP A;  1LEV A;  1NNT A;  4ESW A;  2F34 A;  2B4M A;  3PV0 E;  2I4C A;  1LBX A;  3PPP A;  1HSJ A;  4GQO A;  3L6G A;  4IB2 A;  4K3F A;  4YKP A;  4FBP A;  3RYA A;  4X9T A;  4N13 A;  3VFJ A;  2O7U A;  2VOZ A;  2Z8E A;  3VLU A;  5FBP A;  4OET A;  5DVF A;  4ZEK A;  5FHO A;  1JEU A;  3QUJ A;  2OK2 A;  2Q8M A;  1YYZ A;  4Q5T A;  3FVO A;  4UAC A;  1N0T A;  3Q25 A;  2B4L A;  5J16 A;  4IO3 A;  2P3N A;  3MQ9 A;  1Y4T A;  1NFT A;  2Y84 A;  3A3C A;  4M1V A;  1N84 A;  3TPA A;  1B0L A;  2DXR A;  4GBW A;  4OFO A;  1UTH A;  4QHQ A;  3H03 A;  3I3V A;  5KDT A;  3C9H A;  4OFJ A;  3DP8 A;  2DWH A;  2FA7 A;  3HFU A;  1M5D A;  2F97 A;  3U65 A;  3EHU A;  4X8R A;  2ZYK A;  1LAF E;  5T3J A;  3G3K A;  3JV9 A;  2NOO A;  1JP4 A;  2O7I A;  1FBH A;  3H06 B;  4MNC A;  2I3V A;  3QK6 A;  4PFW A;  1FPK A;  3PTY A;  5HM4 B;  4BDR A;  5KZT A;  4AS5 A;  4P0G A;  1QUJ A;  1B51 A;  2Y7K A;  3T22 A;  3C4M A;  3UK4 A;  2F36 A;  2PYY A;  4F3G A;  5EQ9 A;  2QRY A;  3E3K A;  1IMC A;  5H8S A;  3ONM A;  4PFI A;  1MQI A;  4ZDM A;  2B3B A;  3ZKK A;  3PPO A;  1QUI A;  1ELJ A;  2HZL A;  4P47 A;  4YMA A;  3EHT A;  4G2Z A;  1UTB A;  1RDZ A;  3RTW B;  3MWB A;  2PFZ A;  3FV2 A;  3QYT A;  3LSX A;  1N04 A;  3RUM A;  4IO6 A;  5K2X A;  2GH9 A;  2XXI A;  3PD9 A;  1N3W A;  1FBF A;  2UVH A;  4R73 A;  1MXX A;  4R9G A;  5I58 B;  1M5C A;  3WAE A;  2Z8D A;  3H6T A;  4FEB A;  1LB8 A;  4PTK A;  5I59 B;  4AB6 A;  1R9Q A;  2DOJ A;  2ZYO A;  3S9L C;  3JYR A;  4MLV A;  1RDX A;  4N81 A;  3KJT A;  3H6V A;  2G29 A;  4JSO A;  3OEN A;  3B6W A;  4LZ5 A;  1WDN A;  2GRV A;  1PB8 A;  2F8D A;  4HS7 A;  3EKI A;  1MPB A;  4QBA A;  1GVC A;  3S9E A;  3KFM A;  5LDZ A;  3BBR A;  2ANJ A;  4NE4 A;  4XIG Q;  2XHD A;  1N7X A;  4FEC A;  1D3K A;  3K0V A;  4OVQ A;  3T1B A;  5DT6 A;  1LBY A;  3KC0 A;  2F7A A;  1P1W A;  3CG1 A;  2RCA A;  1DOT A;  2ZMB A;  5DEX B;  3CVG A;  4R75 A;  1Y3P A;  2DE2 A;  1KA1 A;  3AXF A;  4NF8 A;  5I58 A;  1A7L A;  1B4Z A;  5I59 A;  4F19 A;  2E1S A;  3E79 A;  4HW8 A;  3C33 A;  4G4P A;  2VPO A;  5ITP A;  4PDD A;  2FNC A;  3UOR A;  4NTL A;  4XKQ A;  2V4C A;  1MRP A;  4F2Q A;  1MPD A;  4P56 A;  3O66 A;  4EQB A;  4ELP A;  2ZZV A;  1LAG E;  3UGW A;  3LC8 A;  2Q2A A;  1TFA A;  3ZS6 A;  4U1O A;  1B3G A;  3EF7 A;  3IK6 B;  3QSL A;  4AS4 A;  3IAZ A;  4Z7E A;  3DP6 A;  4QFP A;  3TFL A;  2HXR A;  3KJ7 A;  4QF9 A;  3CFZ A;  1B9J A;  2CZH A;  4ZEI A;  1JW1 A;  1OMP A;  3M3K A;  1K9Z A;  1Q1K A;  4Q8R A;  1B40 A;  4U21 A;  3CFX A;  3HST A;  4TQU Q;  1KWH A;  4KYD A;  3C35 A;  1NH8 A;  4OTE A;  1IME A;  3BFT A;  2OWS A;  3C34 A;  1B1X A;  4H8I A;  2QMX A;  1FPL A;  4ZEB A;  1BTJ A;  4KCC A;  1NV4 A;  3Q29 A;  4XTC Q;  3UA8 A;  1LFG A;  5I2K B;  3T93 B;  1FBP A;  4BDQ A;  4DCX A;  1N3X A;  1IEJ A;  4MLQ A;  3FXQ A;  1XI6 A;  3CRB A;  5I57 B;  3K6U A;  2G93 A;  2FIX A;  2OCU A;  2F6G A;  2OWZ A;  1D9Y A;  3ISP A;  5CBR A;  4KYS A;  4ZS9 A;  4PE5 B;  5F7V A;  4GRK A;  4JWO A;  4JVI A;  3MPL A;  1EYJ A;  1WOD A;  1B7H A;  4PF8 A;  4GBV A;  1NMU A;  5JTY B;  5CI5 A;  1FQD A;  1OLA A;  3C32 A;  1USY E;  3UP9 A;  2UYE A;  3TQW A;  2VPN A;  4P9K A;  3WAF A;  4R74 A;  3MUQ A;  1MY2 A;  4FIM A;  3TTN A;  2WOL A;  1ZJL A;  2FHY A;  4H8J A;  5IGA A;  3H7M A;  3G3I A;  2D21 A;  4H5G A;  5BWJ A;  3R7X A;  3EQ1 A;  2X26 A;  4GXS B;  3THI A;  4ELO A;  1EZP A;  5I2K A;  1IXC A;  2CZI A;  3KGC A;  3HO7 A;  3T9X B;  1H76 A;  2XXU A;  5FHM A;  5I57 A;  2Y7P A;  4DIG A;  5IAI A;  2Q74 A;  5FHN A; 
#chains in the Genus database with same CATH homology
 3R6U A;  2Z8F A;  3W15 C;  1Y3N A;  1DTG A;  1MG1 A;  2OWT A;  3OO6 A;  2F78 A;  5DVJ A;  3HPI A;  1NNF A;  4TLL B;  4FJP A;  4EQ7 A;  2ZNT A;  1QKA A;  4FAJ A;  1JEV A;  3PU5 A;  1LLS A;  4JDF A;  1QUL A;  3UN6 A;  3RYB A;  1MXW A;  3IOT A;  5JTY A;  4EQ9 A;  5LOM A;  4BLA A;  1B3E A;  1FTO A;  4ND9 A;  2F7B A;  2ZYM A;  3KN7 A;  3LR1 A;  1LST A;  3O2A A;  3VE1 B;  3TKD A;  3TYH A;  1RYX A;  2H5Y A;  3CR9 A;  3CSG A;  3KG2 A;  4EUO A;  1URD A;  1RKM A;  3CG3 A;  3IB2 A;  4YMB A;  1Y4C A;  3DRH A;  3SEW A;  3SDF A;  2HFB A;  3V89 B;  1MDP 1;  3MP8 A;  3TEP A;  3SEY A;  2DVC A;  3S2V A;  2ABH A;  4U4X A;  2DSF A;  3U94 A;  2XXX A;  4MF3 A;  4C1T A;  3C36 A;  1LGB C;  1SI0 A;  3QUF A;  4I8C A;  3CI8 A;  1GR2 A;  2H9B A;  3DP4 A;  3FGS A;  2YJP A;  4OES A;  4ONY A;  4MH5 A;  3U8Q A;  3MZ1 A;  4WKM A;  3HHG A;  4U2R A;  4QFK A;  1PBQ A;  2I6E A;  3TEL A;  4DXB A;  1SYH A;  3RTF B;  1GGG A;  4OEV A;  2NUV A;  1US5 A;  3FJ7 A;  5H8Q B;  3RY3 A;  3RT8 A;  5EYF A;  1JVY A;  5AA4 A;  3G3J A;  3TAJ A;  5AA3 A;  3B6T A;  1I6B A;  5EHS A;  3H6U A;  4KYE A;  3VXC A;  5AA2 D;  2GHA A;  4JXI A;  4Q30 B;  4JB7 A;  3LVU A;  4BDO A;  2B3F A;  2HZK A;  5CMB A;  3N5L A;  3FUZ A;  3SES A;  1IXG A;  2V3U A;  4FAT A;  5H8F B;  2DYX A;  2UVJ A;  2O84 X;  3SEX A;  4M4G A;  2DQV A;  4DXU A;  1YCJ A;  3IOU A;  4ZEC A;  3K6W A;  4IGR A;  1MQJ A;  5ICQ A;  1UIV A;  1P1Q A;  2RCB A;  2Y7W A;  2O6A A;  4ZZE A;  3K1M A;  3MP6 A;  1B5J A;  4L17 A;  5H8Q A;  1MY4 A;  1FTJ A;  1N76 A;  3RPW A;  2I58 A;  1PBP A;  1POT A;  1S9T A;  1PDA A;  2V93 A;  4IY6 A;  3DRJ A;  3O97 A;  5CRY A;  1OQH A;  4H1X A;  1Q35 A;  3SKP A;  4OWD A;  1MH3 A;  3B6Q A;  4N07 A;  3CSB A;  4RY1 A;  2HAV A;  3PPQ A;  1JNF A;  4ISU A;  1S7Y A;  3CIJ A;  1TFD A;  4RPO A;  4WXJ A;  1US4 A;  3O6H A;  1FTK A;  1YPN A;  5H8F A;  1EZ9 A;  4PFY A;  3KBR A;  1AH5 A;  3KEI A;  3FIR A;  4O3C A;  3BFU A;  3JZJ A;  1JVX A;  4R2B A;  3D4G A;  4E0W A;  3PAM A;  1A55 A;  1PEB A;  1SVX B;  4G77 A;  1A54 A;  5HBC A;  4JBZ A;  5CMM A;  3SEU A;  3O6G A;  1ATG A;  3PMX A;  4YZZ A;  4RJZ A;  3LBS A;  2WOP A;  2I49 A;  4X48 A;  4GF8 A;  4E0X A;  2I0B A;  1P1N A;  1SW1 A;  2XX7 A;  4U1Z A;  2UXA A;  4DE8 A;  4YAH X;  1R6Z A;  1P99 A;  3MZ9 A;  3M3F A;  4RYA A;  3K6V A;  4X1D A;  3G3G A;  3OEM A;  4MBP A;  3VVD A;  1FTM A;  5CC2 A;  3DLN A;  4U22 A;  1I69 A;  1RYO A;  1MXV A;  3U92 A;  4KFQ A;  1SD3 A;  2QS1 A;  4F1Y A;  3T9U A;  3FV1 A;  3MVX A;  1O7T A;  1NNK A;  2DE3 A;  4BDL A;  1XVX A;  1LB9 A;  1SYI A;  3S4U A;  2R9J A;  3FXR A;  5CMK A;  3E4R A;  4ZED A;  3C31 A;  1B3F A;  3O29 A;  4JWY A;  2VHA A;  3LSF B;  4ZE9 A;  4YU0 A;  1GTK A;  4Q0C A;  4G8H A;  2XXW A;  3DM0 A;  1ZU0 A;  4LQ2 A;  4MFI A;  1MDQ A;  3TCG A;  4GL0 A;  1ZMG A;  4RA1 A;  4PFT A;  2H4I A;  3FAS A;  3IO4 A;  3O9P A;  1MQD A;  1EH3 A;  2XD3 A;  3TZA A;  3HCQ A;  4R6Y A;  1OVB A;  2ONR A;  3IO6 A;  4QFN A;  3GZG A;  3FXU A;  3CFL A;  4DCY A;  2OLB A;  4R6K A;  2HEU A;  2DS9 A;  3N6U A;  2XXH A;  3CHG A;  1POY 1;  3RT6 B;  2YPN A;  4NMY A;  5AE4 A;  4G8N A;  1VE4 A;  2O69 A;  5H8H B;  2UYF A;  3Q28 A;  3LSW A;  3OMB A;  3PMV A;  3USD A;  1B1H A;  1DSN A;  4P0I A;  1D9V A;  1FW0 A;  3H6W A;  3OOA A;  5DEX A;  4BDN A;  1AMF A;  1M5E A;  1MM6 A;  2M8C A;  3IJX B;  3UIF A;  3KSJ A;  1B05 A;  3S9N C;  4TLM B;  3FVN A;  3D4C A;  3PUY E;  3V83 A;  1BIY A;  5TP9 B;  4FED A;  2GFE A;  2O68 A;  2REG A;  4XKN A;  3VXB A;  3QIM A;  5ELV A;  2P1S A;  1I6Q A;  3OO9 A;  4DDD A;  2VP1 A;  4X1B A;  1MM7 A;  3IR1 A;  5M2V A;  4ZZA A;  2NWJ A;  5J1D A;  2I4B A;  1LBB A;  1L5T A;  3RNN A;  3K1P A;  3K1N A;  3FZV A;  1LFH A;  5B7D A;  1MY1 A;  2F7C A;  4IY5 A;  2I0C A;  1URS A;  4R6H A;  2Q89 A;  2VD3 A;  1S50 A;  2ONK E;  3MC2 A;  4AQ4 A;  4ESX A;  4G8M A;  5H8N B;  2P2A A;  4YKK A;  3M8U A;  4O3A A;  4IO5 A;  4OEU A;  4F39 A;  4LVQ A;  3TCF A;  4DZ1 A;  2NVU B;  3T66 A;  4OMB A;  3U93 A;  5A5X B;  4OHN A;  3G7W A;  3MP1 A;  5TP9 A;  2KLF A;  4F1V A;  1M5F A;  1MPC A;  3A3U A;  3TMG A;  2FYI A;  4EXK A;  4F18 A;  2PBW A;  2ZNU A;  3ECR A;  3B7D A;  4H67 A;  2X7P A;  3FAT A;  4IO7 A;  4XXU A;  1M5B A;  3N6T A;  1QJM A;  2QPQ A;  4YIC A;  1TXF A;  5ITO A;  4ECF A;  4H65 A;  4F22 A;  1B6H A;  3ILU B;  2Q88 A;  1MXY A;  3VDF A;  4EF2 A;  4YB6 A;  4IO2 A;  5H8N A;  5L9O A;  2R6G E;  1XS5 A;  1JET A;  1FQA A;  5IKB A;  4GFR A;  3PUX E;  2W7Y A;  1JQF A;  2Y7R A;  3L6H A;  1DPP A;  3KN3 A;  2QMW A;  4KR5 A;  2AIX A;  5A5X A;  1R1N A;  5KCJ B;  2OZZ A;  1H44 A;  2AL5 A;  3GXA A;  1USY H;  1BLF A;  4RK9 A;  1B3H A;  5TU0 A;  2CMO A;  1YAE A;  2PX1 A;  2B65 A;  3K01 A;  3OD7 A;  3RGY A;  1SW2 A;  5JK4 A;  3VVF A;  2O1L A;  4THI A;  4NF5 B;  2QS3 A;  4KCD A;  3IJO B;  5DTB A;  2ZNS A;  1H43 A;  1B52 A;  3G3F A;  3MVY A;  1I6A A;  5I56 B;  4TOZ A;  1AOV A;  1OQG A;  1B5H A;  3KN8 A;  1SBP A;  3PPN A;  4DLD A;  3PMW A;  4F2O A;  5EHM A;  3U72 A;  3HV1 A;  3Q26 A;  4NWD A;  5KCJ A;  3TOD A;  2I3W A;  2XX8 A;  2Q8J A;  3MBP A;  4LUB A;  3FD3 A;  2PMS A;  3VLV A;  3PUW E;  1NNP A;  3PUZ E;  1ZTY A;  2F6P A;  3QXM A;  3P7I A;  3MVW A;  2PT2 A;  3K2D A;  1BKA A;  4U23 A;  3W9V A;  2ESN A;  2RF1 A;  4NF5 A;  1FTL A;  5I56 A;  2XD2 A;  5F1Q A;  2ZYN A;  3FJM A;  1MY0 A;  3OEK A;  3O6P A;  1URG A;  2I48 A;  3PGF A;  3E9X A;  1B7Z A;  4U4S A;  3VVE A;  1SW5 A;  1PC3 A;  3H3G A;  4P11 A;  3H4Z A;  3IX1 A;  2E0S A;  4BDM A;  1Y20 A;  1UIU A;  1ZKB A;  4Z0I A;  1XT8 A;  1FQF A;  3R26 A;  1MY3 A;  3OSR A;  4GOT A;  2XXY A;  1HSL A;  1A99 A;  2D5W A;  1N7W A;  4H6D A;  1UTB B;  1B58 A;  1LBC A;  5I2N B;  4OQO A;  1QVS A;  3IB1 A;  5FTH A;  4RK2 A;  4QSE A;  3IOR A;  1FQB A;  4PQJ A;  1VR5 A;  4PFU A;  1JW4 A;  3EPE A;  4OFL A;  3KOT A;  2OJT A;  5ISU A;  2Z23 A;  2F5X A;  3QAX A;  1O64 A;  2QL3 A;  5DYH A;  2RC9 A;  3K02 A;  4LZ8 A;  2RIN A;  1MS7 A;  1VSO A;  3TDJ A;  5L9S A;  5JEI A;  2A5T B;  1JW5 A;  3MAM A;  2THI A;  4LZ7 A;  4IGT A;  1B4H A;  1MXZ A;  1XHY A;  5DVI A;  2F35 A;  4PET A;  4LP2 B;  4RXL A;  3RN8 A;  1P1O A;  1PB9 A;  4RNS A;  5L9M A;  2IEE A;  3KSX A;  1B32 A;  3LUY A;  2H99 A;  3S9M C;  3DRF A;  1BP5 A;  1OLC A;  5I2N A;  1LAH E;  1DPE A;  3TTR A;  3V8X B;  2RC7 A;  3O6I A;  1Y3Q A;  5B70 A;  3PD8 A;  1WVJ A;  1H45 A;  4NF8 B;  4LAT A;  1A8E A;  2BJJ X;  4R72 A;  3MW0 A;  4KD5 A;  4OEN A;  4OXV A;  1IIW A;  3RLF E;  3U1O A;  3TUS A;  3N26 A;  2DXY A;  1Y9U A;  2A5T A;  4C0R A;  4HTG A;  2YLN A;  4GLI A;  3TTM A;  4DXC A;  2P0S A;  3ILT B;  4GWO A;  1OVT A;  2ALU A;  2QSX A;  2PT1 A;  2AL4 A;  2DWJ A;  4GVO A;  1SDX A;  2IA4 A;  1TT1 A;  3DRG A;  4UA8 A;  1R9L A;  1P1U A;  3SEV A;  2GHB A;  1MQH A;  1IZ1 A;  1LFI A;  2XXQ A;  2DWA A;  1ZBM A;  5HPQ A;  2LAO A;  3K4U A;  4OVJ A;  5TPA B;  1EZO A;  1SI1 A;  3A09 A;  3EN3 A;  4KQP A;  2RC8 A;  2H25 A;  2RKM A;  1A40 A;  3V5A A;  4XKR A;  1MQG A;  3OEL A;  4HCW A;  4OER A;  1D4N A;  2CZL A;  4O3B A;  5CMC A;  2HQ0 A;  5FTI A;  1VFD A;  2O51 A;  3FVK A;  3BKI B;  3E13 X;  2V84 A;  3G3H A;  1DTZ A;  1VFE A;  3TTL A;  2UVG A;  4LQ5 A;  4JWX A;  1AL3 A;  1ZLQ A;  3KOS A;  4GL8 A;  2R71 A;  2ZXT A;  5TPA A;  1NKX A;  1HSE A;  1NH7 A;  3OO7 A;  1EU8 A;  2HAU A;  3TQL A;  4I62 A;  2DWI A;  4KI0 E;  4N6P A;  4YKI A;  3I5O A;  4WED A;  1FCK A;  4F1U A;  1ANF A;  5H8H A;  3VV5 A;  1FQC A;  3ZSF A;  1LCF A;  5CM6 A;  4YKJ A;  2VD2 A;  3K6X A;  3F11 A;  2UVI A;  3OO8 A;  2VGQ A;  4FOR A;  4GD5 A;  1B3L A;  1IUD A;  1Y1Z A;  1PB7 A;  2X7Q A;  4OYV A;  4R2F A;  4AB5 A;  3M3L A;  2OBG A;  1II5 A;  1QUK A;  4ZEF A;  2XXP A;  3ODB A;  4NED A;  1QKB A;  3FJG A;  3K00 A;  2DP8 A;  2HCA A;  4POX A;  3IOW A;  4NF4 B;  2DE4 A;  3T9V A;  4GIZ A;  3Q27 A;  4LON B;  5AA2 B;  4ZE8 A;  1T0K A;  3MZB A;  4I1D A;  3TTK A;  4EF1 A;  1IQ7 A;  1IXH A;  2H98 A;  4GXA A;  3GLB A;  5K2Y A;  4ELQ A;  1J1N A;  1TWY A;  3W9W A;  3N94 A;  1CB6 A;  3PUV E;  1Y1M A;  4G68 B;  3KZG A;  4R9F A;  1F9B A;  1IXI A;  3GBA A;  1UQW A;  1DMB A;  4NF6 B;  4EXL A;  4QSD A;  4PP0 A;  2XXV A;  3MPK A;  2Q2C A;  4F31 B;  3T96 B;  3DEL B;  2A5S A;  3HN0 A;  3HHF A;  2XX9 A;  1YTV A;  1SQY A;  3IOV A;  4NWC A;  2QS4 A;  1Z7M E;  4I9D A;  4ELR A;  3I6V A;  3MVZ A;  1B46 A;  2WKY A;  4NF4 A;  1FQE A;  3VLW A;  1B2H A;  3FVG A;  2XXT A;  5AA2 A;  2V25 A;  2XXR A;  3MJN A;  3O28 A;  4YB5 A;  1AIV A;  2HXW A;  1XVY A;  2ONS A;  4F29 A;  2REJ A;  2D3I A;  4F3P A;  4POW A;  2Q9T A;  1B7U A;  1MXU A;  4C1U A;  4IO4 A;  2DVZ A;  4G68 C;  3PPR A;  4G68 A;  5AA1 A;  2NXO A;  1LAX A;  4H0W A;  5BUU A;  4YB7 A;  5I84 A;  3GBB A;  1NL5 A;  1ZIU A;  4NF6 A;  5AA4 B;  3SER A;  1Z7N E;  1A8F A;  4F3S A;  3OXN A;  1SW4 A;  2QS2 A;  4WEP A;  1GV8 A;  2Z22 A;  1IIT A;  4F3B A;  3TCH A;  4OZ9 A;  1QW0 A;  2AYS A;  3ZKL A;  2PVU A;  3DRI A;  2WOK A;  4XKP A;  1B5I A;  4JSD A;  4H5F A;  1XOC A;  3LSL A;  4HCY A;  1H3D A;  1LCT A;  3T9H B;  3EHS A;  4QRZ A;  5ICT A;  4FE8 A;  1XC1 A;  2QJE A;  3RQT A;  2V3T A;  3IL1 B;  2Y7I A;  4RPN A;  1B0H A;  3DRK A;  3FTO A;  1OIB A;  2O1M A;  4LA9 A;  4QFL A;  4KHZ E;  3OSQ A;  1UTH B;  5KDT B;  4QSC A;  1O63 A;  1MH4 A;  1CE2 A;  2V3Q A;  3SET A;  4QFO A;  3IB0 A;  4KPT A;  5L8D A;  5CBS A;  4EDP A;  1NNT A;  4ESW A;  2F34 A;  2B4M A;  3PV0 E;  2I4C A;  3PPP A;  1HSJ A;  4GQO A;  3L6G A;  4IB2 A;  4K3F A;  4YKP A;  3RYA A;  4X9T A;  4N13 A;  3VFJ A;  2O7U A;  2VOZ A;  2Z8E A;  3VLU A;  4OET A;  5DVF A;  4ZEK A;  5FHO A;  1JEU A;  3QUJ A;  2OK2 A;  4Q5T A;  3FVO A;  4UAC A;  1N0T A;  3Q25 A;  2B4L A;  4IO3 A;  3MQ9 A;  1Y4T A;  1NFT A;  2Y84 A;  3A3C A;  4M1V A;  1N84 A;  3TPA A;  1B0L A;  2DXR A;  4OFO A;  1UTH A;  4QHQ A;  3H03 A;  3I3V A;  5KDT A;  3C9H A;  4OFJ A;  3DP8 A;  2DWH A;  2FA7 A;  1M5D A;  2F97 A;  3EHU A;  2ZYK A;  1LAF E;  3G3K A;  3JV9 A;  2NOO A;  2O7I A;  3H06 B;  2I3V A;  3QK6 A;  4PFW A;  5HM4 B;  4BDR A;  5KZT A;  4P0G A;  1QUJ A;  1B51 A;  2Y7K A;  3T22 A;  3C4M A;  3UK4 A;  2F36 A;  2PYY A;  4F3G A;  2QRY A;  3E3K A;  5H8S A;  3ONM A;  1MQI A;  4ZDM A;  2B3B A;  3ZKK A;  3PPO A;  1QUI A;  1ELJ A;  2HZL A;  4YMA A;  3EHT A;  4G2Z A;  1UTB A;  3RTW B;  3MWB A;  3FV2 A;  3QYT A;  3LSX A;  1N04 A;  3RUM A;  4IO6 A;  5K2X A;  2GH9 A;  2XXI A;  3PD9 A;  1N3W A;  2UVH A;  4R73 A;  1MXX A;  4R9G A;  5I58 B;  1M5C A;  3WAE A;  2Z8D A;  3H6T A;  4FEB A;  1LB8 A;  5I59 B;  4AB6 A;  1R9Q A;  2DOJ A;  2ZYO A;  3S9L C;  3JYR A;  4MLV A;  3KJT A;  3H6V A;  2G29 A;  4JSO A;  3OEN A;  3B6W A;  4LZ5 A;  1WDN A;  2GRV A;  1PB8 A;  2F8D A;  4HS7 A;  1MPB A;  1GVC A;  3S9E A;  3KFM A;  3BBR A;  2ANJ A;  4NE4 A;  4XIG Q;  2XHD A;  1N7X A;  4FEC A;  1D3K A;  3K0V A;  5DT6 A;  2F7A A;  1P1W A;  3CG1 A;  2RCA A;  1DOT A;  2ZMB A;  5DEX B;  3CVG A;  4R75 A;  1Y3P A;  2DE2 A;  3AXF A;  4NF8 A;  5I58 A;  1A7L A;  1B4Z A;  5I59 A;  4F19 A;  2E1S A;  4HW8 A;  3C33 A;  4G4P A;  5ITP A;  2FNC A;  3UOR A;  4NTL A;  4XKQ A;  1MRP A;  4F2Q A;  1MPD A;  4EQB A;  3O66 A;  4ELP A;  1LAG E;  3UGW A;  3LC8 A;  2Q2A A;  1TFA A;  3ZS6 A;  4U1O A;  1B3G A;  3EF7 A;  3IK6 B;  3QSL A;  3IAZ A;  4Z7E A;  3DP6 A;  4QFP A;  3TFL A;  3KJ7 A;  4QF9 A;  3CFZ A;  1B9J A;  4ZEI A;  1JW1 A;  1OMP A;  3M3K A;  1Q1K A;  4Q8R A;  1B40 A;  4U21 A;  3CFX A;  3HST A;  4TQU Q;  1KWH A;  4KYD A;  3C35 A;  1NH8 A;  4OTE A;  3BFT A;  2OWS A;  3C34 A;  1B1X A;  4H8I A;  2QMX A;  4ZEB A;  1BTJ A;  4KCC A;  3Q29 A;  4XTC Q;  3UA8 A;  1LFG A;  5I2K B;  3T93 B;  4BDQ A;  4DCX A;  1N3X A;  1IEJ A;  4MLQ A;  3FXQ A;  3CRB A;  5I57 B;  3K6U A;  2G93 A;  2OCU A;  2F6G A;  1D9Y A;  5CBR A;  4KYS A;  4ZS9 A;  4PE5 B;  5F7V A;  4GRK A;  4JWO A;  3MPL A;  1WOD A;  1B7H A;  1NMU A;  5JTY B;  5CI5 A;  1FQD A;  1OLA A;  3C32 A;  1USY E;  3UP9 A;  2UYE A;  3TQW A;  3WAF A;  4R74 A;  3MUQ A;  1MY2 A;  4FIM A;  3TTN A;  2WOL A;  1ZJL A;  4H8J A;  3H7M A;  3G3I A;  2D21 A;  4H5G A;  5BWJ A;  3R7X A;  3EQ1 A;  2X26 A;  4GXS B;  3THI A;  4ELO A;  1EZP A;  5I2K A;  1IXC A;  3KGC A;  3HO7 A;  3T9X B;  1H76 A;  2XXU A;  5FHM A;  5I57 A;  2Y7P A;  4DIG A;  5IAI A;  5FHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...