1B88A

V-alpha 2.6 mouse t cell receptor (tcr) domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
114
structure length
114
Chain Sequence
MQQVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSNKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAASASFGDNSKLIWGLGTSLVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR V-ALPHA DOMAIN
publication title The X-ray crystal structure of a Valpha2.6Jalpha38 mouse T cell receptor domain at 2.5 A resolution: alternate modes of dimerization and crystal packing.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 19
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b88A00
2LVCA 2I07B 4HPYL 4HDIA 3QIUB 3L3OA 4FZEL 1HCVA 4TRPL 4I0PC 5EULV 1HYSD 2DYPD 1LNUB 5BRZA 4FQ2L 4RFNC 2MKLC 4NZUL 2CRZA 3KPMA 4HUMB 2HT4C 3OMZA 3ILPA 3RU8L 3OAYK 3ARXA 4MMXC 4YC2B 4Y2DA 4UT6H 4IIQB 3ARFA 1E0OB 3JTSB 1W72L 1FFRA 1IAKA 5GZNC 5AEAA 1QFHA 3T4YB 3BP4A 4M00A 5IG7A 2CIKA 2P47B 3MRHA 4S2SB 4MXWL 2O5ZH 5FO8B 4P4KC 4B41A 3VXSA 3PP3H 1MF2L 1YJDC 2Q7YB 3K7UA 4M93B 5I16A 5HDBF 4JFFE 2YBRA 4RMRA 3VXRB 4ZFOA 1BPVA 2FBJH 3Q6GL 4U6VL 5DD6A 4JO4H 4D2NA 1GH7A 4ZOCA 3TBWB 4XMLL 3IXTB 4G8FB 2O26U 1D5MA 2ZG1A 2OK0H 1N59B 4NQCE 4WW1B 3CVHB 3ETBF 3MLXL 3TC9A 1CXFA 1AR1D 4MQXD 4GG8A 1S9VA 2GITA 3S5LG 4O9HH 1T0MA 5IKCB 4ZS6C 4P9MH 1RVFH 1D6EB 5C0NC 5TH2B 3WLBB 5I1JH 3V5DA 1JGDB 1MH5B 2VQ1A 2DMCA 3FT3A 5IMKB 2E27H 3ULVD 2X4TA 3K4AA 4G5ZL 5B39B 1BBJB 3U6RA 4XCFL 1P84J 2MOVA 1NAKL 1T7VA 4UV4L 1KTKE 4MNHB 5ADOL 3GSOA 5I9QB 1BHGA 1RU9H 1IL1B 2UUDH 4NQDB 4Y1AA 1G7QA 2BY2A 3MLZH 5LAXB 4Z77B 3OG6B 1Q8MA 4GRLA 4RISH 4JFZH 1K8IA 1OF2A 2NY4C 2VLJE 5CSZA 4UTBH 3BPLB 4X9GA 3TJEH 1TQBC 1A8JH 1GGTA 4OZHA 4F15C 4MJ4A 4RMQA 1KEGH 4OUOA 1TPXB 3TNNA 5K9OA 4ZPTA 3AREB 3DHMA 4I18C 5FA3B 1KSRA 4GLRI 4I0PD 1CXIA 1KCSL 5DHYB 2FR4A 3T4AB 4JM4L 5CEZH 2KZWA 5KJRH 4JANB 4UT9H 2HT4D 3MJ9L 1PG7L 2D7PA 3HCVA 2A73B 5E99L 1I9IH 3QEQE 5GRYA 3RNKB 1RD6A 3FQWB 1JI2A 3IKCA 2OYPA 3U46A 2IBBA 1MCOL 3MLUL 1K8DA 4OZFG 4I2XE 5GZND 3TP4A 2KKQA 5CUSL 5DRWA 1ES0B 5KSBB 2VDML 4P4KD 2EEBA 1P4LA 1V7NH 2PXYC 2V17L 3K2UL 3TM6A 4P46B 1QRNB 3Q3GB 4YUEL 1JUFA 3FQNA 3K8KA 1DBMH 5HHVL 2HKFL 2Q1EA 4CMMB 3WNOA 1YNTA 1I9JH 3D3VB 3BDYH 4D94A 1KXQE 2WUCL 4HV8A 3ARDC 1KLGA 3DUSA 5HHOE 5HYSB 4F33A 2P4AB 3KPLB 5EBWB 2DLEA 2YD4A 5I8OH 1WBYB 2Y7QA 2JJVA 3NCMA 4NSKB 5EUOE 2J6EA 4PUBL 3QNXA 3BISA 4O5LH 2F9BT 1LEGA 2Z92A 1XCQB 4ERSH 5C0AE 3MNVA 4D9QD 1NSNL 4YHNA 1ZANL 2QBWA 5DS8A 2CGRL 1YEKH 3WD5L 5J9PA 4K94L 1T04A 1G6RA 4EN3A 3N85H 3OKEB 4C56D 5I1GH 2HWZL 4NCC1 2HTLC 1P7KA 4XBEH 5FUOL 4Q58C 3PE9A 3F6IA 4PG9B 2R1WB 1W0VA 4MZ2A 4JFEE 1QBML 2M1KA 2A6JB 4U1JA 2IPTL 3S34H 2XWJB 5BV7L 4B5EA 4OV5B 4AIOA 1BF8A 2BNRD 2NY4D 4DW2L 4LSQL 1F4HA 1YMMD 3NN8B 4L29B 3KPQB 1Q9LA 2K7PA 5HI4C 3MLVL 3BD5A 1M71B 2F74B 4PBXA 5E8PB 3FQUB 4LRIC 5HGAA 3WS3B 3AFLA 2VLRB 5JDSB 1G9ML 4JO3H 1IAII 5MENB 3QQNA 4QHKI 3G04A 4IBLT 3DX8B 3CFCL 1G7JB 4BQ6A 1JYXA 3GSNL 1JPSL 3JTTA 4YDVB 4GSDH 4P23B 5DHVA 2RCSH 3KPSA 4MD0B 3JV6A 3QUKA 4IRSC 1JK8A 2GHWB 2QLVB 2DQTL 3HNSL 1CDBA 3HE6A 1UCBH 5HYJE 2P7TB 5GGTH 4K71B 4JM2A 1N8ZB 4CN4A 1O5DT 5BW7A 2J5LC 4TSBL 1U93B 4D0BB 5F9AC 1NUFA 1S78C 1ZWIB 2WBJB 3C5SB 3O81A 4AIZA 1H0DA 2F54E 5HHNB 3BSZH 4LLUA 3ARGB 3KPTA 5DVLA 3WSQH 4XZUB 5JQ6L 1M05A 2PXYD 3QDJA 1NFDB 3F5WA 4P2QB 4OFYA 5IVZB 3MNWA 2A9NH 1CU4L 5F6HJ 4JJ5B 4LVEA 4I0PA 3MV01 4NC1C 2HH0H 1EJOL 3T1FB 5HHPA 2A2QT 1KB5A 1ZHNB 2VDOL 3QQ3A 3ARDD 4WTWA 4PRDB 3FCTA 3UX9B 3O11A 3BIBX 4NN5B 3VE0B 5A1AA 2IBGA 3OPZH 2E7CA 5HJ3A 1S3KH 3FQRB 4FRWA 5CFHA 4KI5C 2RR3A 4AK1A 3RWFA 3KDMA 2V7NA 1DSFH 4L3ED 3W9EA 4E5XB 1FE8H 3RJDA 4K9EL 3FT4A 1T80A 1TVBB 5K59F 2JB6B 1UXWB 2Q86A 1OT2A 3EOTH 5AD0A 1ZVSA 4R96B 3H9SB 3BKMH 3O6FC 3DNKA 3SE8H 1ZHLB 5IOPA 5GGQH 4WI6A 1FIEA 3HR5A 1F3DJ 4HWBA 1N6UA 3DRTB 5E2VH 2I5YL 4W6YB 2HVKB 2D7TH 4X7FC 3EJZC 1VFAA 1FFQA 2B2XH 2EDNA 4KJYB 4L4TE 5T3XH 1C5BH 2Z8SA 3TPUA 5HI4D 5HHMB 4HIJB 3OBAA 4LPYA 2CIIA 1ORSA 4GAFB 1F2XK 1FYTE 3FO0L 1UCTA 4WDIB 2DBJA 4FTVB 1JWMB 1BIIA 3VXNA 5FUZL 5HBBA 4EI6A 5F9JB 4IRSD 2DQDL 1NEUA 3ZKNC 3OF6A 1ZTXL 1KPRA 1QFWI 4ZFZB 3TYFB 4G9FB 4X8JB 3KG5A 1JZ2A 4ODXA 1G9NL 3VA6A 2V5SA 2XTJB 3FRPG 3D39D 3EBAA 1WFTA 5AG8A 2BHUA 2VXTH 4HS8L 1NGZA 1A7OH 2FX8H 1S78D 1QKZL 1TTGA 2NYYC 3X14A 4L8CA 4WY7L 3E2HB 4R90H 3C5JB 1E4XI 1KJ2H 1U8PB 5J89A 4YK4B 3UJTL 2UYLB 1YY9C 1I1FA 3ZT5A 3P73A 1KNOB 3V4UH 2XZAL 2PO6C 4XNQB 3D87B 4GW1B 1EUUA 2M26A 2VE6B 3CUPB 3B8SA 4PJIB 5DO2C 4NO5B 2QEJA 3ZO0A 3GSRB 4PJ9C 1ZS8A 5ESAA 5DURD 3DOSA 4YXLH 1JL8A 3F58L 2X4RB 1JPFA 4XC3H 5IHLB 1JPST 4GO6B 2BC4B 3G5VB 4LCWB 1HKLH 3GRWA 4IEFB 1X3DA 1MFDL 4JKPH 4DGIL 5ID0A 4KI5D 1KG0B 5T1DH 3ROOB 3C8KB 1N0XL 2UY7A 2PXYA 3GSVA 3V6BR 2OL3H 2OCFD 1RUAL 3O9WA 4S1SH 4YAQB 1QSEE 4GT7A 4NQVA 1OP5K 5JW5A 3WNKA 4Z7WF 1DBBL 3O6FD 1P4IH 4WHTB 2XY2A 5MERA 1CG9B 4NFDA 1S7TA 3MRFA 2XI9A 2Q76A 1BQLH 1TJHH 3AUVA 3LKSA 5IVXB 1R5VA 3QRGL 3EJZD 5FIEA 4X6BB 1VFMA 3ZYOA 2PYFA 4PJGE 1C7SA 3BRDA 4ZUUB 4L3EA 3IGAA 5DK3A 2X09A 2YD3A 1DEDA 5MEPA 3LQAC 3PQYD 3P0YL 5ICYA 2AJZB 3CFBA 1I7ZB 4LHJB 5GZOC 3QHFH 3X3FH 3ZKND 4HPOL 2ZUYA 3JWDC 2D03L 1QD0A 2YC1B 3BP5B 1ETZB 1HIMH 2NLJB 2VAAB 1XF5B 1UXSA 3HN3A 2X70B 3A6BL 4H5SB 5C2BL 1D5XB 3O45A 2CRMA 5CMAA 1DLHA 4LRIA 4TQEH 1MFAH 5EH1A 5F7FA 3WDJA 3GGWB 2NYYD 5HI5C 5DA4A 4ACPA 5H94A 1TJGL 1VACB 4OQTL 4OGYH 1YY9D 4JRYB 4L4VA 1TNMA 5GIRB 1R0AL 5D7IF 3T0EC 5A2IH 3JV4A 5I1LA 1QA9B 4O4YL 3HHRB 5DO2D 5GRJH 3ULVL 4PJ9D 3W2DL 3ZZ1A 3SE3C 2GCYB 2Y4SA 1DQMH 5FGCE 3IFPB 1RPQA 4HF5L 3O2VH 2ZUWA 3D39A 3CSYB 5T1KB 4Q97A 2XQBL 4U0RB 2LU7A 1TZIB 4HIHB 1S9YA 2NY0D 5IMOA 3PXHA 3IDIB 4JFHE 2BZDA 5DD5L 4QRSA 3S37L 1RJLB 2R0WL 4KRLB 3S36L 3D48R 4WV1A 4RFEB 4FOMA 4LGPB 4AEIH 5LG1A 2IALA 2YXFA 3VWKB 4PJHB 5IV2B 3BUYA 4X98A 4KVNH 5SWSE 3MFGB 4XI5C 1RJYA 4ELMB 4HUKB 3WKML 1RZFH 2ZUUA 4PJBE 2QKIA 1AC6A 2P5EB 5GS0H 3UTOA 4Y1AE 2IANB 1T1WA 2X4OB 3DYMA 3MV8B 3VXMA 2D0GA 3CIQA 3SE9H 2VL4A 3KYKH 1H8SA 5GJTL 4DN3H 4APQC 1Q9KA 2XQYK 4ZS7H 4B7IA 3WFDL 1Y18B 4OZFA 4IOIA 3MR9B 2ATKB 4LSTL 4EQ3A 4EXKA 1LO3H 3VD9A 3KGRA 2HJKB 3VH8G 1WGOA 3MRIB 3NFPA 1ZHBB 3SEPA 3U9PL 4NHCH 2AKRA 2HTKC 3QP3A 2VIRA 3NCEB 4ODVH 5J1AA 5KSVB 2MQ0A 1YJDL 4NHUA 5TFSH 4KVCH 1F4YH 5GZOD 2FSEA 4K8RL 2XRAH 1JYNA 3L5XH 1HHKB 1NPUA 1DUYA 1CLYH 5DJDB 4Z76B 1YEFH 1J1PH 3DROA 4ZD3H 3GMNB 3PWLA 4Y5VB 3F65A 2X4UA 3P2TA 3G6DH 4PRHE 1E27B 1XCTA 2V2WB 5DQDL 5I1DB 4GMTH 5HI5D 5C08B 1QRKA 4LCIH 2I26N 4UOW1 4PJ7F 5HTSA 5JORA 4XP9L 1RURL 1YN6A 4MJ2A 3OJDA 3VI4F 3C6LA 4FFZH 4WU7B 1TJIL 5TJWK 4KZDL 5B8CC 1YYML 2KBGA 2P5WA 1JF1B 3V52L 4F7CA 3QUZA 5CJBA 5DYOA 4LL9A 2F5AH 4M8VA 5DFWH 2BNUA 1WSST 3LN4B 1NCBH 3V0VA 2X40A 1FVEB 3ULUD 3OKDA 1R3HB 4LAJH 5DEGA 3UPRA 2H6PA 4JAMB 2NZIA 2YN5A 3M45A 1AHWC 4P5KA 3BE1H 1J18A 2FJFA 1MLCB 4PV9B 4XNYH 1MWAA 1U8LA 1OAQL 3TBVB 1LP9A 5I19H 2QADB 5IB3A 3IDMA 1NMAH 4X7EC 4P4RB 2A9MH 3CH1A 3WCYA 1VGKA 2PO6A 2X9YA 3BESR 1EFXA 2HT2D 3ALPA 4BUGA 4EOWH 2ZCLH 5FHBH 5CZXC 4L3CA 4HUVA 4XI5D 5ID1B 1RI8A 1MFCL 1YPZF 2HVJA 5ESQB 5K9JL 1IEBB 1V7MH 4PJEB 1NCWL 2CXKA 3LHPH 3L95B 4FXGA 3ULSB 2OI9B 3FKUS 2WQRA 5I6XB 2VQUA 3VG0H 3HNVL 4APQD 2H32A 3MLPA 4AJ0A 2NQCA 1HOCA 4YIQA 1DQLL 2JKXA 2ZOKA 2GJ6D 4PJ8C 1DUZA 2Y06L 1AKJB 1CDJA 5KVGH 2HTKD 3EO9H 5C0FA 3T0WA 3O6KH 1KF9B 5IJVB 3HAEB 1DQDL 3IU3B 3ULVE 2FJHA 1JZ4A 5DQ9B 4L8SC 1FFPA 3VD3A 1FH5L 3QUXB 2DBLH 4RIRB 2W9DL 1YNKL 3KPOB 5D9SB 3TT3H 1SY6H 4R26L 4HKJA 4NO3A 5FM5M 3FQTB 5SX4I 1IM9B 3PWUB 4PJAB 5C0CD 4OZIE 1KC5H 4RMVA 2V5MA 1JZ5A 4JPIB 3LN5A 2CD0A 1FFOA 2FYYB 4OCXH 4NYLA 5E5RB 3I3DA 1RAMA 4DCQA 2AI0L 2Q3ZA 4F7MB 2XN9B 5HYQA 1F4AA 4H88L 2Y07L 2VABA 2MCPL 5HVHC 3GBMH 5D96C 4W68A 4I13B 4PJCE 4EXPX 1NFKA 1AJ7H 4PRIA 2VL5A 2R4SH 1M6OA 1JMXA 4OT1H 1LO4H 3ELAT 2G9HA 4ZXBC 4GUPA 3QCVH 1LD9A 1T03L 1FG2B 3OWEA 1AD9B 5AG9A 3T0EA 5FYJD 1OAKH 3WJJA 1S8DA 1C16B 1UWXH 3GMQB 4QOKD 5MEQB 5C70A 4M9PA 2VUOA 5D5MB 5FYLD 3SE3A 4ZNCD 5H35B 3VA2C 5EU7C 4Z7QE 5F7WC 4HLZH 2NTSP 1GPOL 2DTMH 5T1LA 1XGYH 1D5BB 4Y16B 5F3HA 4EVNB 4KH2A 1CXKA 2ITDA 2BNQA 4KV5F 2DQHL 4OQ1A 4O2CB 4PJ8D 3D2UD 4WUUB 5C9KA 2EIZB 3VFTA 4LLWA 4D9QE 5ETUB 3DSFH 4D9LL 4AQ1B 3HAEH 4X5XA 2QQKL 3TA3A 5TE6H 4NKOB 1A7NL 1W8NA 3QUYA 1OD7A 5ERWB 3DGGA 2GFBA 2JJSA 1N3NB 4C56E 3VFRB 1OTUC 1ITCA 3RX8A 2EKSA 4G42B 2Z31A 5JXAH 1CFBA 1ZT4B 2VB5A 1DTUA 3SBWC 2Z35A 2GQHA 4LRNH 1OAYH 4APQA 2BNRE 4M03A 5I1IL 1YMME 4OIIL 3MJ7A 4WWID 3UTTD 1BFOA 1EZVX 3PL6C 3IRZA 1WZLA 4NWUL 3NH7L 2B5IB 2B4CC 5F6IC 2P8LB 3ILQC 4XVJL 3HZKA 3FB5A 4WEBL 3D0VB 1GGIH 4XAWH 1RZIA 3GEWB 3NZ8A 3TYGH 1MHCB 1N6QH 3UZEA 1IKNC 1JYVA 3LQZA 4U31A 3QR2A 2VQTA 1IC4H 3M8OL 4YX2L 3V2AR 1RJZA 2N4IA 1FORH 4YFEA 5F7DB 1RQ5A 5FA4A 1JHKL 5EUKA 4M6MH 1V5JA 5IT2L 4S0SD 1OM3L 4NP4H 4LHUB 4S1QL 4KXZH 4ZXBD 3VFGL 1IBGL 1QSFB 1GZQB 4O2FB 1OQXA 3P4OA 1I7RB 3IF1A 4X0KB 4NOFA 3MBXH 2HFTA 3OGCB 4R97B 5DC0A 2L7UA 5BJTB 1SBBA 1KGCD 3QHTC 5ISZD 1XR8B 1P4BH 3IDJA 1IAIL 1AHWA 3QO0A 5B3JF 1NGXA 4H1LA 3DMMA 2H2SC 3PF2A 4NUJB 35C8H 2DLFL 3ZKSD 4GKNB 2FD6H 5KSAC 4XHJC 4Y4FB 4E41A 4LVHB 1ITBB 4L3EE 2GSIB 4YNYA 3QNYB 3KYOB 5IMLA 3SKJL 2W65A 5ANMB 1CXEA 3I75A 1J87A 2A6IA 5H2BA 1CR9H 4QOKA 5F7HA 1LDPL 2EE2A 4H26B 5I30L 1KCRL 3C5ZC 1OTUD 1DBJH 3QQ9C 3R8BB 4HX1A 3EW3B 1MAJA 2AJ3A 3BPNB 1NDMB 1MUJB 5FUCC 4HK0B 2H9GA 5LXGL 2HN7B 5EC2B 3EYFA 2A38A 1LE9B 1X5ZA 3DTXB 4Q9BA 4U1SB 1MHEB 2CLVA 3P0VH 3PL6D 1ED3B 1F00I 3GMPA 3CC5B 3TH2T 5IJKC 3E0GA 4OM1L 4WWKC 3VGAB 3FO9B 4ZDHB 3CLFH 3CSBA 3ILQD 3PDGA 1GHFL 2IPUG 3BDBA 4P0DA 2J2ZA 4EJ1C 3NPZB 3LAFA 4JFQA 3M1BA 3VFNB 4NQCB 1U3YA 3ALXA 3ZLQC 1DBAL 4ORGB 5JNYB 2GJZA 4KGLA 1KB9K 1DQTA 3D39E 1A1NB 2R2BB 5E2TH 1HH9B 1JE6A 1TVHB 3HKFA 4G3YL 5E00B 1HE7A 4W4NA 4DVBB 4N8CH 1H5BB 2YUVA 3O2DL 3BN9C 3DVNB 2Y5TA 5F88B 2V2XB 4OD1H 4PS4H 1YQVL 5CS7A 1SVZA 1RK1B 4NC1E 1EFQA 3QIWB 2APWA 1C8PA 2DQJH 5ICXA 2GTWA 3LH2H 4NN7B 4O51B 3GHEL 2EC8A 3EYVA 4UQ2A 3SO3B 2VLJB 1LEIA 3SJVD 2ESVA 5IBTL 1UWEH 2H2SD 4PJDE 1NMBL 1QFOA 3PG2A 4Z7UF 3S96A 5AWNH 2ICCA 4KI5E 3QFJB 2FB4H 4XHJD 5KSAD 1YEJH 1YEGL 3UJJH 5A40E 5B4MC 3P4MB 3T77A 4OUUB 5CINH 1RSFA 4IOFC 3QWOA 3LV3A 4EI5B 3TH3T 5FGBC 4K7FB 3RGVC 2DQCH 5JIPA 5HVGB 5B39G 1HHIB 1J0ZA 1G7HA 5IHBA 3C5ZD 5FOBB 3GSNA 3QQ9D 1AGFB 4KY1L 4RMTA 2A6KB 2YZ8A 5KW9L 3QH3A 1KLUA 3IAQA 1UQSA 4MAYB 1J8HD 5KG9B 2F8VA 5MP6L 3ULUL 4HFUH 5IVNA 4I2XB 4U3HA 5CJOL 3P77B 5SV3A 4XNZC 4FZ8H 5DRNA 1OHQA 4IDLA 6CGTA 2ZCHH 5GGRA 4JDVB 2J1KA 1FNEA 1JPGB 5DHXB 2UWEF 5IHUH 3L9RA 1GGBH 1TFHA 1MFBL 4F8TA 3WO4B 4WWKD 1DVFC 3PQYE 1RZ7L 4QXUH 3GMLA 4PTUB 3H9ZA 5EZJB 1IC5H 4F58L 4NO0B 4FQHB 2HFFB 1LO5B 2IEPA 2VXQH 2XWBB 4QRUB 4ZUSA 5FB8A 4IRZL 3N1PC 5HHOB 1A7RL 4K3EH 1OWWA 4NQED 1FL6A 4CN1A 1SEQH 1I8IA 4PGCA 5DI8B 4D0DB 4YHKH 4LKCA 5JW4R 5C0AB 3PL6A 4K3DH 4L8BA 3QPXH 5JR1L 1IGTA 1XGTB 5INDA 2R2HA 5I75B 1NANH 5FHAL 2YPVH 4MYWB 1A3RL 2GSGA 3LKQB 4J6RH 1NMCC 3MXVH 5DVMA 2MCG1 2H2PC 4LCYB 1K4DA 2G5BB 3VWJB 4JDTL 4Z0BL 3BH8B 3MROA 1NBVH 1UFUA 4KMQA 4JFEB 4YHIB 3MXWH 1IKNA 5D93C 1BP3B 5AUMB 2ZOLB 4CVWA 3BW9B 1A1OB 2Z91B 4Z8FH 5KOVC 1Q0XL 5DEZA 4HQQL 1OAXH 4X6DF 4TVPL 4YC2C 2XPGB 3GBNL 4ALAH 4YEEA 1J5OH 1X5FA 2FWOA 1CFTA 3IDXH 4ONHB 4PB9H 1S7XB 3MJ6A 3BP6B 5GRUL 2BSSA 2LABA 1MAKA 5B4MD 4HC1L 2VLLB 4RZCB 5D6DA 5E4EC 4AMKH 1MCPL 4O58H 5GXBB 4Y4KA 4JG0H 3UXFA 2VXSH 3RGVD 2DLGA 4M93C 4ZO6A 4QT5B 4K23H 5ITBL 5ITFB 3SE4A 4GRWE 1CGXA 3I02A 1JCKA 1BVKA 4U6HB 3T1WA 5JW3H 3QXAA 5AZEL 1Q72H 4JE4B 3V6ZB 5ENWA 1VFBB 3ZL4H 2AV7B 1I9EA 5F93C 3EFFB 3U4BH 4J3TA 1WIOA 2F54B 2VLKA 3SDDA 1MI5B 5KSAA 3BRFA 3HE7B 3P0GB 3G08B 5FM8A 3LN9A 4L3AA 4JPVH 3BPCA 2WWMC 4M5ZH 5EN2A 1DVFD 2EDOA 4J1UB 3GIVB 3FN0H 5ILTL 4ONGL 2WMPA 2ZUQB 1A2YA 1K6QH 4ONFL 2VZUA 3IFLH 5DD1L 4HCRL 3EO1A 2FGWL 1DL7H 5FYLL 1CWVA 2BSRA 2DQIL 1U8QB 3FRUB 3RNQB 1DZBA 3D85A 1E4KC 3LEXB 2VLMD 4XP6L 2YPLA 1BM3L 4FXKA 4P59H 2RJMA 3X3GH 2AXFB 1AP2A 2CKBA 3TBTB 1MCCA 2VR9A 4MDJA 3PP4H 1QLFB 5FYKH 4EUPH 4OLVL 4RFOH 4RBPH 1FZMA 2OXGA 3FO1B 5CJQH 3DX6A 4WWKA 5EO0A 3DURB 5H37H 4OZGE 3MLSL 2C9AA 2H2PD 4B50A 1G7IB 3H42L 4AL8H 3S97C 4Z7WA 4C54A 2ZJSL 1TPXC 4MX7A 3KYAA 2VDNL 2OBGA 1OB1A 3WXVH 3FOMB 4OCRL 3AREC 1HWHB 4RGMB 3G6JF 1WISA 2YEZB 1CICC 5JA9A 3ULUE 4M02A 4L4TB 4JKWA 3DO7A 7FABH 5J12B 5CEZD 1C5DB 3C8DA 5FKPA 4LKXA 4WO4A 5C09D 1XGUB 5L2KA 4RAUB 1FYTB 3SKOB 4Z7OF 4QHUA 2MQ3A 2NY7H 1ND0B 5K93A 2XT1B 4NKQB 3ZKXB 2UV3A 3QDMD 2EE3A 4NO2B 3L3GB 1C08B 2OJZH 4LIQH 4BUHA 2YRZA 1ERNA 2G2RA 4NPYA 5C0IB 3RAJH 4EEEA 1KXTB 3MGOA 1N0LA 4GW5A 4QHKJ 4P46C 4UIKH 4PV8B 5DUMH 4YBQC 1KIUA 1SM3L 4NQSA 4DKEH 2N7AA 2R1YA 4TULL 4WUKL 2KUTA 2VERN 5EZOH 1EGJL 4ZUVA 1YEEH 2JCCF 1UB5B 1RY7B 1OTSC 4F7EB 1OSZA 1A6TA 1G7PA 4HIIA 3O2WH 3HZVA 4YHML 1N64L 5FV1L 5DJYA 5DSCB 1CDHA 5ACZA 5E08H 4FP8L 2GJ6E 2WWMD 1U91B 1INQB 4FQQA 4HUXB 4LEOB 3K1KC 1U8IB 5D7IA 1A6ZB 2YRPA 4PJFE 2O5XL 1A14L 1KN4L 1E6OL 2X41A 1PY4A 5CEXB 1BOYA 2QL1A 3WFCL 3HI6H 4K7PH 5GSVA 2E5EA 4DVRL 1FBIL 3KJ4C 2XZCH 3H3KA 1NEZA 1OPGH 2J88H 4WHYH 5SX5H 5D1ZC 5JOEA 3O3EA 3GSXA 3G5YB 3V8CA 3HRPA 4PJXB 5D71L 4JO1H 5DRZA 1MSPA 2DWDA 1YDPA 1QSEB 5FGSA 5DEFA 2BVUA 4BZ1H 1HHGB 5C0CE 3INUL 3WNPA 1JGUH 4OCSL 3T0AA 3CK0L 5FDYA 1VFUA 1S7RA 4KROB 5KVEH 4J4PC 5ICZA 1LK3H 1MAMH 3ARED 3PDOA 4P23C 2G60H 1HZHH 4FQ1L 1QFWM 4U6XA 5JW4Q 2RGSA 1CICD 4CW1B 4ODSH 4XVTL 3U0PB 1ADQL 3HS0A 3KLSA 4K71C 5DVNA 4EBQL 2FJGA 1YEHL 4LARH 1F4XL 4LLYA 3SDCC 1R3LA 1I3GH 3V6FA 4DJMA 4ODBD 5A2FA 2Q3AA 1A5FH 1LWRA 5KVFH 3DX7A 4Z7NF 4O2EB 4X6CF 5D2NC 3PJSA 5CGTA 4GRMB 4JGUA 2B4CL 1AXSA 2ADFH 5FYJE 4HDIB 1F13A 3D5OF 3L3OB 4P46D 1QRND 1HEZA 5D2LE 2F19H 5I1KH 5BRZB 4QOKE 4FQCL 4XNXL 2W0KA 3KPMB 4I3SH 5FYLE 3WUWA 3DGCR 3ILPB 4X4ZA 3IU4L 3U36A 5I15H 3U2SB 3D3VD 1G7LB 4Y2DB 1OTSD 5LWYL 3ARFB 1KB9J 4N0FA 2EO9A 5LGJA 3KAAA 3CFKA 2I60H 2WUBH 5IB1A 4OJFH 5IG7B 2CIKB 1EXUB 1T3FA 2BOCB 4PJ7A 4JHBA 3VXSB 2QR0A 2FATL 3KR3L 2IGFH 5I16B 3RVVC 2DJ4A 1JGEA 1GOGA 2IPKB 4XP4L 5FF6B 3VXTA 1BWMA 5DD6B 3TZVB 2A1WL 1CFNB 4ZO9A 2Q87A 5KS9E 1K85A 5FGCB 1QSVA 4H8WH 3QI9A 2X4QA 2EDJA 4RRPG 1IGCH 1D5IH 4G8IB 3VFOA 1PG7W 3PIQA 3HI1A 4POZD 3WN5C 4G6JH 1T5XB 1AE6H 5IGXH 4J3WA 4MMZC 5D1ZD 2R0ZH 1OGAA 4GG8B 1FV1A 3UTTE 1IGJA 4LVOC 2GITB 1I7UA 1T0MB 1BMGA 1WTLA 1RIVH 5T3XD 5I8KL 1NCCH 4C57C 5I18H 3RIFF 1OP3K 2VLRD 3U48A 4CDGC 4JZNA 4UAOB 3V5DB 1TZHB 3FT3B 3O0RH 1U8MB 2IQAA 1XGRA 2X4TB 4BK5A 2EDWA 4J4PD 1YPZA 4P23D 1ZEAL 3VDAA 2YA0A 3O41A 4Y1AB 1E4KA 4KTEH 4C83A 3FAWA 4GRLB 2DTSA 1K8IB 3CD4A 3MRBA 1OF2B 3RDTC 4XB7A 1INDH 1AO7A 5CSZB 4ZYKA 4XPHL 4MLSA 3LRSA 3B2VH 3SDCD 4BFBD 2V5RA 1XGQA 1NC4D 1A6AA 2OTWA 1A7QL 5EU6D 2BFVH 2NXZC 4YK4C 3TNNB 4G6KH 4I5BA 4P2QD 1TZGH 4ZPTB 5K9OB 4X7CC 1EAPA 3UYPA 4QRRD 4X80H 5EU7E 1H15B 4LAQL 4HWZA 3HCVB 3LPGA 1KCVL 1U3HC 1KGCE 4DOHE 5ISZE 3VW3H 3IKCB 4PRHB 3V5KA 4ZAKA 1NGYA 1QFUH 2DQGL 4M7LT 4OGXL 5DJ8A 3IFNH 1K8DB 4JR9H 4AZ8A 1AQKH 5DRWB 4QEGA 1II4E 1MNUH 5IW1A 5FM5O 3NACL 1P4LB 3IVKA 5C0BA 1P2CA 1WCBA 1BLNA 5IB2B 4PRAB 1R5WA 3PWPA 5DD0L 3RVVD 1U58A 1EHLH 3FQNB 1WK0A 5TF0A 4PRBA 3UTQA 1PX3A 1IGIL 3AGVA 1XZ0A 1A3LL 3I6GA 1AIFA 2F58H 4HV8B 1BFTA 1NGPH 4OFDA 3DUSB 3H9SD 4YHZL 5FEBA 4HWEL 1UM4H 3W0WA 4X4ME 2R2EA 2OQJA 2Y7QB 4NNXA 5TQ0H 5CBEB 3QNXB 4RMUA 2OZ4H 2X42A 1LEGB 5GS0C 1IZKA 2ID5A 12E8H 2DI8A 3MNVB 3R06A 4YHNB 1M7IB 5B3NA 4U1HB 5DS8B 3MMEA 5J9PB 1Z5LA 1JTOA 1WITA 2N1KA 3DJ9A 2VDRL 5JOPD 4W6XB 4YXKL 1SVCP 3NABH 3NCJL 4P57A 3E8UH 4DGYH 5BS0A 3B5TA 3QXUA 2JK5A 1W0VB 1E28A 2VAJA 1B4JH 3QUML 1AGCB 1UM6H 4MAUH 2UUDK 4GKZA 4UB0L 4YR6A 3BD4A 4BZYA 2FBJL 4JKMA 5L2JA 3PABA 3RDTD 4M7JH 2LQRA 1Q9LB 2ARJB 4JO4L 1JZ7A 2WBKA 5KSUA 1FCCA 1GGYA 1P69B 3CU1A 3BUTA 2OK0L 3G04B 4MS8C 3BKJH 1EV2E 4YDJA 3T2NH 2NXZD 5GGUB 3FQXA 3JTTB 2IPUK 2LTQB 2MTPA 2EH8H 5DHVB 4J4PA 5BCAA 1BQHG 2XACC 3JV6B 1T89C 1JK8B 4LPWA 4LSUH 3HMXA 5I66A 8FABA 1IILE 1KFAL 3BGFB 3HE6B 1RVFL 2VKWA 4ZNEA 5DGQA 2YD5A 4HLZG 4WNQA 5I1JL 3HPLA 4XTRC 3GFUA 3WFBH 2E27L 1NLDH 4KC3B 1PKQA 1UJ3C 2NY5H 3SJVE 3RY4A 2ZNWA 4AIZB 1H0DB 1EHAA 3SDCA 1RU9L 2AQ2A 5D70H 4JHAL 3MLZL 4U1GB 2BERA 3CXDH 4J3UA 1M05B 5D2NA 4RISL 4Q9QH 1RZJH 4LNVA 4M61B 3MNWB 3A6CH 4MCYA 4N90D 4I0PB 3HAEG 3GHBL 4RFNB 4ELKA 4Y88A 5HHPB 1KB5B 3TJEL 4JQXA 3SGJC 3QQ3B 1D5ZB 4OFKA 1J10A 1S9WB 3U4EB 3PHOA 5KTEH 2DQFA 1KEGL 1K5NA 2NY2C 2J6EH 3ARQA 1J8HE 5FUCE 1RIHH 2IH1A 3IT8D 1WQVT 3M07A 5K33A 5CEZL 4WENB 4ODUB 3PWNA 5JLZB 2J4WH 4M43H 4M7KL 4UT9L 3RWFB 4Q0XH 5TE4L 5GS0D 1PQZA 2EYTA 2V7NB 3P40A 4XCCL 1A9BB 4NRYA 4P4KB 4QGYA 1G6RH 1P5VA 2HKHH 3STLB 5BZDA 3ZDXF 2ADIB 3BT2H 3RWJA 5TQ2H 4KKNA 4M5YH 1MPAH 2Q86B 2OL3A 5D7LA 4KK5C 4IOSD 5HGDA 4TNVF 2MHAA 1RHHB 4NNYA 3JWOH 4BK4A 1V7NL 4A6YA 2ATPA 2OSLA 3AM8C 3HR5B 4ZTPH 1RZKL 2AJUH 5LGKA 4NQEE 1L9NA 1MRCL 1JGVH 3GI8H 3TPUB 2YA2A 3CFIC 5JPMA 3OKLB 3FMGH 4LLAA 4G6ML 1I4FA 2CIIB 3EZ8A 3BI9X 1NUGA 1ORSB 4FQIH 4HGKC 5DJAA 1MREL 2VRAA 4KTDH 4UIMA 4MS8D 1UZ8A 1IMHC 5CD3A 5I8OL 1QR1A 1BIIB 3VXNB 3O6MH 2LU4A 4U1IA 4YEFA 5TGBA 4BFIB 1GJIA 1PD6A 2Q7NA 1UACL 2BP3A 43CAA 3REWB 1YEKL 5SWZD 2ZKHH 3F7YA 3MCG1 4LQ1A 2IF7A 5GS1A 3N85L 3OR7A 4XTRD 2NY4B 1HCFX 3KNBA 3RDTA 1YMMB 5I1GL 3ZE2F 3F7RA 4XNMA 2QQNH 4JO2L 1KIQA 3X14B 4L8CB 1TQBB 1CT8A 3FTGB 5EDXA 2PYEA 1OLZA 4XWOC 4F15B 7CGTA 3GMRA 3S34L 3S35H 4R2GC 3MBEA 1I1FB 3RWDA 3JXAA 2QADC 4GQPH 4I18B 5EIQA 4DEPC 2D7OA 5D7IE 1WV7T 5DMIL 5IWLC 4JY6B 3UBXB 1ZS8B 2BDNL 4JO3L 3N1GC 1TLKA 2QSCL 5C92A 5EIIA 1U3HA 1JPFB 3IDUA 5HY9A 5BZWA 1SYVA 2NY2D 3LD8C 1T1XA 4X83A 3ARZA 4N5ED 2P5ED 3SKNA 2RCSL 2EYRA 4JPKH 3QWRD 5EOQH 2B1AH 4CGTA 3ZDZF 4W81A 1KACB 1UCBL 4MNQA 2PXYB 4I48A 5GGTL 8CGTA 4G8GD 3N0PB 1UKTA 1F58H 5FGRA 3H3BC 2OS7A 3LS4L 4N9GA 4NQVB 3H9YA 3B5HA 5JW5B 2CJUL 4M1CC 2V7HA 2ZCKH 1ZE3C 4KK5D 3Q0HA 3DSNA 4LMQI 3VCLA 3WSQL 4RGNC 1WAAE 3WIIH 5MERB 2AW2A 4EDXB 32C2B 4O00A 1CGYA 1F3JA 5DT1H 1A02N 4GBXA 4ZSOE 4QY8A 3MRMA 2HH0L 2VLME 4JKLA 4Z7UA 4Z95L 5E8OA 5FECA 4JY5H 4C4KT 2CH8A 3PV7A 4L3EB 5J57B 2BOBA 2X7LA 4OCYH 3P30L 4OI9A 5ALCH 1S3KL 4OF5A 4YHLL 1BEYL 1JRHH 4XPBH 4MHHG 5ICYB 1EO5A 4M1GH 4LNRB 3O3BA 1QLRA 3DETC 2WW8A 2BCKA 3CFBB 1YYLH 1K4CB 2WINA 3MLWH 1DSFL 3ME0A 3RPIA 1QFPA 5E24E 4A2LA 2C4XA 4M48L 3GSUB 1UXSB 2JIXD 1EO7A 1HWGB 3EOTL 2E9JA 6FABH 1I1AC 2EIDA 5CEZE 2N7BA 3BKML 2ZPKH 3TT1H 5LQBH 4OD2A 2E7LC 1CFVL 5C09E 4MHHI 4L5FL 5GGQL 1MEXL 4HZLB 2HFEA 2C3WA 4XWOD 5H94B 3V4VH 2UWEA 3DECA 3ET9F 1WZ1H 2GUOA 2D7TL 2UVFA 3QDME 3S5LB 4JQVC 4TSAH 2B2XL 2QADD 5T3XL 4L4VB 2G5RA 4X7SL 5CP7A 3PWVA 4J7RA 1T89A 5I1LB 2XG4A 4XCEB 5DZLA 2GYSA 1F4WH 3FONA 3WNLA 4HKZA 1UH4A 4M3JA 5KN5A 3CMOH 4JY4A 4YFLI 1ULVA 2J5LB 4R3SA 4N8VA 3D39B 5EB9A 3CFJA 1WC7A 1YECL 2W60B 5IMOB 4N0YH 1S9YB 4XC1H 4YHPB 2W38A 1YEIH 1H3TA 2F5BL 2V9RA 4QRSB 3EDFA 1I3VA 4KMTH 4FG6C 4GKSA 1N4XH 1NL0L 2IALB 1RUKH 1OL0A 2NTFA 2VXTL 1A7OL 2FX8L 5DJCA 5HVWA 4M1CD 1K2DA 4W4OA 3BUYB 1JZ8A 2EC9U 3P9LA 4X98B 5I1AA 3RHWF 4R90L 1RJYB 4KTYA 1KJ2L 1JZ6A 4U1KA 1B2WH 2MNUA 3V4UL 1S7QA 5E5MA 3FB7A 4BSWA 3OG4B 1T1WB 1A7BA 3H3PH 1Q0YH 1QLEH 4X6DA 4JPWL 3WFEH 1Q9KB 4JHZA 3S98A 4OI8A 1A6VL 5GSRA 4OZFB 4IOIB 5AZ2L 5DMJB 4YXLL 5DR5L 2WNGA 3DV4B 3TCLA 3FFCA 3X17A 4Y19A 3NFPB 5EORH 2EDRA 3OKOA 2VIRB 3W11C 4FNLH 5J1AB 3DETD 4NHUB 2B5IC 3O6FB 4RX4D 1ACYH 1NC2A 2FSEB 2P46B 5EO1A 5T1DL 3AM8A 3D6GA 4S1SL 3SGDH 5K9KA 1DUYB 1IEAB 5IUSA 4M6OH 3MRCA 4G43A 1YUHA 3DROB 1I1AD 3PWLB 1CFQA 1FDLH 2X4UB 1CGSH 1NDGB 1P4IL 1XCTB 1NANI 2EDKA 4I3RL 2FCBA 1XIWC 3K74B 1ZA3A 3RKPA 3TLRA 1BQLL 1KTDA 3PQYB 3DRQA 5F6HI 5D6CB 1GC1L 4KQ4H 4YWGH 1YN6B 3MGTA 3RA7H 3OJDB 5KSBE 2DD8H 1MCBA 1CF8H 1EMTH 1UVQA 4U3CA 2P5WB 4Y8AA 3CCHA 5JHDD 3QUZB 5F96H 1QRNE 3U0WH 3KJ6H 2BNUB 1F90H 3Q6FA 5CILH 3V0VB 1G9EA 4NBXB 2F15A 3U9UA 2JIXA 1T20B 4U7MA 1J8KA 3D3VE 4X5WA 5DEGB 3HUJE 2WWKO 3L3IA 5EOCH 2AJSH 3U79A 4FABH 2VKXA 4FQLH 4P5KB 3X3FL 3H7BB 1CE6A 5JO5A 1FNSH 1MWAB 1EEUA 3GM0A 1ZGLP 1U8LB 1ZT7A 1HIML 3U30B 4NKIL 3DPBA 3EYOB 4FG6D 3MJGX 5D1QA 5IB3B 3IDMB 4V1DA 25C8L 3CH1B 2PO6B 4TUJB 3DXAD 1A4KA 4OKVA 1EFXB 4XGZA 4TQEL 1CGVA 4OB5L 3FFDB 5B22A 4PJ9B 4HUVB 4L3CB 2YSSB 3FT2B 5CZVL 4HW6A 5F70A 1BQHA 2HVJB 4KI1A 1BFSA 3G6JA 1FC1A 5J1SC 2IFFL 2DQUL 3WBDA 5TE7H 2E6QA 1YMHA 5I1EL 3B9KA 5GRJL 2H32B 5DVKA 1KTLA 1HOCB 2PTVA 4YIQB 2ZOKB 1NCNA 1DUZB 4U6YA 1DQML 3BJLA 5BMFH 2NY6C 3O2VL 5T3XE 3CFDA 3J7HA 3BAEL 4OZHF 3WEXA 2VLRE 2IG2H 3W11D 5C0FB 5L6YH 2EDEA 5H37G 4WI9A 2HP4A 4CMHC 2YZ1A 4GRWB 4RNRA 3VGAC 4D8PA 1Q1JH 2JLLA 3L7EB 4NRZA 1D9KC 1FFPB 3OXSA 4KWUA 3OB8A 3DLQR 3ZHLA 4JVWA 4Q9RL 3HFMH 2GTZA 4WU5A 2JCCA 5BVPH 3SDXE 3QISA 1A22B 4OCWH 4GW4B 2XXCB 4JN2A 2NX5D 4HKJB 4NO3B 1IJ9A 1PKQE 4ODWA 1KCUH 2XWTB 2X4NA 2YMXL 1RZFL 1XFPA 1XIWD 3MUHL 1XF2A 5HPMA 2J8UA 1N7ML 4LDOB 3D0LB 3Q1SH 5KANG 4H25B 1HXMA 3SE9L 3BP7A 3KYKL 5EU6E 3T0VA 1H5BC 4DN3L 4RX4A 3LN5B 4B53A 1NFDE 1FFOB 4P2QE 1XF3A 3L3DA 1S7SA 2BJMH 2BXZA 4JFDA 5C0GA 3FB8B 4QRRE 5HYQB 4P2RA 2VABB 3G9AB 3TO4A 4NHCL 1KCKA 2VDLL 2VC2H 1MQKH 4ODVL 3UYOD 1I1AA 3ZTJG 2P8PB 5TFSL 2N56A 1MWAH 4UT7L 5KANI 1S7VA 4NN7C 1M6OB 4DFIA 2XRAL 2J8HA 3ZDYE 1I3UA 1CLYL 4GUPB 1LD9B 5IFHH 1YEFL 1J1PL 3LEVH 4HS3A 3HC4H 3KPPA 3T0EB 3G6DL 5JHDA 1S8DB 3ZYZA 3U1SL 2X44D 4R7DB 1FNHA 4EI5C 1A1MA 4CNIB 2C3HA 2H26A 3H9SE 5DMYA 3W9DB 4AM0A 3OB0H 3HTLX 2CUMA 1CLZL 2H32H 4FN0A 4MAYC 1L0QA 4WHYG 4U3XA 4U1NB 1EEZA 1NCBL 5T3ZH 3WHXA 3VFTB 4LLWB 2NY6D 3DIFA 3T3PF 3DXAA 4PLOB 4QNPF 4X6CA 4X5XB 3QQ4A 4YHOL 4G80A 4ZQKB 3CH8A 5JOPE 2GFBB 4JRXA 5EC1A 2C3GA 4LEXH 4JB9H 5D72H 1VFOA 2JJTC 4FFYH 2EKSB 2A9ML 2Z31B 1QEWB 3L6FA 2WP3O 4Y0GA 4EOWL 2Z35B 1FZJA 5FHBL 4APQB 2PUQT 3WNNA 2PTTA 3L3HA 3MJ7B 2HYMA 4XH2A 2GJ6B 1UWGH 4MA1C 1FAIL 2VJXA 1L7TH 1ODAA 1PLGH 4TPRH 5EFIB 4PJFB 1CGWA 3IRPX 4K3JH 3VG0L 5I75C 1Z9SA 1ZSDB 1IVLA 3V5HA 3FB5B 5EU3A 3V6OA 1QNZH 1RZIB 3NZ8B 1GAFH 5KVGL 3FZUC 3EO9L 3LQZB 3O6KL 2H3NA 1RJZB 3OHXB 1U0QA 3QEHA 2V5YA 5FA4B 3GMOA 5EUKB 1XIWA 2W0FA 4WI5A 3UJIL 1IZJA 3ARRA 2XFXA 2H1PH 1OAZL 2DBLL 4J3OC 4HKBB 4LSSH 4IMKC 2ED8A 4QHNA 4HBCH 4PLNC 1CVSC 4X4YB 1HQ4A 3IF1B 5B8CB 1SEBA 3TT3L 1SY6L 5CIPA 4N90E 5DMKA 3RGHA 4WRLA 4I0CC 3QT2A 1UWXK 4EI5D 5C7XL 3O8XC 1JJUA 4K3GA 1PSKH 1KC5L 3LIZH 4NGHH 1I8LC 3HA0A 1AHWB 1FO0A 3QO0B 4PYGA 4XB8A 1NGXB 4H1LB 4OCXL 4MAYD 5IVXE 1RULL 1FNGB 3KYMA 1CZ8H 4E41B 3GBML 4CJ0A 5IMLB 2W65B 4PP1C 3I75B 1AGBA 1AJ7L 2A6IB 4GQ9H 5D2LB 5HGHA 2R4SL 4QOKB 5DQJB 1BBDL 5HVFB 4OT1L 1LO4L 4HPYH 4NJAH 4FZEH 1XF1A 5I76A 4FQ2H 3QCVL 2ZUQC 1DQQA 4Q6IC 4Y5YC 2V6HA 1RZ8B 3CLEH 4HX1B 5FOJA 3TBSA 3RU8H 5C07D 5E9DD 1OAKL 5HHQA 5IMMB 2W0LA 4JEGB 5D8JL 4XPAL 1K3IA 2H9GB 1JI1A 4NZRH 3EYFB 1BVZA 5J13C 1IGFL 1W72H 4QRTB 2AEQL 4PJ8B 3OX8A 1XGYL 4PJEF 3MCLL 3VFPB 5I2IA 1E6JH 1MF2H 5E8EA 4EIGB 5FYKD 3P9MA 1CYGA 4YZFF 1HK6A 1D9KA 4MLIA 4HD9A 1Q94A 4U6VH 5T33H 3M1BB 4J8RA 4XAKD 1LMKA 3DSFL 4R0LA 3FZUD 5SWZE 5FKAA 9CGTA 4KUZH 2GJZB 4RQQA 3MLXH 4DKFL 3QIBC 4JFXB 4PREA 4CVXA 4KAQL 5JXAL 1MLBB 5EU4A 1REIA 5FO7A 1ZT1A 2H41A 4OGZA 3VH8B 3TVMA 3CX2A 3NMEA 1T1ZA 4U1MA 1S7UB 1MCFA 4G5ZH 2PF6A 3O8XD 1NAKH 4PJHE 4UV4H 5T5FH 5DJ2A 5D96B 5ICXB 4H1LH 3ZSSA 3EYVB 1NGQH 3U7YH 1NAMA 4UQ2B 4RDQF 2ESVB 2P5EE 5TPWH 4DKAA 1FL3B 3CXHJ 4FFWC 3S96B 3TYGL 3MRRA 3DO3A 1U8OA 1MI5D 1IC4L 3HE7D 3WIHA 4G8GE 4KQ3L 4XP5L 1BJ8A 4PP1D 3QWOB 5CGYD 3LV3B 4HJGB 3MUGA 5H8DA 2VYRE 2WM0A 3MRGB 4DZBA 5L9DH 2VITA 4NP4L 1KCSH 1MCSA 2AEWA 4JM4H 5GS3A 3WFHA 3B43A 2BMKA 3K3QA 4DOHB 3QH3B 1TETH 1KLUB 1PG7H 5TDOA 4TN9A 1JWUA 1UQSB 1CN4A 1LO0L 2FZ3A 1KUMA 4OTXH 5ESVA 3MBXL 4H8WC 3MLUH 2X89A 3HC3L 4KZEH 1FNEB 1MRFL 2E8YA 5CUSH 3QB7C 3L9RB 3L1OL 1VKXA 1P4BL 2VDMH 2OR7A 3M17A 5E2WH 2YHGA 3GMLB 2B1HH 2OR8A 1NBQA 2QQLL 2SEBA 3KXFD 3WIFA 4J12A 5HHVH 1IC7L 4ZUSB 3TIEA 1B0RB 2P24A 5CBAA 1JF5A 4MD4A 1MJ7H 3SGKC 2YD8A 5C6WH 1FL6B 1CR9L 4R9HA 1V3MA 4PGCB 4AEEA 2DKMA 3QIUA 4P2OC 4LKCB 4CVUA 3U4AA 3F62A 1LNUA 1DBJL 3PL6B 3SDYH 4NKDA 4L8BB 4RA3A 3HMWL 3RIFK 2BVPA 5INDB 3H2WA 1A4JA 4YXHL 3PV6A 4ZUWA 5DFTA 2NY1C 5F6IB 3VMOA 2DDQL 4IIQA 3WD5H 2GSGB 4EUPA 3THMH 3C6SA 3W82A 1NCDH 5JMOC 3NIFE 3P0VL 3D18A 5GRZA 1FP5A 3MROB 1MFNA 4F57L 2HWZH 5A2LH 1P9MC 4LBEA 3U82B 4WTXA 3BEWB 1BZ7B 2D7NA 2IPTH 5BV7H 3VXRA 2FLRT 5BO1H 4Y2DC 4DW2H 1CFTB 4X9BA 4FFWD 1T66D 3MO1B 5I1HH 1QBLL 3PDDA 4IMKA 2Y6SC 1FGVH 2MFNA 3GI9H 3KWWB 4CADB 1N59A 4K55A 3CVHA 4IHOB 4Y4KB 3GSNH 5E2TL 5C8JB 1JPSH 5FO9A 3CZFA 3D9AL 3O8XA 3I02B 4N8CL 4Z78B 3KHQA 1BVKB 1I8LA 2DQTH 2ZWLT 3HNSH 3QXAB 4OIAA 1FLTX 3SJVB 4OD1L 1JGDA 2QSTA 5IMKA 3GIZH 2VLKB 4JQIH 3TFKC 1EIBA 5KSAB 2O61A 3FOLB 1BOGB 5F7KC 4HIXL 3LH2L 3BPCB 1C7TA 4BA8A 5LAXA 4Z18A 43C9A 5JQ6H 4DTGH 1UWEL 3LMJH 1AD0A 1CU4H 2VXUH 4MB4A 5GPRA 5AWNL 4PJAE 5DK0A 1QR4A 1A2YB 3C5ZB 2FB4L 1YEJL 3UJJL 4Y5YA 5CINL 4K7PX 1TXKA 2R4RL 2F53D 1IFHH 4D0CB 1J8HB 5C0RH 3D85B 5FXCH 2R69H 3C08L 4LLVB 2EDHA 4X6FA 3ES6B 5JQHC 4P2OD 5E95B 4FXKB 3T4AA 2V9TA 4JANA 4MDJB 3AS2A 3QHZL 2CMRH 2C7UA 3QAZC 1CDUA 1FZMB 5EO0B 4WWKB 5FFLA 4HFUL 2NY1D 4K9EH 3FQWA 2W9LA 4HKXA 4FZ8L 3KXFA 3CX5K 2ZCHL 4OF6A 5D7KD 5ADPH 1U8NA 4MX7B 5JHDE 1OB1B 2X4SB 5IHUL 1GGBL 1SJXA 2O5YL 1PBYA 1F8TL 4NQEB 5BRZD 5GGVL 2MJWA 3U7WL 3DO7B 1HDMA 2I5YH 5D7JC 1KJMA 3I3BA 4YE4H 5DUPH 4LKXB 4Y2DD 3LEYL 2VXQL 3QIBA 2YPKB 3ARFD 3KLAA 4KHXL 2Y6SD 3OGOE 1SEQL 3FO0H 5J3HC 2EXWC 3KPLA 1ZLVH 2NY5C 1CBVL 1MIEH 4HH9B 3DXAE 4OLWL 2G2RB 4NPYB 3VXSD 3QPXL 1RZJC 1FPTL 2R1YB 3VRIA 5M7QA 1ZTXH 4ZUVB 2COQA 4J6RL 4LCCA 1D6VL 3ZYJA 1A6TB 1G7PB 1LQSR 3OKEA 4HIIB 1NBVL 3RBSA 5DJYB 1CD1B 2E6PA 4WEUD 3TFKD 3MXWL 5ACZB 1T6WA 2XQYG 1QKZH 4LMQE 2XG5A 4Z8FL 4NT6B 4WY7H 4F9PA 2A6JA 3L3JA 4FQQB 1CLCA 3UJTH 1TQCB 4OV5A 1B90A 4UI2A 4ALAL 3RGVB 1J5OL 5D7IB 3F7VA 4N0UA 2XZAH 4PB9L 1T0NA 4L29A 4ETQB 5F97E 4EN3C 4RWYL 1LO2L 1Q9WB 3MODH 3WS3A 1H3UA 4P2CG 5JDSA 3UYRL 4ZMAT 5GSVB 5MENA 3O3AB 1DBKH 4AMKL 3IDNA 3LKNA 4B0MM 4CJ1A 3EFDL 1G7JA 4XNZB 4JG0L 2CKBH 1OARL 2MKWA 1HNFA 4K23L 3JWOC 3O3EB 3GSXB 4DGIH 2NX5E 2KDGA 3AB0C 4JN1H 1N2RA 4NNPL 5JW3L 2KH2B 2DWDB 1YDPB 1N0XH 2X1QA 1UB6A 5DEFB 3SOBL 1OP3H 4RBPK 3U4BL 4KHTH 2XTLA 1CIDA 5E6IC 1U93A 3E6HA 1ZWIA 2WBJA 2VOTA 1DBBH 5HHNA 3E6FA 5ICZB 3KLDA 2F53A 3ARGA 2LTQC 3PDOB 2JJWA 1HINH 3SGKA 4GMSH 4NZDA 3QEGL 4U6XB 5FAAA 4LU5H 1ZXQA 4KKCC 4ZSOB 1Z0NA 5GRXG 3RWGB 3FN0L 5ECJE 3BIAX 4JJ5A 3BGFC 3HE6C 2VTFA 4P2OA 3MRDB 5D7JD 3B6SA 1K6QL 5CD5C 4JM2C 1L7IL 1MCDA 3AY4A 3UPAA 4LLYB 4HGWA 3VG9C 3V6FB 5J3HD 3DX7B 2EXWD 1NMCB 5EUOF 3PJSB 1AXSB 4P59L 5L7XH 3X3GL 3STBA 1YC7A 3ARWA 4YGVA 1HEZB 5ANME 3IJHA 3PP4L 1UKSA 1LILA 4YQXL 1P9MA 5D93B 2XIDA 4RFOL 5ACLA 3I9GL 2D3VA 5CJQL 2APXA 4KKBC 3ISWA 4E5XA 1QVOA 3H9HB 1BZQK 1YZZA 2JB6A 2QSVA 4FMFA 4LSDA 2Q8AL 5AAWA 3ARYA 4N0FB 5C09B 1X5LA 4AL8L 2FHCA 5C2BH 4NJ9L 4DN4H 3I50H 4XBGA 1U3ZA 2L0DA 5IB1B 4S1RH 2EKJA 5F7EH 1ORQB 5E4EB 1Y6MR 3QDMB 4RAVA 1MRDH 7FABL 1FL5A 2QR0B 4UZGA 3WL9B 1JGEB 4EN3D 1B3JA 3TH4T 3VXOA 3VXTB 2HJFA 2Z8VC 3OKKB 4O4YH 2FDBP 5F7UA 3VFOB 3WKNA 3PIQB 4FTVA 1JWMA 1U92A 3EYSH 2EDLA 4NN6C 4HF5H 5I73C 4UIKL 4RA0C 5DUML 3V9FA 1Q9OB 5F9JA 5SX5K 4DGVH 1FV1B 5IHZA 5GRVK 2VDQL 1IGJB 4IRJA 3BJ91 4GAGH 3MOBL 3GSWA 3S37H 4YPJA 3S36H 2K1MA 3TYFA 4Y5XC 3VXUD 2OZ4A 1EA9C 3O2WL 5E6ID 4IMLA 5IESH 2IQAB 4E9LA 1U8JA 1GOHA 1XGRB 2HFGH 3PHQA 3SGDI 4MD5B 4R4FL 4QXGH 1GSMA 2NR6C 1YPZB 3C5JA 3O41B 3KPSD 2ICWA 4C83B 3D1MC 5DTFB 3SQOL 3MJ8A 1U2HA 4HGMA 3HE6D 4GXUN 2X6MA 3MRBB 2CRYA 1SJHA 2EECA 4GW1A 5CD5D 4JM2D 3ORJA 3CUPA 1AO7B 4WGVB 4ZYKB 1IQDA 1TCRA 4K7PL 3WFDH 1XGQB 3G5ZA 5GHWH 2HRPL 1A6AB 1U9KA 1OPGL 1BQUA 2J88L 3QFJE 2BC4A 3U9PH 4UOW0 3QDJD 4I5BB 4GG6E 2HRLA 4OFYD 1EAPB 4JLRB 4HEPG 4YJZL 3ROOA 3MNZB 1QG3A 4KKBD 5IR1B 1WTGT 4BZ1L 1CICB 4K8RH 4PTTB 4MQ7A 3MA7B 4ZFFB 1N5AA 5D7JA 1JGUL 4JZJC 2BY3A 3DBXA 4OFVA 1CD8A 4BH8A 4LF3A 5DQDH 1LK3L 2XICA 2UZYB 4OGAC 1FZOA 2G60L 3BFOA 4WHTA 3UDWC 2RFXA 4N9OB 5LCVH 3PXJA 3MUY1 3IVKB 5C0BB 2ORBH 3NZHH 1P2CB 1BLNB 2IC2A 1R5WB 3G6AA 2BVOB 1KJVA 1U58B 4LVNC 4NQUA 4X6BA 4MVBC 3O9WC 4HAGA 3TF7C 2VZOA 4PRBB 4LARL 1YYMH 5SV4A 4NUGL 1W0WA 3V52H 1XZ0B 3I6GB 2JELL 5KVFL 5F3BA 1EVUA 3HUJB 3W0WB 3EKCA 1TITA 1MCNA 5C07E 2ADFL 5E9DE 5JZ7C 2AEPH 2R2EB 1MJ8L 1CL7I 2F19L 1QBBA 4NNXB 4LPUA 5E1AA 3G9VA 3ZE0E 4I3SL 4IJ3C 5IM7A 2YC1A 3D25A 3QXTA 4LCUA 1G6VK 3R06B 2BY0A 1ETZA 2NLJA 4OD3H 1U95A 2VAAA 3ZTNH 4BQCA 1LK2B 3MMEB 1XR9A 1Z5LB 3V7MA 4ZS6D 5J06A 3IETB 5EO9A 5C0ND 5JUEH 1X5AA 5FYKE 2WUBL 4OJFL 2NR6D 5EIVA 1TDQA 2B0SH 5BS0B 4D9RD 1MFCH 1E28B 1UC6A 1VACA 2EEDA 2RAMA 2FEDC 1RMFH 3OF6D 4XAKE 3KJ4B 5DZOA 4OBSA 4RGOH 4JRYA 1NCWH 4JDZB 4YR6B 4KRPC 4LP5A 5E2UH 5D1ZB 5DJ6A 3T04D 5DRXA 3VDCA 1NKRA 2P1YA 3ZHKA 1OT1A 4OKDA 5C9JA 2CR3A 3HNVH 5KSUB 1IGCL 1D5IL 1DQLH 4CN6A 3QJHA 3MV9A 3VXUA 3IFPA 1AE6L 2OTPA 3LSOB 5E6IA 5T1KA 1A0QH 2YUZA 1B0GA 3FQXB 1W8OA 4NWTL 1DQDH 4WFHD 1RJLA 4OLXH 3NCYP 3SDXB 3VRJA 1RIVL 1NCCL 2YKLL 4LIQE 4LLQB 5J6HA 5DC9B 4WNQB 3HPLB 3VWKA 3O0RL 4MDIA 2W9DH 3I84A 1BFVH 1PKQB 1F97A 5IV2A 4Z9KB 4X99A 5L88L 3L3KA 4OGAD 4R26H 3SDCB 1X4ZA 1NC4B 4TYUA 2VWEC 3S35X 3VDBA 3ECBA 5D2NB 1MI5E 5EU6B 4HHAA 3VFSA 2IADB 4PJGF 3CX5J 1RHFA 4WV1C 4MVBD 3O9WD 1KJ2B 3S88H 3T2OA 4ELKB 1J05A 1RFDL 4QRRB 1Y18A 5DXWA 4JFPB 2DQFB 4BSVA 4MSWA 5EBLA 1K5NB 1Z9LA 2BFVL 1OWRM 1VERA 4JVPA 1NQBA 4P3CH 5JZ7D 1ZVYA 3TO2B 5C3LD 2IH1B 4P3WA 4PB0H 1UG9A 4Y4HA 1WBXA 1AC0A 4F7PB 1PQZB 1NJ9B 2EYTB 4XNUH 5BVJA 3BGMA 4NRYB 3VW3L 5BZDB 5FCUL 3ROLA 4LPCA 1QFUL 3RWJB 2CLRB 3I2CH 1T03H 3IFNL 1QTYT 4JR9L 1FNLA 4Y5VA 2OL3B 2IAMC 5I8CA 3KXFE 1AQKL 2VN7A 3QG7H 4WI8A 5HGDB 2HTLD 2MHAB 1JHLH 5JW4M 2ATPB 2FEDD 1AY1H 2OSLB 4ZFOL 4MJ5A 5CJ5A 3WN5B 1GPOH 5JOFA 4L9DA 2VN4A 3HNTH 2DQHH 4LVOB 2F58L 1ZA6A 3OKNB 3PNWA 1I4FB 1NGPL 3IDYC 3R0NA 3MRKA 2IWGA 4X7TB 4GLRH 4Y5XA 5DJAB 1FVEA 1UZ8B 2RQ8A 5CD3B 1R3HA 1QR1B 4QO1A 4N1EA 4ZPVA 5MEOB 4D9LH 4TUOA 5TQ0L 4U1IB 3HMXH 3MYJA 5TGBB 4L4VD 3C6LC 4CL7A 43CAB 4S11A 3QG6B 3QUZC 1A21A 3F7YB 4OLYL 4P4RA 2YOCA 5GS1B 3OR7B 1R3IH 3KNBB 4N5UA 3RDTB 3I6LD 2VUYA 1DFBL 4Y7MA 3NABL 1NBYB 3E8UL 3DX9A 4PJBF 4KDWA 4LLMA 1CT8B 4S1DC 4OLUH 3TPKA 4NWUH 3GMRB 3NH7H 1MJUL 2AEIT 4PJEA 3MBEB 2NXZB 3U30C 5JTWA 3EO0A 4M7JL 2DWEB 3E1F1 4CDHA 5F7LB 4WHCA 4PLJC 4XVJH 4N0UE 1FIGL 3VI3E 3V7AG 5CKGA 2DICA 4WEBH 5EIIB 4WCYH 1U3HB 1AKJA 4JZJA 4N8PA 3UTZB 5HY9B 1SYVB 2L4OA 3T2NL 3MACL 2X1PA 1JBJA 5J56B 5IB4A 4YO0B 4YX2H 2VDKL 3SKNB 3V4PL 5IJVA 4JREC 2EYRB 1HI6A 5DQ9A 3NGBB 3VXMD 3UDWA 4X9HA 5IT2H 3T3MF 2C3VB 3VFUB 1OM3H 1WT5C 4XPGH 4S1QH 4L1HA 3RVUC 5EOTB 4PJXE 3VFGH 3RWEB 4N9GB 2NY5L 3KPOA 4Z7VE 2IAMD 4NZTL 2V7HB 1B6DA 4QXTB 4A6YH 5C0JA 3CXDL 4P5TC 5I8EA 1Z3GL 3BZEA 1INEH 3T0DA 1ZK9A 1RZJL 1IM9A 3KPNA 4DZ8B 2F53E 1PDKA 1MCRA 2IH3A 5IQ9A 4QY8B 2EDYA 3MRMB 1LHZA 2J7LA 2DQEL 4MA3A 2FYYA 5E8OB 3GUTB 5FECB 3AC0A 3UC0L 5FDWA 2DLFH 5KTEL 2BOBB 2XN9A 3KPRA 2J6EL 1H3GA 2BSTA 1NGWA 3SKJH 5J4MA 1IQWL 3O3BB 1QLRB 2BCKB 1CE1L 4M43L 5D7KE 3C6LD 3PGDA 1KCRH 2P5WD 1G6RL 2HKHL 4OFIA 3RPIB 1EO8H 1A47A 1X4YA 1JGLL 3QUZD 3C2SA 4WI7A 3BT2L 2VISA 5TQ2L 5BRZE 1UT9A 4XCNB 5DUBB 4MA8L 1OGTB 3UMTA 5J7CC 4G7YH 4QRPD 1MCLA 4H1LG 2X1WL 4YDIL 2DJSA 2V9QA 4OD2B 5MEQA 4Q6YA 1QPPA 1KPVA 4S1DD 2NY3C 2HFEB 2UWEB 4ZTPL 3QRFM 5J6GA 2GUOB 2EXYC 3SCMA 3ZKMC 3GI8L 4KDVA 4Y16A 4DFHA 3KVQA 1Q38A 2XZQH 3G5XB 4PLJD 3FMGL 5CP7B 3PWVB 2JB5H 2PO6D 3VXSE 5DC4B 4PIRF 1GHFH 1EFXD 3WJJC 3FONB 4FQIL 4WUUA 5SWZB 1R5IA 4HKZB 2EIZA 4KTDL 1A6WL 5KN5B 2BXYA 3ZT6A 2HMIC 3GJFH 5JHLL 2C5DC 4JY4B 3O6ML 5LBSL 1I1YB 1DDHA 4N8VB 4R3SB 1P7HL 1UJ3B 1HXYA 3MOAH 3S3SA 1WC7B 3ULVF 4ODTL 5ERWA 3W5NA 3HRZA 4JGJA 1N3NA 4ZTOL 2QV2A 4G3YH 3O4OC 3RVUD 1GXEA 5LKNA 4HT1L 3O2DH 2GY5A 1VPOL 4KPHL 4HK3J 5T3ZD 1D7FA 3LKRB 1K2DB 2A83A 3P9LB 1UYWL 5I1AB 1YQVH 3TA3C 4P5TD 4OZIF 3QUYC 3WLWC 4PGDA 3NCCB 4U1KB 2JJSC 2NY2B 1NCAL 1S7QB 3FB7B 4BSWB 1KB5L 4CAGA 2Z31C 1I7TA 4U1LA 3REVB 3LKPA 1NMBH 3D0VA 5GSRB 4OAWA 4G8GB 1HH6A 1YEGH 4PJCF 2CQVA 4FQPA 5AYUL 3QCUH 2IAMA 1FZKB 4OZHE 5EOQL 5F7DA 4QTIL 2X1XR 4HJJL 1NC2B 5EO1B 2A0LC 3HI5L 3NA9L 4F9LA 4DUWA 5IEHB 1XGPA 2FO4A 1P6FA 1F58L 5K9KB 1SBSL 5KW9H 3QXVA 4O2FA 2ERJC 3MRCB 4G43B 3RWIA 3LPWA 3ULUH 1CFQB 2ZCKL 5DJZA 4LDEB 4Z7QF 2DN7A 4HWBL 3WIIL 1U3JA 1ZA3B 2NY3D 4PRID 4TOYL 1KTDB 3DRQB 5DT1L 2EXYD 3ZKMD 3MGTB 3T08A 3LY6A 3WHE0 2LE9A 1RZ7H 1UVQB 3T65B 1GGCL 4MJIA 3T0ED 1BZ9B 4NUJA 2H8PA 3T2QA 5IP4A 3V79C 1TMCB 1F6AB 4IRZH 1WIUA 5ALCL 3U9UB 3MRPA 3KYOA 2JIXB 5E7BA 2HMID 4XPBL 4M1GL 4QRPA 4XPFL 3TIDA 3UO1L 4AQOA 5J1TC 1JP5A 5T1LD 5DK2B 3V8OA 4R4NC 1CE6B 4TNWF 3D69B 2DS4A 4UTAL 3MFFB 3HC0A 1ZT7B 2BNQD 3DMMC 2FNBA 4CRPA 4R2GB 3TBYA 3VRLE 1GGUA 6FABL 5FHAH 2DM7A 4RSVA 1A4KB 1LDSA 2ZPKL 4OKVB 5LQBL 2XNAB 4XGZB 5EC2A 4DEPB 4QXWA 3AXLA 1RUPH 3H8NA 3RIAF 5KBNC 4JDTH 4AIXA 2CRIA 3TA3D 2FLBT 4P5MB 3QUYD 1BQHB 1WZ1L 3WLWD 3OKMA 3CC5A 1UA6L 1IGYB 3LD8B 4JFFA 3EDJA 5CHNB 4CKVX 2FECI 1BGXL 1L0XA 2R39A 5IF0A 2OMNA 2Z31D 1MCWW 4HQQH 1YMHB 3BMWA 4TVPH 3SDAA 1F4WL 3X13A 4GJTB 3MREB 5F89A 1WT5A 4U6YB 3GRWL 3CMOL 4HC1H 1QHPA 2AQ1A 4XT1C 1A9EA 3UPCA 3CFDB 4ORGA 4U2ZA 5JNYA 3WEXB 3VXUE 2D31A 3IFOA 3BVNB 1MCPH 3MLTA 4D8PB 4RNRB 2A0LD 1YNLH 4NRZB 4P5TA 4RGNB 5ITBH 3OXSB 3UZVB 5I0ZA 5E00A 4DVBA 1KEMH 1AFVH 1IRAY 3KPSE 4WU5B 3L5JA 4AENA 4HBQA 5DZNA 5AZEH 1V3KA 1CQKA 1RZGA 2AP2A 5BXFA 4JN2B 3LS5H 3BO8B 1RK1A 2AJXL 4ODWB 3QIWA 1CI5A 4R8WH 3KLHC 4G8EB 1HXMB 3BP7B 2VLJA 3T2PA 1I9RL 3WFEL 1F2QA 5C71A 1EHNA 1FNFA 3QDJE 2ICWJ 5ILTH 4ONGH 2R56L 3CSGA 1S7SB 4ONFH 4JFDB 5C0GB 3P4MA 4HCRH 1FHGA 4OM0L 4BZ2L 1I1AB 1NFIB 4NKMB 3UROR 4PJ5D 4XP6H 1S7VB 4R4ND 4XRCA 1J0HA 4QLRA 4XMPL 4HXAH 2GIYA 3DMMD 5HHXL 3RY6A 3QEQA 1T1YA 3F6LA 5BV7C 4OZ4A 3BYYA 4X4XA 4E41D 3KPPB 4CVZA 4I2XA 3P77A 3MLSH 5JHDB 2EDDA 1AQDA 2WZPD 1JNHA 4JDVA 2Y5EA 4EIZC 5IVOA 2VDNH 5CZXD 3VU2A 4KQ4L 3TV3L 3Q2CA 2H26B 4YWGL 1KCLA 5CJXC 2DD8L 2DL2A 1CF8L 4PTUA 3V0AC 3SPVB 4PBVC 5ALBL 5EZJA 1LEKB 3MLYH 3QWQB 3WJLC 4JG1H 4XMKH 1FLRL 3U0WL 3KJ6L 2CPCA 5HHOA 3WHXB 5EA0H 2G75A 2LVEA 2VH5H 3DIFB 2I25N 3GB7A 5E8DH 2GY7B 3DXAB 3S7GA 4GH7B 1ZLUH 4X6CB 1A7PL 5EUOA 5EOCL 4FABL 4D0DA 1FAKT 1JNNH 4G6FD 5C0AA 1XT5A 4JRXB 5EC1B 1XGTA 1SM3H 4TULH 4JJHA 4D9RE 4PPTA 3RRQA 3L6FB 1T2QL 2AK1H 1BWWA 4DKDC 2BRRH 2PTTB 3LZFL 2NNAB 3L3HB 2C3XA 1N64H 4XH2B 4JFEA 3NFNB 1BVLA 1JHTA 1NBZB 1KV3A 2ICES 3BW9A 4FP8H 2Z91A 3KLHD 1W72A 2IQ9H 2YD7A 4LSRH 1C5CL 2LFGA 5TE7L 4PJDF 3VGDA 4KI5F 4YPGB 2WSKA 2W9EH 3V5HB 2YA1A 5EU3B 3BP6A 4PRNA 1CL7L 2O5XH 1A14H 1KN4H 1F42A 5BOPA 2EO1A 3EJYC 4K9EC 1U42A 4WFHE 2VLLA 1AI1H 1KOAA 2IG2L 4DVRH 2H3NB 2UZIH 1S5HB 1S9XA 3ARBC 5INCA 2NX5B 1RIUL 3QJFA 3QEHB 4QCIA 2Q6WB 3GMOB 15C8H 2YK1L 1XIWB 1GL4B 4LLDB 5ITFA 5CP3A 5HYJA 2ESVD 1DN0A 2XFXB 3B9EA 3HFML 3OAUL 5BVPL 3KYNA 4R7NA 4PGZA 3RTQC 4JZOB 3V6ZA 1IKFH 1QSZA 3MGAA 1SEBB 3EFFA 4XWGL 5D6DC 3INUH 1KPUA 5EPMA 5JDJA 2ED9A 3LPFA 2F54A 4MXVF 1OY3B 1KCUL 5CKAA 1SHMA 4Y4KC 3CK0H 2E8ZA 3G08A 4M7LH 2D7QA 4L9LA 3LQMA 4FQ1H 3SE4C 4F7TB 1NEZG 3C2AL 5IQ7H 3GIVA 4PJ5A 2P43B 3OB0K 1ADQH 1MIML 2IJ0C 2BJML 1I8KB 3IYLW 3IS0X 3KYMB 1F4XH 3SDDC 1U8QA 3RNQA 1VEOA 4UV7H 1MWAL 1AGBB 1H3XA 5HGHB 2DLTA 3CFEB 3BIKB 3TBTA 1BD2D 2WIIA 1FSKB 2WV3A 5I76B 4FQCH 1DQQB 1PG7X 3V0WH 3LEVL 3DURA 2EDTA 1MQ8A 3RVTC 3IU4H 5CCKL 2OP4H 5HHQB 2BSED 5LWYH 5SX4H 1G7IA 3MJ9A 1CD0A 4UDTB 1LE5A 1G0XA 1P5UA 2NY6B 5MI0C 3OX8B 2YEZA 3AMKA 1N26A 4LK4A 4MA7L 3STZB 2NW2A 5E94A 2FATH 5E8EB 5HGBA 4CMHB 5E0QA 3P9MB 3BHBA 3DWTA 4RAUA 1D9KB 4TTDC 1Q94B 3N50A 3SKOA 2CK2A 4L4VE 3EJYD 4XX1G 3X11A 3WUWG 2GT9A 3GNML 4J8RB 4R0LB 2EDQA 3L3GA 3GZKA 5EZLB 5FKAB 1C08A 3ARBD 4RQQB 5C0IA 1M7DA 2M8XA 3I6LE 4GRWF 1R3KA 4GS7C 1HYSC 1U6AL 4JB9L 5D72L 4P3DA 3JSSA 4PREB 4WO4C 5D1XC 1IT9H 3K4DA 4FFVC 1NLBL 4NM8H 4AT6B 4CVXB 1OAUL 2MMXA 4L8DA 3RTQD 1OSPL 1T7YA 2AJVH 4NBZB 5EU4B 5CIPH 5FO7B 1N5YH 2YRLA 2CDGA 4NQXA 4I9WD 4OF3A 1ROWA 3NFSH 4GAYA 4Q9CA 3GMMA 3LQAL 3CSPA 3FN9A 4AEHL 5DSCA 1X5JA 1T1ZB 1RV6X 4U1MB 4Y4KD 1L7TL 3SO5A 1OLLA 1PLGL 3MLRH 2I9TA 1RK0B 1FO0H 1U91A 1INQA 4CU6A 3JWDL 3JUYA 4JRWA 1NAMB 1U8IA 3CJJA 4P9HH 1QNZL 1JPTL 1P7QD 2ZG3A 4H0IA 3MRRB 5E6ZA 3VXME 1U8OB 2VLKD 3SDDD 5E8NB 1YN7A 4GG6B 3WS6A 1A7QH 3PHSA 1QFWL 4XPTL 3MUGB 4S10A 1NUNB 5HYIA 3HZYA 1TQCC 2VITB 3VD4A 1X5KA 2H1PL 2ZSWA 4H0GA 1NKOA 4LSSL 3WFHB 2BMKB 4OZGF 4HBCL 5F1NB 5TDOB 5CJXA 3HZMA 3RVTD 4KKAC 3O4LD 3K80A 2FZ3B 3DI2B 2WWKT 3WJLA 1E4XL 5ESVB 4OGXH 2DQGH 2OX5A 3D85D 4UILH 5BQ7B 2VR4A 2YPLD 5LGHL 4BKLA 1V3LA 1YY8A 2VSCA 3ULUF 3LIZL 2R23A 2EZ0C 3UZQA 1VKXB 1Y0LA 2KZ1B 3NACH 3M17B 4PJGA 3GK8H 2E6JA 4XP1L 2AJYL 2SEBB 4PRPD 1BD2A 3WIFB 4TTDD 1CZ8L 2X05A 1IGIH 2P24B 5B38G 3L5HA 5F9WC 5CBAB 2P5WE 4MD4B 5C07B 5E9DB 1B6UA 2VMFA 4LSVL 4LGRB 4GQ9L 1HKFA 3S3PA 4QRPE 1WEJL 1DEEA 4NJAL 2OR9H 4C58B 4HUWA 4MA1B 3DV6B 4NKDB 4WO4D 4TUKH 5D1XD 5L2KD 3CLEL 4FFVD 1Z0MA 2BVPB 1A4JB 4PY7A 1FN4B 3PV6B 3U2SA 4ZUWB 1G7LA 5AYQA 2A77H 4MWFA 4NZRL 3T8XB 5CEYA 1UM5L 4EUPB 1LP9E 3C6SB 1FFNB 3BN9D 2J3SA 3WE6A 2VDRH 3MCKA 3D18B 1G0YR 1S9KC 1EH9A 1HN1A 4YXKH 4C4KO 3NCJH 2R8SL 4LBEB 1EXUA 2BOCA 3DHJA 3MA9H 4FQXC 1NAMH 1E6JL 3QUMH 3ARBA 4PJFF 4WIQA 4UU9B 4UB0H 2IPKA 5DLML 2BY1A 4WFED 5FF6A 3RZCA 3AS0A 4K8RC 5T33L 4Q74A 3TZVA 5IFAL 1CFNA 3WIHH 1CDIA 1J1XH 3RTQA 3QDGD 1WWCA 4G8IA 4Q2ZB 4KUZL 1MY5A 2AGJH 2C1OA 3NIGF 1AGEA 1T5XA 4IOFD 4BH7A 1T7WA 2GK2A 5T3ZE 1CS6A 5FO9B 4MQSB 5L0QC 1T83C 3CZFB 3O8XB 3ABZA 3TNMB 5I1CL 1FGNH 1KFAH 2R0KH 3NPSC 4KKAD 4ODHH 3QI9C 2QQQA 3QYCA 4WTZA 1IGMH 1UZ6E 3QZWA 1TZHA 4QGTA 5SWSA 1U8MA 5EOCJ 1P7QA 3P4NB 5F7MC 1QYGH 3DUUA 4PJBA 2AAVA 5T5FL 3X12A 2O61B 2EZ0D 3C8HA 4JHAH 1T21A 1JIBA 3U7YL 1NGQL 43C9B 4OLZL 3B8YA 2JE8A 1JYWA 5DD3L 4FQJL 1AD0B 5E2JA 5TPWL 3MRNB 5A43C 5DK0B 2DI9A 4KGJA 3OR6A 3GHBH 4IM8A 1RUML 5FYJL 4Q6IB 4Y5YB 1JFQH 1CK0H 3GKWL 3O6LH 3O4LA 3W5MA 1WWBX 3B9VA 4EDWH 3RL2B 5D2LF 4HFWA 5J13B 4X6FB 5A16A 5L9DL 1MELA 1F11A 1J0JA 5KZCD 3NCBB 4AYFA 1VCAA 4M7KH 1BJ1H 5TE4H 1TETL 3K0WA 3B9AA 4XCCH 2C7UB 2DJUA 5F7NC 1H15A 4PRIE 4PR5A 2X2YA 3BWAB 1JV5A 4OTXL 4HKXB 4PRHA 4S0TD 1JWSA 3EOBB 1MJJB 3KXFB 4PRPA 3VFMA 2RB8A 4KZEL 1CTNA 1U8NB 2HG5A 1OCWL 3T0EE 5C6PB 1KIPB 1BREA 1G1YA 3P11L 4FQXD 1N6VA 3RPKA 5TDNB 5E2WL 2B20A 5IB2A 4PRAA 2WP3T 4JFYB 1RZKH 2B1HL 2XY1A 1HDMB 1UKQA 2PNDA 1KJMB 1MRCH 5KS9F 2DYPA 3QIBB 4K8RD 4ZAKC 5D1XA 4PY8I 1ZV5A 3PGCA 1ZHKB 3KLAB 4FMKA 3T0BA 3WXWL 4G6MH 1EPFA 1MJ7L 2BNQE 2DKUA 4WI4A 5K9QG 3CVHH 4K2UH 1MREH 4AH2A 3A67L 1EDQA 3NCYS 1F5WA 4NDMA 5F72S 3SDYL 5CBEA 5CAYB 1M7XA 3VRIB 1UACH 1M7IA 3OAZH 3DYOA 5CWSB 4OF7A 4U1HA 3FN3A 2DLHA 1KELH 4LCCB 3THML 3V7AE 3QI9D 2PR4L 5K9QI 1NCDL 1IE5A 3RL1A 1VADA 4JO2H 2V2TA 3QDGA 2EYSA 3TESA 4PFEA 1OGAD 2J8UF 3L3JB 1AGCA 5BO1L 3CPLA 5JXEC 3F7VB 4N0UB 1T0NB 4KKLC 5I1HL 3BN3B 2ARJA 4OQTA 2BHYA 5HDBE 1FGVL 4AG4H 4CBPA 5DMIH 3GI9L 2BDNH 2YD1A 4H20L 2QSCH 3IDNB 3LKNB 2IFGA 2R29H 5GGUA 4HZAA 3ZT7A 1C1EL 5C0DB 1XF4B 1N2RB 3S37X 3SGEH 4HIEA 2O93L 5DJ0A 3S36X 1EUTA 1AO7D 5EZIH 2AABL 1UB6B 4YLQT 4Z7VB 1AGDA 4IDJH 1PJ9A 1SJEA 5IBUB 3GIZL 1G7MA 3LS4H 4JQIL 3EZJB 2FECL 1KT2A 3E6HB 2DF3A 2CJUH 4HXBH 1HQRB 3E6FB 3N9GH 2F53B 4OZIA 1KJ3L 2X5PA 2ARWA 3VD7A 5GQBA 4DTGL 4M61A 3LMJL 3VFWA 2VXUL 4P2OB 4ZOBA 1JF6A 3B6SB 4PJ5E 4HS6A 4ZAKD 2XYCA 4TSCH 1QO3A 1KENL 4Z95H 1IFHL 4HWUA 1D5ZA 5C0RL 1S9WA 4HGWB 3U4EA 5HI3C 4BQ8A 2NY1B 3KS0H 3VFVA 2R69L 4PJCA 5EWIH 3P30H 2R15A 4YHLH 3CGTA 1BEYH 4E41E 1ZLVK 4HUNB 5C0BD 2WAHA 2DMBA 4YGVB 3BKCL 3PWPD 4ODUA 5JLZA 3IJHB 2CMRL 4WVRA 1A9BA 4YBQD 4FQXA 4LQFH 5FM4A 4P4KA 1QVOB 3STLA 5GGSA 4OF8A 4JQXC 4GXUM 2ADIA 4M48H 1UJTA 5ADPL 1P1ZA 3W0WD 4FHBD 1LGVA 4XBGB 4MGXA 2X1OA 1WFNA 1TENA 1CFVH 3ZHDA 1IAKB 1CLOH 4L5FH 1RHHA 1YQ2A 4RAVB 1MEXH 3BP4B 4M9OA 3MRHB 1FL5B 2EIBA 3PWJA 4M6NH 4YE4L 5DUPL 5JXED 4UINH 4HMEA 4KKLD 1T83A 2YBRB 2OMBA 3OKLA 3LDBC 4X7SH 3VXOB 4ZFOB 2HJFB 3O3DA 5IIEA 2GAZA 4M62H 1VB9A 3RZWA 3U83A 1MIEL 3QCTH 1E4WH 3RWCA 1U92B 5BS0D 1D5MB 4QYOA 4I77H 4C56A 1FVDA 1KBGL 1FQ9C 1YECH 4ZOEA 3RUGF 4BFIA 3OQ3B 5IHZB 2RIKA 2I9LA 3REWA 4IRJB 2F5BH 3K8MA 4DUVA 5I71C 1S9VB 3GSWB 2PN5A 4WJ5A 1MFEH 2BNRA 1ZGLA 1NL0H 1UENA 1VGEL 1EAJA 1YMMA 4BSJA 2QHLA 2ITCA 3MV7D 2ZSVA 4IMLB 1U8JB 3PHQB 4M1DL 3BRGC 3R1GH 2VQ1B 1K9TA 3FTGA 1GIGL 3U6RB 4F2MA 2ICWB 2GK0A 2WQ8A 3GSOB 3EJJX 1G7QB 4N8VG 3MJ8B 1ZLWH 5D7SH 4I18A 2R1XA 2ADJA 1SJHB 5F1IA 5GS1C 1FRGH 4JPWH 1MHPH 3MODL 3NTCH 5C0EA 1IQDB 4JY6A 2XA8H 1A6VH 3UBXA 1TCRB 3QAZB 1A3QA 2ESVE 5AZ2H 1CD9B 1DBKL 5HI3D 2CDEA 3G5ZB 5DR5H 3DVGA 4I8DA 2CKBL 2NMSA 4OZHB 4MNGA 1AXTL 2EH7L 2NY0C 2R2CA 3MBEC 5JPNA 4JN1L 3VJ6A 3TWCH 2J12B 3ALWA 5HPOA 2FR4B 1I8MA 2KL6A 4MQ7B 4LSPL 2FO1A 5DWUH 4YBHA 5B38A 1N5AB 4KHTL 5D7JB 1ZLSH 3DBXB 2C4FT 4NM4H 3EOAA 2CDFA 5DMGC 4XHQA 3U46B 2JTDA 4BH8B 4LF3B 3WDIA 3ARDA 4I3RH 1HINL 1FZOB 1SMOA 4GMSL 1U41A 4LU5L 1T4KA 4NFCA 2RFXB 2LAGB 5HDQH 32C2A 5F71A 4EDXA 3BXNA 1O0VA 3NGBC 3FL7A 1VHPA 1GC1H 3G6AB 5JIHA 5IBLC 1KJVB 1MOEA 1JUFB 2BK8A 5DJXA 3GBLA 1W0WB 3R8QA 1BD2E 4PGEA 5D7LD 1YNTB 5F3BB 1KLGB 1JN6A