1B8PA

Malate dehydrogenase from aquaspirillum arcticum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
KTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRNIKVLVVGNPANTNAYIAMKSAPSLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGASVKDMINDDAWNRDTFLPTVGKRGAAIIDARGVSSAASAANAAIDHIHDWVLGTAGKWTTMGIPSDGSYGIPEGVIFGFPVTTENGEYKIVQGLSIDAFSQERINVTLNELLEEQNGVQHLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MALATE DEHYDROGENASE)
publication title Structural basis for cold adaptation. Sequence, biochemical properties, and crystal structure of malate dehydrogenase from a psychrophile Aquaspirillium arcticum.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b8pA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1b8pA02
2TMGA 4W6ZA 3UN1A 3AU8A 1HDXA 3H9UA 2B4TO 3BHJA 2EW8A 1PIWA 4F46A 5GZ1A 3OQ1A 1YXMA 2FR8A 4NFYA 4QX6A 1Y6JA 2OGUA 4WE3A 1JQBA 2HJSA 1OC4A 4R5HA 5C7IO 3OJFA 4W7IA 1WDMA 4Y67A 4CM4A 2X22A 3VOSA 2X4GA 1P1KA 1V35A 5BNTA 1UDBA 5FWNA 3QVWA 2D2IA 1ZEJA 5HWSA 2IXAA 5A05A 3IL2A 4MIEA 1M6HA 1T2DA 3NX4A 1UXHA 3DAGA 1O0SA 4KZPA 1YH3A 4J49A 3Q9UA 4JJGA 9LDTA 1YE3A 1E3IA 1KERA 1N1EA 3VPXA 3PWZA 1ZEMA 5EJ2A 5H83A 4YPOA 3VZSA 2EG9A 1R4MA 1ZK3A 3VTZA 5KOIA 1UZMA 4E12A 2ZB4A 3W8DA 5A03A 1GUYA 3C24A 4EW6A 3S1LA 3ETGA 3WYEA 1T2AA 2EIHA 3H7AA 1YQDA 3TZHA 2D0IA 4Y98A 1EUZA 4DLAA 3TQHA 2G1UA 2YDXA 3ZNPA 4YRBA 1HLDA 3CZRA 4MKZA 3PLRA 4GGPA 1NFQA 3HFGA 5EL0A 4YJFA 5K6AA 1S6YA 5A4DA 6LDHA 2B5VA 1I33A 4K6FA 2BGLA 5A04A 3BMQB 5JNLA 5L4NA 1E3EA 2PY6A 3L6DA 5JXWA 5ILGA 4BNFA 3TL3A 1GPJA 5CDSA 4M8SA 3NDRA 4RLHA 4ZQEA 3UW3A 1DOHA 4MDHA 4P8RA 7MDHA 3TZKA 1NM5A 3ANNA 3FNGA 4I9NA 1WXDA 4YACA 2JFFA 1Y8QA 3D3WB 3MJSA 4IDCA 4GMGA 4PZCA 5A3JA 4O6VA 3C3XA 3R6DA 3RFXA 3JYLA 1BHSA 4BHTA 4WOJA 1PJ4A 1T1RA 4CMEA 3JYPA 1VI2A 4CLOB 2GYYA 2IEBA 4NNJA 5T5QA 2NVBA 4WKGA 4YEDA 3ETEA 1G1AA 3KB6A 2NM0A 3DC2A 2VRCA 1LSSA 1E1NA 1NWHA 1TXGA 1RKXA 3PIIA 4FBGA 5T8KC 5GZ6A 4FFMA 4OOFA 2CDBA 4IDBA 4HP8A 2EW2A 2JD1A 1T4BA 2P68A 4J91A 5DOZA 5KVQA 4GKBA 1H2BA 3QP9A 4L73A 1QP8A 4E2WA 3Q2KA 4B3JA 3IAHA 4LGVA 2VTEA 2NU9A 1FJHA 3I6QA 2P9CA 5DP2A 4YRDA 3I83A 3H9EO 3UICA 1CERA 3V5NA 3H2ZA 4BO7A 3RAJA 4OHUA 5I8ZA 2NTVA 2Y67A 4CPDA 4Q3DA 1YRLA 4NI5A 3VPFA 4BV9A 3GVIA 4AJOA 1C0PA 2FY8A 2WE8A 3L4SO 1U28A 4E5PA 4XYGA 4DBVO 4WLUA 3ZI0A 2NLOA 3ON5A 3H9QA 5JS6A 5L53A 2C0CA 3ETDA 4LSWA 4BQPA 4KP7A 3D64A 4XQEA 1B8UA 3GDGA 4LK3A 3ZGYA 2D5CA 1JAYA 1PU2A 3UXYA 4R51A 3VAZA 2PZMA 5G2OA 3KYDA 2YW9A 3GZNB 4JN6B 1OAAA 1HWYA 4IS3A 1XU9A 4ALLA 1XLTA 2YHIB 1GY8A 3BTUA 1EDOA 2PKRA 1H94A 3NT2A 1D1TA 1XELA 3PJFA 3ZWOA 1ULSA 4CLRA 1JWAB 1UXKA 5IZCA 2VYND 3KLMX 4PLYA 8LDHA 1QR6A 3QIVA 1OZAA 2YZ7A 4B4OA 4BMVA 1H9BA 4WJZA 1GYRA 4Q3EA 5KJFA 2I99A 3KBOA 2IYOA 3FI9A 1GQ2A 2EF1A 2C2YA 1NQ5A 3EYWA 2ZTUA 3HN7A 3Q1LA 3PRJA 1MFZA 4DRYA 2G5CA 4RO0A 3AI2A 3I1JA 4J2HA 4IINA 2UUOA 1AXEA 1DXYA 1TT7A 2AA3A 2O3QA 1KVSA 1WLYA 3NTQA 4M1QA 4XZ3A 3H4VA 3PHHA 3U49A 1EVZA 4LVCA 4FJ0A 3DOOA 4CODB 5JY1A 3VKVA 3U3XA 2VT3A 5A9TA 3PGJA 2YV3A 3W6UA 5TS3A 5EQFA 2GN8A 4UVEA 5C7LO 4HY3A 4XGIA 1RPNA 4A26A 5L45A 3IKVA 3EVNA 5AOVA 1PEDA 2X0RA 9LDBA 1ZJZA 1DC4A 4PFJA 1R0SA 4CUZA 5LC1A 2X6TA 3RUFA 1NWCA 1LRKA 1X7GA 1EK6A 4Z3KA 4Y8VA 1ONNA 2GASA 3D1LA 4RPJA 4D44A 2Z95A 4HNGA 2ILTA 1IULA 1HYHA 1G0OA 3GUYA 1X1TA 5I7EA 2VHZA 4R5MA 2V6GA 4DREA 2NU8A 1LDYA 1DPGA 4Z9YA 3PJDA 4HFNA 4ND3A 4PLFA 1JN0A 3A4VA 2P4QA 5B37A 2FR1A 3P19A 2DBVO 3QVOA 3I6IA 2BH9A 1PL7A 4EYEA 1K89A 2BHLA 3VHRA 3OF2A 1NFRA 2ZYGA 4WNCA 2HMSA 1Y5RA 1ZK0A 3ANLA 4AJEA 2DUWA 2TMDA 5BT9A 4E4YA 4I1IA 4W9NA 3DZIA 3HUDA 1D1SA 4BO8A 2Q45A 4YYZA 3OSUA 2H6EA 5TNXA 4CMAA 4FFNA 4MVJH 3PYLA 4Q3AA 2LDBA 4XYLA 2FP4A 4E30A 1DRVA 1UJMA 3KO8A 4XJTA 3AUUA 1NR1A 1P33A 1R6DA 2Y1DA 1RM5A 2JD2A 1E6UA 4Y9DA 3RFVA 2B69A 5CG2A 4NDNE 3OIGA 4OXNA 1LSUA 3I4FA 4E2ZA 4ZQBA 2X7HA 2CD9A 3KYCB 3L0DA 4Q39A 3UAGA 3RBZA 2C07A 1HRDA 1I0ZA 2HRBA 4R3NA 1Z74A 2H9IA 4WOKA 2YUTA 3EUWA 4H7PA 2PD3A 3W8FA 2GSDA 5T64A 2XXBA 4MVJE 2ZTLA 3F9IA 4CL3A 5JO0A 3ONFA 3ZWMA 4YAJA 3C7AA 5T57A 1MX3A 1OBFO 1N2SA 2Q1WA 4BGIA 4HFRA 1HDOA 3KM0A 3DFUA 3A28A 1EQ2A 3OJ0A 1PGNA 2EXXA 4UVDA 1T4DA 3TZQA 4CLEA 3W4IA 4PVDA 5G4KA 1C3VA 1PJBA 2WD7B 4MPDA 4WNIA 1F14A 2Y1EA 1YVEI 1PS8A 5CEEA 1B26A 1SNYA 4CQLA 4FFRA 4A03A 4LRTB 1HZZA 3ZZNA 1Y8RA 4OXKA 4CL8A 4GQAA 2O50A 1U3WA 2R00C 4MKXA 4AJKA 1JU9A 2OL4A 1A7AA 4J43A 4W4TA 1BRMA 1J0XO 1PGQA 3HDYA 4WEQA 2I65A 1ZIDA 2POQX 2QZ9A 2X9VA 3NT4A 1V3UA 3KTDA 2HK8A 3DTTA 3PJEA 5IDWA 2X0IA 1H2HA 1E3JA 3VPGA 3ZWPA 1GD1O 2NUAA 4P38A 3RD5A 1YGYA 4XR9A 3DBHB 4YQZA 3D0OA 3IQDB 4U6SA 3JQ9A 3H6KA 2PFGA 1FDUA 1I2BA 4I9UA 1M6WA 1Q0LA 3QVXA 4BO1A 1H6AA 4ZQHA 1PJSA 2VYVA 3SJ7A 3I9MA 1P44A 1YL7A 1SZJG 4DPKA 2Y99A 4FFPA 2GUGA 4I5GA 3AOGA 1OC2A 4LSMA 3DOJA 4KWIA 5AXCA 2J6IA 1UP7A 3BMCB 4QT0A 2Q2WA 2Y0DA 3PFWO 5IN4A 5BR7A 4AJ2A 2BGKA 2PZJA 2GO1A 4RL6A 3RCBA 3V2HA 4YXFA 1DIAA 3LF2A 1LLUA 1NPTO 4BMNA 5I9LA 4WUVA 3AW9A 5HS4A 3GT0A 7ADHA 3M2TA 1A7KA 4UEOA 3WSVA 5KVSA 4Q3NA 1NX6A 1DC6A 2ZB7A 1QYCA 1YDWA 1E6WA 4G65A 3QV1A 4CV0A 3DBLA 3DHNA 3WFJA 3V1UA 4HKTA 3HDHA 1EEHA 3PDUA 5G0TA 2X1HA 4J4HA 4JGBA 3DHEA 1LA2A 3EVTA 3CH6A 4BO0A 3RC9A 1YBVA 5DF1A 4OMUA 3OP4A 3PIDA 4XWYA 2AE1A 2D8AA 1NVMB 4R3WA 3MOGA 1E3SA 3STHA 3O8QA 2YV2A 3KSDO 2GCGA 1DB3A 1EVYA 4TSKA 1DAPA 4YAIA 4BB6A 4BUCA 2Q99A 3T4XA 1XEAA 2O2YA 5AVOA 1QYWA 2H5LA 1W0CA 4QQRA 4FCCA 1UZNA 2IZ0A 4LN1A 1IUKA 1Q7CA 2NU7A 1HE5A 1U2DA 3H3JA 2DFDA 1MV8A 1JTVA 1U3UA 4DUPA 4ND5A 2WDZA 4DPMA 6ADHA 1CDOA 2W8ZA 2Q1UA 1QLJA 2VQ3A 3L4BC 4QSMA 1YQGA 1TA4A 4RVSA 3TN7A 4I8XA 4N7RA 4A73A 4XJSA 1L7DA 3OM9A 4E0BA 1IZ9A 3C85A 4GVLA 4L74A 4RDIA 4UUMA 1NQAO 2ZTMA 1GU7A 3ZV6A 1WAMA 2O4UX 3MJTA 4BNXA 2AQHA 3H8VA 4FFOA 4WK6A 5T6BA 3TWOA 1T2FA 2PGJA 4HX5A 2DM6A 1DLJA 3E5MA 2IYPA 3CZMA 1AN9A 3DB2A 3MCVA 1DLIA 2C82A 4YJHB 5KVCA 4AJJA 1FDVA 1FDTA 4TROA 2ZCVA 2Y05A 3KYBA 3EW7A 2ZK7A 1I2ZA 1YB1A 1ZXLA 2AXQA 3ICCA 3QWAA 1A27A 1JKJA 1ISHA 4A27A 5HRUA 2HQ1A 4PLVA 1BDBA 3S8MA 1ADBA 1GUFA 2JAHA 3JYQA 1GCUA 4RORA 1R37A 2O3JA 3LC7O 5TJHA 2OBYA 3Q9NA 4J4BA 2IDZA 4D41A 1DHRA 3ZU3A 3MWDB 5JW6A 4IZHA 1V0JA 2QX7A 4N5LA 4QFCA 1NTOA 2BFMA 1K0UA 4OGWA 4J90A 5JAQA 3WXBA 2C29D 1KVTA 3GY0A 2BMAA 1IHXA 3JTMA 3WLEA 2XXJA 3RC1A 5COQA 2FPPA 4J3FA 4G81A 4X54A 4D3DA 1I01A 5I7SA 4EBFA 5AQ1A 1A9ZA 4NBUA 1QORA 3I52A 1JKFA 5AXAA 3RUHA 3B1FA 1PWXA 2W2LA 3DBRA 4IMRA 5IDYA 2WJPA 3EAGA 3RJ5A 2WSBA 2QYTA 3V8BA 2VWQA 1PL8A 5F5LA 3O03A 1PS9A 5ENDA 4A2CA 3E9QA 5L7TA 1CJCA 1ONOA 5MDHA 2RAFA 3GEGA 3PWKA 3LSYA 3KHUA 3S2FA 1X1EA 3PP8A 3M6IA 4IQGA 4ONEA 4G5HA 3I3OA 3TOZA 4BNTA 3SLKA 2X86A 3F4LA 3WBFA 4Q3CA 2ZQYA 2B5WA 3PTZA 4XR4A 3ZWYA 4IQ0A 2O48X 1KBZA 1PWZA 1IPEA 3TFQA 3KVOA 4I5EA 3D3EA 3VH1A 2J5RA 4GPD1 4H15A 4IXWA 4ALNA 2DVMA 4OKIA 3IP3A 1SO8A 2Q4BA 1I3NA 5BSGA 1UXGA 2V6FA 1SOVA 1VL0A 3UOGA 3OEWA 3PHIA 4JXKA 2D1YA 1X0VA 2EEZA 2YFHA 1SCUA 5G0SA 4W99A 1PQWA 2UV8A 2BFAA 5TT1A 4FN4A 2CFCA 1VRWA 4TVBA 4N5NA 2YQ4A 3SXPA 4EITA 3QE3A 1SC6A 3I5MA 3GAFA 3ZNNA 2I67A 1ZVMA 2VZ8A 5TJ9A 1B8VA 1HTBA 3JD3A 2GF2A 2YDYA 3RASA 3PFFA 1BSVA 1JVBA 1TT5A 1IZ0A 2PNFA 3WYBA 4RGBA 3WNQA 4BVAA 1M66A 3F5SA 3RVDA 3JQBC 1UXIA 5CDUA 3H5AA 4MP8A 2XOXA 5COBA 5EPOA 3UVEA 3GH3A 1C1XA 3GMSA 2HCTA 4RVGA 4K28A 1U8XX 4JBIA 3LC2O 3GZ4A 4LCJA 4XYEA 1HZJA 4UULA 5EESA 4CM7A 4GX1A 2HMWA 4D43A 2P5YA 4CR7A 1WNTA 1LX6A 2WYUA 4M49A 4ZN6A 4LISA 3UUWA 1YONA 1F12A 3S2IA 3CE6A 3TNLA 5JMPA 1GDHA 1NAIA 1X7HA 4NBRA 1LLQA 2EP7A 5TLSA 3K96A 4BKRA 2CUKA 1VL8A 1GEEA 3AI3A 1YOVA 4CM8B 1LRJA 1NPYA 1VLLA 2I66A 3ONEA 4CMIB 5ITWA 2GLXA 4IDAA 5B4UA 5JDCC 2C7GA 4CLHA 4YB8A 2D3TA 2P4HX 1EFLA 3FN4A 4NJMA 1E3LA 4E5MA 2BI8A 2O2SA 1GR0A 1AGNA 4WCFC 1LNQA 1ULUA 2Q1SA 3NGXA 5IDXA 1HYGA 5TRTA 2FR0A 1GZ3A 5BSEA 4AVYA 4UVIA 3NJ8A 1JW9B 4Y6SA 4RLSA 4UVHA 3ENNA 3P7MA 2OXIA 1WMBA 3KLPX 4DWVA 3C7DB 3UFXA 3CPSA 4GWKA 1G0NA 3LF1A 4ESOA 4CM5A 1HE2A 2Q46A 3PDJA 3OH8A 3FPCA 3HDQA 1H9AA 2FHSA 3DQPA 3NKLA 3OIDA 3HHPA 4EEXA 2CNBA 1V9LA 1QYDA 1PJLA 3H2SA 2ET6A 2PK3A 3AI1A 3G17A 2VUSA 4AJPA 2AEFA 3E9MA 4S3MA 5JAIA 4GX2A 4KWHA 4BIIA 1YJQA 3K92A 1QRRA 5DCWA 1DJQA 3CSDA 4YVFA 4QXMA 3E18A 4AFNA 4BO2A 3DMTC 1IPFA 4QEDA 4II3A 4QFDA 4RPLA 1V6AA 2ZJ1A 3QHAA 4MVJA 3U62A 5G0VA 4BKQA 3ZWXA 1UDAA 2B83A 3AM5A 3CEAA 4UEKA 1KEVA 4RQTA 1E7SA 3QVSA 4MVJI 3ZHZA 3MOIA 1HLPA 2DPGA 5DBGA 4EUFA 4GGOA 1R4NA 4NIMA 4GVXA 3LQFA 5JMWA 2DAPA 2QYSA 4D3SA 1UP6A 2ZB3A 5IDQA 1GZ4A 1UXJA 3EC7A 4BNVA 3WTBA 2Q49A 2CF6A 1E3WA 1PJTA 4KUHA 4L4SA 4NH4A 3OA2A 1BVUA 4UUOA 3DZBA 1P77A 3K31A 3R1IA 3Q11A 4R01A 5JYEA 1B16A 4YJGB 4J1TA 1RYEA 3VVBA 3QWBA 5ITVA 2AQ8A 5TF4A 5I9NA 4BB5A 1ADFA 1LRLA 3VPHA 4Z0HO 1J5PA 2OZPA 1QKIA 5H82A 4ND4A 2VCYA 4E6PA 4RF3A 2C59A 5C37A 3HJAA 1E1LA 3BAZA 2W2KA 3ZHBA 5KKCA 4CQMB 1GL3A 4CM6A 4OH1A 1ZNQO 3IDSA 3D4PA 1QSGA 2C2XA 3WOHA 4CUJA 5C7OO 5T67A 1CQIA 2OORA 2GPTA 2VT2A 4UUPA 3WGYA 4R1UA 3U09A 3GLQA 1NYTA 4BNMA 3K2EA 4BNNA 3GFBA 3WIDA 3JV7A 3GNSA 3F47A 1O94A 4L8VA 2QG4A 5HBRA 3GVPA 4GSLA 4PCVA 2VYNA 1DC3A 4HFJA 2C5EA 1H0KA 4BNUA 3RFTA 3RBXA 2UYYA 2JAPA 4OAQA 5FEUA 4IY1A 4CR6A 1Q2XA 1UH5A 1AE1A 1Q7GA 1QYVA 3S2GA 3OHSX 5DBFA 4D7AA 3I9OA 4EJ6A 1YB4A 3ZH2A 1KVUA 1X7DA 3DL2A 2DPHA 4U6QA 1J4AA 5ILOA 3X2EA 5L40A 3HQ4O 3ZHXA 5DNAA 3RUDA 2A4KA 3GPIA 2AW5A 4QUKA 1E7YA 1LDMA 4WCFB 4XRGA 4UEJA 5KNLA 2XF8A 3WQRA 3JQAB 1PTJA 4YT4A 1ZSVA 4RV9A 4DQVA 1HL3A 5CPFA 2X5JO 3N74A 2FN7A 2JL1A 1VSUA 2JD0A 1PX0A 4CR8A 1IY8A 3JD4A 5EMHA 2JCVA 3OQ6A 4BNYA 1FXSA 1SB8A 2P9EA 3G79A 2YV1A 3DBLB 3KOUA 8ADHA 1ADGA 4J1SA 2CY0A 2ZQZA 3RIHA 5FFFA 2NVUB 3T7CA 4RJTA 1N8KA 1GAEO 5EN4A 2A94A 1FDWA 1B0AA 3GVXA 3DZHA 3JD1A 2CDCA 4B3IA 1F8FA 4FFLA 2UVDA 4FD3A 3IUSA 2JKVA 2HDHA 1ORRA 4JBHA 3D4OA 5FF9A 4K1LA 1ZBQA 1ZH8A 3FD8A 4U8GA 3TFOA 2BFPA 1EQUA 1VSVA 3E03A 3RJ9A 1EE9A 3WMWA 4NFSA 5JPIA 2CVQA 1ENYA 1LSOA 3M1LA 3WWYA 2GD1O 5C3MA 2O7QA 2RCYA 3KEOA 5G0UA 5U9CA 3TDKA 1RM3A 1U7TA 4TRNA 4NU6A 1ISFA 2G17A 3EMKA 4IUYA 4E13A 4MKRA 1Y5MA 1K2WA 4L0QA 1FF9A 2V65A 3UGKA 3NGLA 3R3JA 3FTPA 4INAA 3FBGA 4GKVA 5THQA 3EZLA 2PH5A 3G0OA 1KC1A 1NP3A 3G49A 3LT4A 2J8ZA 3JQFA 4RQUA 1GUZA 4B7XA 4JBGA 1P1HA 1WPQA 1Q1NA 2UUPA 4G2NA 1KETA 2GN4A 4EEZA 4YT5A 3E8XA 4CM9D 4U7WA 1YBMA 4GH5A 4MO2A 4B8ZA 4JJIA 2GZ3A 5A5FA 1YBAA 3PZRA 1DO8A 3V1TC 2ZATA 4TRRA 2B0JA 1PJ2A 4RPHA 1PJCA 3JD0A 2Q2VA 5B4TA 4U5QA 1XKQA 3SEFA 2EERA 5EIOA 1ARZA 4PG8A 2H1SA 1ZJYA 1N7HA 4JJFA 4DQUA 1B14A 2E82A 1CRWG 4JP2A 3CXRA 1A4IA 2JCXA 3ZHYA 3GAZA 4ZA2A 5IJZA 3ZWCA 1DRWA 5JDIC 4LMRA 3A06A 1L7EA 1MXFA 3CMCO 4WASA 5H81A 3RUCA 4A7PA 4U0JA 4CMGA 3HG7A 3KSZO 3LT1A 3CIFA 4OSPA 4UUNA 4I9HA 2DTDA 3E48A 2NTNA 1B3BA 4XQCA 3RUIA 5TGDA 2BFOA 4RVHA 1P1RA 3B1JA 3A14A 3SJUA 3WDSA 1RYDA 4B79A 3GF4A 4B4UA 4L75A 5U1PA 4CMBA 3C8MA 4LMPA 4B7UA 4R9SA 4J0FA 2BLLA 4HFMA 5JC1A 2X0JA 3O26A 2CVZA 1ZXBA 1ZZEA 3U4DA 4XIYA 3PZBA 4OIMA 1SPXA 3ZW8A 3GNQA 1HXHA 5GZ3A 3DZFA 4NK4A 2VOEA 4MVJF 1P9LA 3GR6A 2PGLA 1V3TA 2YYYA 1Y9AA 3EGOA 3MJVA 3RI3A 2NQ8A 4R1SA 4IDFA 4OSOA 4JK3A 1EUDA 2AQIA 5BSHA 1U3VA 3H9JA 4UREA 4CM3A 4D0SA 3AUSA 3VKUA 3O9ZA 2JFHA 1E6EA 3QWIA 2VN8A 1GTMA 1I3MA 4OOEA 1ADCA 2VHXA 4IQ8A 4WLVA 1MA0A 2FPGA 1WDLA 3B70A 3MTGA 4D46A 4DC0A 5KIAA 1E7WA 4EUEA 3AK4A 3ROQA 5K6AC 1MP0A 4F45A 1K3TA 2G82A 2ZYDA 1XU7A 4ALKA 1YL6A 3FPLA 3JQ8A 2YHUA 3W1VA 5CDYA 4RDHA 3FR7A 2RHRA 3KSUA 3JQGB 4II2A 3WIEA 1DRUA 5KJ1A 4PLGA 3OECA 3QRWA 3GMDA 4GAEA 1MFPA 2B4QA 1EBFA 1LSJA 1GV0A 2QHXA 1Y81A 2PGDA 4IDDA 1EUCA 5CP8A 1X14A 3R0IA 3A1NA 4MOWA 4XYMA 1NQOA 4FJ2A 1WWKA 5ICMA 3D3WA 3JQ6A 1W4ZA 4R9RA 2ZKLA 5A5EA 4TZTA 1A71A 1TT5B 2OP0A 3JQ7A 1BTOA 1T25A 5L4SA 2AMFA 4EZBA 2OO5A 3VZPA 4CLOA 2IE0A 4Z3DA 3IJPA 5TX7A 2EKLA 5FYDA 4CMEC 5CFZA 3LLVA 5HM8A 2OHXA 3WTCA 1C1XB 5JCXA 3S55A 5A9SA 4R1NA 2QQ5A 2W98A 3NDJA 4FPXA 1HT0A 1KS9A 5JCJD 1RM0A 1EFKA 1ENZA 3ORFA 4NHEA 4B4WA 4C7JA 1LQTA 1O89A 5A06A 2PKQO 5L3ZA 2Y66A 2XAAA 2AEMA 3GOHA 2E48A 2Y1FA 1FDSA 1YOVB 2B36A 4OL9A 1Z7BA 4BS9A 5BSFA 5IXSA 4E2XA 2NQTA 4M55A 3K9QO 5F1KA 5A9RA 3F1LA 3GEMA 3MJCA 4J9VA 4MVJG 3UCXA 1VE9A 1T1SA 3OETA 4KMSA 2WM3A 1NNUA 3BA1A 2BRUA 4ZRNA 3ST7A 2VHYA 1XWFA 1DFIA 1CQJA 1KVRA 1P45A 5DN9A 4Y6PA 1R15A 4GWGA 4BGUA 4KTTE 2D5AA 3PGXA 4MINA 5LCXA 5IAAA 4K26A 1MLDA 4TVOA 3NUGA 1HDRA 2B35A 4RZHA 1NHWA 4ROSA 4ZQGA 2G0TA 4D0RA 1TLTA 4UVGA 4CM4B 1LLDA 3CUKA 3FNEA 1XGKA 1YDEA 1AXGA 3DAPA 4CQMD 3ITDA 3GA0A 3WYCA 5L9AA 2I6TA 4MP3A 3R3SA 1Z7EA 3GZNA 1GQYA 3TPCA 1LTHR 2G76A 5IG2A 4PLHA 3D4NA 1TI7A 2YHIA 3QWFA 4K9DA 4JX8A 4TMFA 1MB4A 2JHGA 4WLNA 4DYDA 3WX0A 1R16A 1DDOA 1R4MB 1Z82A 1Z75A 3AUAA 2HK9A 1DBVO 3E9NA 1YWGO 3ASUA 5IZCC 3FSRA 3ABIA 5DZSA 1HDCA 3VZQA 4GX0A 5F3RA 3PEFA 1K6JA 2VYVD 1SEPA 5ADHA 1SMKA 2FWMX 2DTEA 1CETA 1GPDG 3NDIA 5IZ4A 1C0KA 3PQDA 2NADA 4IMPA 1NAHA 1R4NB 1ZO8A 4U0KA 4YJFB 4DLBA 5LDGA 2O3RA 3L07A 1LEHA 3RU7A 2B37A 1U8FO 4AJLA 4FGSA 2PWZA 1R12A 3INTA 1KOLA 3E1KA 3JQAD 1E3WB 2GZ2A 2PD6A 2DFVA 3LU1A 3QWHA 2R6JA 4OQZA 4OXYA 3GG9A 1NHGA 3HN2A 3ZWVA 1PGPA 3VZRA 4ZRMA 3WMXA 1RM4A 1LC0A 1N5DA 3FHLA 1P31A 3KXDA 3WQQA 3F4BA 1Y8QB 2YJZA 3D5TA 1EVJA 2OP1A 4IDGA 4OKNA 1LBEA 3PHJA 3VH2A 5F5NA 1ZCJA 3FF4A 2E4AA 3D7LA 1ZUD1 3P2YA 3WGZA 5KCZA 2CVOA 1A4UA 4JQCA 2YY7A 3TZCA 1BVRA 4JIGA 1QG6A 5T8KA 4ALMA 5DDIP 1HKUA 3AM4A 5JE8A 4DIFA 4AJ1A 4PZDA 4KDEA 4B7CA 3WGTA 3LDHA 2FMUA 3RWBA 1KVQA 4MVJP 3ICPA 4NR0A 1BXGA 2IRWA 4BNHA 3P2OA 3NT5A 3JYOA 3GHYA 3LK7A 5BNFA 3DMYA 4HXYA 3OBBA 1D3AA 4CV2A 5CHEA 1PJQA 3DONA 4P4NA 3DOCA 2EGGA 3PWSA 4FOSA 2RHCA 1KEWA 4FJ1A 5AXDA 5K0ZA 4GSKA 2OMEA 4KDFA 1E7RA 3Q2IA 4W9NC 1H6BA 4AJ4A 3PI7A 1JVSA 4E21A 4HUJA 3ZV4A 3PVZA 1Q7BA 3AY3A 5L7WA 1JDJA 1XIVA 5IN5A 2Z5LA 5DCUA 4ND1A 3WB9A 3ZU2A 4BO5A 4CMHA 5L95A 2FOIA 3INRA 3Q0EA 3ZWWA 3ROPA 4FSHA 4FS3A 2BELA 3VDRA 2VWPA 2C54A 1NASA 2Q4EA 3KYCA 3KYDB 1E7QA 2J3JA 3TSCA 4DMLA 3FCOA 3KEQA 4NBTA 3K73O 1DEHA 1NVGA 4J0EA 3OJOA 3OA0A 4H3VA 4FW8A 3DWFA 2A35A 1ZMTA 4GX5A 4CLRB 4YAGA 1ZSNA 3PJGA 1BW9A 4KQXA 1PZHA 4W7HA 2HUNA 3RKUA 1BGVA 3RUAA 3HB4X 1ZFNA 1Q0HA 2Y68A 3TOXA 3ITKA 5J23A 2I3AA 1UR5A 1Q0QA 1XQ1A 5AXBA 3NJ4A 2GR9A 4LCEA 2VUTA 1PGOA 4YA6A 4O1MA 4Y6RA 2J3KA 2SCUA 4A5OA 3Q6IA 3UCFA 2QRJA 5CEJA 1Z6ZA 2HO5A 4CJXA 1D4FA 1GZ6A 2FSVA 4K6CA 4FQ8A 4BGVA 2W2LD 1JLLA 4I08A 4N54A 2Y1OA 3JQEA 5I9MA 4KQWA 2GZ1A 5KJEA 4BNJA 4RF2A 1C1DA 4XIJA 4QO8A 5COAA 4XB2A 3ZV5A 2AG8A 2DC1A 1LXCA 3JQ9C 4NMHA 4XD2A 1A72A 3AOEC 4J1QA 4DPLA 1MXHA 4IS2A 3GQVA 1NFFA 1X0XA 1YB5A 4XGKA 1PZEA 1T2EA 4Q9NA 4PLZA 1TEHA 5JSFA 2NTJA 3G3EA 3L6OO 3BMCA 2JCYA 2V6MA 2P91A 4IJWA 4FDAA 1GV1A 1LU9A 1NPDA 4RVFA 3UH1A 4AL4A 4FB5A 1E92A 2OBNA 4MIYA 2AG5A 3ZU4A 2PZKA 4E33A 5CAEA 4DTIA 1X13A 4YTEA 3CMMA 5IF3A 3I9NA 1NBOA 2DBRA 2HMVA 3NAQA 4FOOA 1SBYA 5DP1A 3TJRA 1PQPA 4ALIA 2F00A 4AG3A 3S2EA 5I7VA 1N92A 4WEOA 3AUTA 2AHRA 3WQSB 1RWBA 4O63O 3I9JA 3X2FA 3QY9A 4E32A 2A92A 1BWSA 4DIBA 2J3HA 1QV6A 2DKNA 4C7KA 3I9KA 1OI7A 1LDGA 4WLFA 3NV9A 4IGFA 5L7YA 2QZZA 1P1IA 3C1AA 2ZTVA 3K2BA 3PYMA 3EZYA 3W4KA 4QO7A 2VRBA 4IPTA 1P1JA 2E37A 3UF0A 1A9YA 4XEHA 4O0LA 2IXBA 4R41A 2FZEA 3C1OA 1DSSG 1W73A 4DMMA 3GRPA 2CDAA 5DOVA 3GHHA 5ENVA 2QW8A 4CV3A 1MC5A 1MGOA 1Y7TA 5KWEA 5TQVA 3RSHA 4ZJUA 4IJKA 3I4CA 4A0SA 3WLFA 2ZIZA 2O3SA 2HKIA 3GN2A 3JQDA 2GGSA 3DR3A 3M2PA 1DIBA 1ZK4A 3SVTA 1HSOA 1TVEA 1T24A 5JLAA 3BIOA 1PSDA 1QYXA 2NVWA 4B8WA 5I7FA 1NVTA 4DYVA 2VZ0A 2Y0CA 1KY5A 3EK2A 2DQ4A 3AWDA 3GGOA 3O4RA 3QW2A 1D8AA 1XSEA 5G4KB 1LUAA 2Q50A 3G1UA 3JD2A 4CQLB 3O38A 4QTZA 5TT0A 3ANMA 1B15A 4BO6A 1I3KA 1IE3A 1WW8A 2R00A 3HB5X 5JAMA 1ENPA 4YJHA 1Y8RB 4BKOA 2J3IA 2RH8A 3JQ8B 3KRTA 3I9LA 1E5LA 2PLAA 2X9NA 2I76A 4ZQFA 4IGEA 4NJOA 1DC5A 1PS0A 4TKMA 5ER9A 1G6KA 3FBTA 5HA5A 3MZ0A 4BNIA 2PV7A 1IL0A 3OMLA 4O59O 1E1MA 3LT0A 3KZVA 2PZLA 4BOYA 1GEGA 2W4QA 2O3TA 4R69A 1C0LA 1DHTA 1IB6A 4OJNA 4PLCA 3JQ7B 3NTRA 2RH4A 1XCBA 4GL4A 1HSZA 4HNHA 4D42A 3B1KA 3BHIA 3WGHA 4R16A 3F5QA 4WPGA 1M76A 1QV7A 4IJUA 5DT9A 3W8EA 3E6AA 4GLLA 4YDRA 4E31A 1VKNA 3IJRA 5ES3A 5A9SB 4XYBA 1ISIA 3CKYA 3JQCA 3K5PA 4PLTA 5AYVA 3HWRA 4PIVA 4DC1A 1PR9A 3NRCA 4I5FA 3IIEA 3MWEB 3VH3A 1CWUA 2BKAA 4RCVA 2QRKA 4MVJD 4W82A 1I32A 3A9WA 4FGWA 4ZVVA 5G4LA 4YT2A 4XB1A 2J5QA 3DXFA 5JC8A 1IYZA 3UKOA 3ROMA 3VH4A 2OFPA 4PG5A 3HZZA 5F1OA 3WNVA 5JYDA 1LJ8A 4P4GA 1VM6A 4J6FA 4CM9A 1MG5A 4OQYA 4IDEA 2EV9A 5IFLA 2ZB8A 3ULKA 4RF5A 1KIFA 1U4SA 1WP4A 5U4QA 4MVJM 4R54A 2UDPA 2PR2A 4J7XA 3BMNA 2PD4A 1OMOA 2F1KA 4J7UA 1WZIA 3VTFA 1KYQA 3O8QB 2HK7A 4AJIA 1Z45A 4CV1A 3IP1A 2HMTA 4RZIA 5BQFA 1JAXA 1LDBA 4I5DA 1U4OA 4WECA 3EY4A 4J2OA 1EBUA 1Y9EA 3BXXA 3AJRA 3IUPA 1QLHA 3SLGA 3U9LA 2VRCD 4MIOA 4YWJA 1E1KA 1UAYA 4TWRA 3ENKA 4Z9XA 1YL5A 4PVCA 2P9GA 3L4BA 5MGBA 4J1NA 1AUPA 3GVCA 1HDGO 4R1TA 1HE3A 2C7VA 4NQZA 4NZ9A 5EQDA 1PZFA 3PQFA 1K5HA 2PH3A 1WVGA 2XPCA 3F46A 4LRSB 5BNIA 3TF5A 4H16A 3FNFA 1B2LA 3K6JA 2VTDA 4PG7A 2WD8A 4M54A 2WWRA 4O5OA 1WZEA 1Z73A 4J16A 3RUEA 3FWZA 4WLEA 3C7CB 3ZN2A 3BMOA 2RBEA 1JA9A 1N9GA 4IBOA 1J49A 1SOWA 2VNAA 4PG4A 3PPIA 1XQ6A 5DULA 3DFZA 4BNZA 1T2CA 1K6IA 5A1TA 3W4JA 4YT8A 2JHFA 3RROA 3BTSA 1EDZA 1NR7A 4J7CA 4AJNA 1P1FA 2DBZA 1HEUA 4XGNA 2I5PO 2QIOA 1SB9A 2Q2QA 4J9UE 1N1GA 2C20A 3FTNA 4RPGA 2YQ5A 4XDZA 4B3HA 5TIIA 4XRRA 4EUHA 3U5TA 4CUKA 1F0YA 4R4JA 2X5KO 2W90A 4Z9FA 2X5OA 3DHYA 3JSAA 3AY6A 1HETA 4JP3A 4L76A 3P5SA 2DT5A 3I23A 4CM8A 1GQQA 1XG5A 1VL6A 3IOYA 4CMIA 1A5ZA 3DEYX 3WWZA 4M86A 1ENOA 1GYPA 4DGSA 3ROKA 1F17A 3SBOA 1PR3A 2IODA 1CF2O 5CEFA 1NXQA 4PLWA 4JLWA 1E5QA 1O8CA 1YQXA 2JFGA 1FK8A 3D5QA 2PTGA 3ZU5A 4E5NA 3QSGA 4BO4A 3LYLA 4FC7A 1XA0A 1BXGB 3QVTA 1I3LA 2O3UA 3IKTA 1AHHA 4IJVA 4DA9A 4S1VA 2Q3EA 3DBRB 1XHLA 3TL2A 4IIVA 4PZEA 1EMDA 1YS4A 2A9FA 2HU2A 3BYZA 1LQUA 4NBWA 3WSWA 2D4AA 2DU8A 1DIRA 1U2GA 3U4CA 4KUGA 3WFIA 5CDTA 1OFGA 1LLCA 5L51A 1ZK2A 2X58A 2NSDA 1ISJA 3H65A 3OFSA 3DZJA 2HSDA 3COSA 3VDQA 4E5YA 1TB4A 1HYEA 3L9XA 3WS7A 1U5AA 3EHEA 3GK3A 2EWMA 1B3RA 3LC1O 3BTVA 1HF3A 5JCJA 3RC2A 5HTOA 2AE2A 1UAGA 4R68A 3B20A 3INGA 5CG1A 1KY4A 3HADA 3VVCA 4KOAA 3ZWAA 4BV8A 1I2CA 1LDNA 3GUCA 3AFNA 3NEPX 1XR3A 3M1AA 3HSKA 2HJRA 3ZCXA 4PG6A 4DBZA 1MC4A 3BMQA 2Y1GA 3WG9A 1P0FA 4C4OA 1BW9B 1Y1PA 1QMGA 3QQPA 1O95A 5TC4A 1I5RA 4TZKA 4TKLA 1CEQA 3GVHA 4YJGA 1AHIA 2EGHA 4Z0TA 4ZD6A 3WGOA 4A10A 1K6XA 2I9PA 4MP6A 4EDFA 5TSDA 4URFA 4ND2A 1D7OA 4CM1A 1PGJA 4CLXA 3WBBA 4DXHA 3GN1A 1U1IA 5KJ6A 3JQBA 3GDFA 1MUUA 2FRDA 3SX2A 4OO3A 1C14A 1VPDA 4OYRA 4B4VA 4CQMA 5ER6A 4QECA 2EKPA 2QRLA 4ZHSA 1ZKMA 3AU9A 3SC4A 1VKOA 3RU9A 4NK5A 4NFHA 3F3SA 5JO9A 3RC7A 4BO3A 3DAFA 3PHGA 3PYXA 2NV6A 4YAKA 2EJWA 1EZ4A 4DL9A 5C5IA 1OOEA 2X9GA 4NU5A 1M2WA 3GRKA 4ITUA 3ADOA 1R0LA 3Q3CA 4FR5A 4GI2A 3WJAA 4EGFA 4YBZA 4F6CA 1I10A 3AY7A 1C1DB 4JCOA 1UP4A 4CMKA 1U7HA 3H9GA 4RPKA 2VHWA 3AOEA 4E2YA 1H5QA 1SEVA 3LT2A 5KJCA 3F1KA 2HMUA 3L77A 3HDJA 2FZWA 5JDCA 2IEDA 4JNKA 2PKQP 1U3TA 2IZ1A 4KUEA 4XKJA 2FPIA 1XYGA 3DZKA 2BI7A 4OM8A 3AFMA 3V1YA 4IZIA 4NJMB 4BQRA 4XA8A 2AQKA 3HE3A 5THKA 3ZWNA 4WCFA 4IXTA 2CSUA 2CZCA 3K8ZA 4CLDA 3VC7A 2VUUA 3H5NA 3JQAA 4WLOA 2D59A 1EK5A 4N18A 3ASVA 4L4XA 3WGQA 4TRJA 3W6ZA 4Z0PA 1DJNA 4BNGA 3IMFA 3V2GA 2RIRA 1BG6A 2P2SA 4IM7A 3H5RA 1E7MA 1J6UA 3GDOA 2EHDA 2HRZA 1H6DA 1ZSYA 1ZW1A 2VNSA 2WTBA 3IC5A 4XQGA 3GGPA 3WGGA 3ZDFA 4E5KA 2V7PA 2NWQA 2E6UX 2NVUA 2ZJ0A 1P74A 2GN9A 2Y0EA 3TRIA 3LVFO 4TQGA 1ZMOA 1VC2A 1BXZA 4F6LA 1L1FA 1R66A 1DIHA 3GNTA 5IXYA 5KTKA 1ZK1A 1MG0A 3DMTA 4GBJA 5B12A 2WYWA 4EJ0A 2VZ9A 1GADO 5B1YA 2DTXA 4M89A 1I30A 3DO5A 3WR5A 5A02A 5CDGA 4L4RA 2O23A 4AICA 2X0NA 3ZWBA 4BO9A 2DLDA 2GRAA 4IIUA 1HDZA 2NU6A 3C1TA 5F21A 4EI2A 1DAOA 2Z1NA 2BD0A 2OUIA 2R2GA 3JCZA 2V6BA 3U0BA 2YFQA 5JBIA 4NPCA 4BL5A 4P22A 4WGGA 3MJEA 3ZV3A 1KC3A 1N7GA 1E77A 4PRKA 3FRJA 3ZW9A 3OJLA 5I8WA 4WCDA 2Y93A 3JQFC 3CINA 2B4RO 1M67A 5FI5A 5EERA 3DZGA 1RJWA 1PZGA 1T26A 3B6ZA 3ZNOA 2CF5A 1HDYA 2JJYA 5FI3A 4BGEA 4ALJA 4YRAA 3HFSA 2J5KA 5KKAA 1PQUA 3DBVO 1GCOA 2W2KB 1QXSA 2IZZA 4D45A 4XDYA 1V3VA 4ZICA 4PLPA 1ONPA 1XDWA 4NG5A 1LDEA 3QLJA 3N7UA 4YCAA 4RVDA 3PLNA 4BMSA 4AJHA 1LC3A 4GLOA 2I3GA 3KETA 3SC6A 3PK0A 4PN3A 2VWGA 4D3FA 1VJTA 4KTVE 3FR8A 1UZLA 3L6EA 4F3YA 4NBVA 3HNPA 1U9JA 3AM3A 4DQXA 2HAEA 3MEQA 5L4LA 1FMCA 4N5MA 2EJVA 3OICA 2VOJA 4Z6KA 2GDZA 3WJ7A 3GC6A 4CMJA 1B7GO 4XQ9A 3RBVA 2EP5A 5G0WA 1X15A 2Y1CA 1O5IA 1S7CA 3IS3A 1GFSA 3FNHA 3GPDG 2VWHA 4FC6A 2VHVA 5GY7A 3OIFA 2DUUA 4LW8A 2EKQA 3WICA 4YAEA 1ML3A 4J4TA 1LI4A 5B4VA 1WMAA 3DTYA 3NYWA 1PL6A 1YKFA 2H63A 3OJEA 3QA9A 2GERA 5K9ZA 1CIVA 4PRLA 3K30A 3JYNA 3T4EA 4YQYA 1UUFA 2BF7A 2C5AA 5EINA 4D79A 4DVJA 3GGGA 1EE2A 3T7EA 1JKIA 4ZGWA 1E0DA 1NQTA 2O7SA 3VPSA 4ZU3A 1U5CA 4PGFA 2DBQA 4E3ZA 1V8BA 4EJMA 4BNKA 1YJ8A 4HWKA 3BMNB 1ISGA 1BDMA 1H6CA 2OOSA 3U4HA 3G1TA 2NACA 1VJ0A 3E5RA 3WGIA 2WMDA 5DCYA 4CMCA 1O9BA 4DIOA 1F8GA 1W8DA 2NNLD 2UAGA 2AEJA 1PJ3A 1P3DA 2GN6A 4Q3BA 3ZNQA 4XX0A 3MTJA 4DLLA 2WD7A 2WE7A 2PA3A 4MJLA 3GG2A 1GYQA 4RF4A 3F6YA 1CYDA 4YJDA 3ADPA 2X8LA 3MJ4A 4ILKA 4TRMA 3DDNA 1JWBB 2GNAA 1P0CA 3OEYA 3U4IA 4ID9A 4UAGA 3UHAA 2LDXA 2ZCUA 5ICSA 2E49A 1BXKA 1IOLA 3JQGA 4RVUA 3RQSA 3CTMA 5CPBA 1W6UA 2HLPA 4HV4A 5JY6A 2P5UA 2O4CA 1DFGA 1IHYA 1WDKA 2CMDA 2X23A 4L9RA 4YR9A 5LDHA 2Q1TA 3N58A 3KUXA 3QJ5A 1C0IA 3BMOB 1N9GB 4M87A 3LLSA 4P4LA 1DIGA 3H3FA 3NTOA 1F06A 3DBHA 3EDMA 1I24A 5JAZA 1KEUA 3BZUA 5DBIA 1EVIA 3L9WA 1VJ1A 4HADA 3UCEA 4HBGA 1UDCA 2ZYAA 1O6ZA 1I36A 5JDIA 1ISMA 1KEPA 1DFHA 1M75A 5JFOA 3BHMA 4BKPA 5KVVA 2FSSA 3GFGA 3KV3O 4FIZA 3ONDA 5A3VA 1SAYA 3PHLA 1H93A 2WEKA 3PQEA 3OQBA 3TZ6A 2Z1MA 4BKUA 1I8TA 1HE4A 3E82A 3LZ6A 2BGMA 4JROA 4XCVA 5F1PA 1R0KA 3RKRA 3BTOA 1B8PA 3FWNA 3PXXA 1ID1A 1BMDA 3V2UA 4BNLA 4LVUA 1YO6A 4BNWA 2WYVA 4GMFA 5GMOA 5HS6A 3GEDA
chains in the Genus database with same CATH superfamily
2I2BA 1XVIA 2VDWA 3D7KA 4W6ZA 1RT9A 3H9UA 4TXHA 2BRUC 5SYAA 3RT9A 5B55A 3OQ1A 4R2XA 4DQDA 4RM3A 1W46A 2JFNA 4F60A 2HA6A 2G6TA 3PU6A 3VJLA 1JHOA 3JR7A 4Z51A 1CXZA 3KZXA 2FZLA 3KFLA 4R5HA 1PK7A 4MQ4A 4W7IA 1U2SA 1XFDA 4HEHA 5DT2A 3K2QA 4AULA 1SXJB 2IHNA 3PC6A 1S2OA 2ZBEA 4MV4A 2VT6A 4AMUA 1ZEJA 4DN6A 1G8SA 4QYSA 3IL2A 1QH0A 3FJ1A 4PNEA 4HXFB 1SKQA 5I3ZA 4G9EA 2JW5A 4J49A 1JLSA 2WIGA 4C4OA 1E3IA 3CUWA 4GQBA 4BLPA 1AF4A 1GPLA 2COUA 1V6CA 5HGXA 1ZEMA 3B8EA 1E63A 2HCFA 2P2LA 2EG9A 1R4MA 3U5ZB 2C7BA 2PANA 4PZAA 2XRYA 3AZOA 3JQPA 3ZDEA 1GL9B 3WJ2A 5CFPA 1G7RA 4K05A 1QHHA 2V98A 3V8NA 3W8DA 5CVCA 2IS6A 3ETGA 4KXYA 4M1OA 4TX1A 1ZN8A 3TZHA 4DLAA 1H2YA 1G9XA 4ENQA 3ZNPA 1LI5A 1HLDA 3CZRA 5K6AA 1P4AA 5TQ0A 3TQCA 4E03A 5BN5A 5LA6A 3HI4A 4AZVA 1SHUX 2EFDB 6LDHA 2B5VA 3DL4A 2OZEA 16PKA 1C9MA 1CUDA 1UBMS 3GFFA 1I33A 4QGSA 4K6FA 2F8SA 4IYRA 5A04A 2WVGA 4TL9A 1YZNA 2NYVA 2R11A 1V71A 3FLMA 4YMSA 1YS9A 2PWAA 1RRVA 2UZ1B 5JXWA 2ALJA 4LF5B 3U9SA 1ZBDA 3IVCA 1XWIA 5BYKA 1GN8A 2OPHA 1JG7A 1W36C 1NT4A 1QIKA 2OBXA 1CQPA 4RYDA 2P8JA 4GYYA 1NM5A 3ANNA 3ZKWA 5FPYA 1B76A 4Q7JB 3QF4B 1S4QA 3LVBA 4C0WA 5HF8A 2VP2A 5J63A 3R6DA 1PE0A 1U11A 5A5DA 3DXXA 3V8VA 3T9EA 3AILA 2XYRA 3H2JA 4WOJA 4YRTA 3IOCA 2IUSA 1C81A 3S2UA 4C3ZA 1OXXK 2IEBA 4CYMA 3I1FA 4QYIB 4WKGA 1TFUA 5DYNA 5M3BA 3E7DA 5GGYA 5JRZA 2SHKA 3G5MA 7ABPA 4QPZA 1G1AA 2HSJA 3FMFA 4WFIA 4EKIA 3HDVA 3RSFA 1NWHA 4PXAA 4AF6A 3KHSA 3H5WA 1RKXA 2IBMA 3PIIA 1UEJA 1XL0A 1P6UA 3NWPA 5A3QA 2X8JA 1VJRA 3O31A 4JT9A 3OFNA 3A05A 4W63A 4NECA 4OOFA 4IDBA 1XTJA 3AXTA 3K1TA 4DOMA 3DVQX 2JLUA 4CVNA 5DOZA 4FDVA 1GNQA 2J9XB 1H2BA 3C4QA 2JASA 4LBYA 1QP8A 4PFSA 4E2WA 1Q2UA 3U44A 3K05A 4JSTA 2IH2A 4HBZA 3S1SA 4Y2XA 1FJHA 3I6QA 4IIDA 3ICOA 5BN4A 3HDTA 3HJUA 1I51A 5DP2A 4DB4A 3VR5H 1W94A 3LCRA 3H2ZA 3BXPA 4WKCA 1W76A 2FN8A 3VNBA 3KLNA 2Y67A 4GPBA 4CPDA 5JTUA 5KWSA 3T3NA 2JFBA 1YQ9A 1YB2A 1Z7WA 3UJHA 3AR5A 5KMGA 2VJPA 3QFCA 4GMKA 3SR4A 4D81A 1PR6A 4BV9A 3P0RA 3GVIA 1CZOA 3GJ8A 1C0PA 4AJOA 1L4MA 2C9BA 3H9CA 4AMYA 4K0KB 4LRUA 3F8SA 1MHTA 3RGWS 1FTSA 2G4LA 2NLOA 4Y18A 2FPMA 3H9QA 5JSUA 2GPSA 2C0CA 3I8OA 4WY2A 1JA1A 1N3YA 1X3LA 4Z49A 4BQPA 5EP4A 4WXYB 3D64A 2P65A 3KHTA 3FPEA 3S68A 5JZVA 3QZUA 4YRPA 1UOOA 1EJ6A 1A9XB 1RXUA 4HJXA 3VAZA 1ZAKA 2PZMA 2W00A 3CVWA 1FUYB 4MQLA 1CUXA 2YW9A 3OC6A 2AC4A 4PHHA 1HWYA 4IS3A 1XU9A 3EBOA 4B35A 2PJRA 1DP4A 3DV0B 1XLTA 3BTUA 4UM8B 1EDOA 3T5MA 3EGDA 3MTDA 1KHTA 4L2IB 4ND7A 1DAIA 3PJFA 4FX5A 3ZWOA 1W4CA 5JR3A 4L85A 1L8AA 1JWAB 1RDFA 1YDMA 1UXKA 4DS3A 4OJYA 4B7AA 3QUBA 3L1UA 1XQYA 1O96A 3QIVA 1UC9A 1VMEA 1H9BA 5TVGA 1GYRA 4LSGA 1XHEA 2IYOA 3FOAA 4MGYR 3FI9A 3PQ4A 1GQ2A 2O8EB 1NQ5A 3AF2A 3Q1LA 1CY8A 2QZ4A 2G04A 2CXNA 4DRYA 1J2RA 3AI2A 4J2HA 3TIGA 3PQ3A 2WYHA 3HJRA 1I13A 3AVWA 1X1RA 2XUOA 5I4KA 3ZX4A 1Z4IA 4MI1A 1EVZA 2P6PA 1PHRA 2BFDB 2C88A 4H4EA 4CODB 3VKVA 3EGIA 4OFWA 1NUQA 5A9TA 3ICQB 5G53C 2BEUB 2R62A 2C7PA 4PNHA 5SY6A 3L82B 2UUBB 4R84A 2W71A 3SQOA 4UVEA 4HY3A 3KAPA 1TQ4A 3OMXA 4PGGA 4DV3B 1MRZA 4PHTA 4A26A 4KXQA 2KQUA 1GNRA 5AOVA 2AX3A 5HZGA 2O6LA 4Q48A 1OH8A 2D1QA 9LDBA 5JS2A 4CUZA 2J07A 5D3MB 3KZ1E 5L3QB 5FORA 1E2QA 1TGVA 3AW8A 2GOYA 2ZR9A 2CKDA 5AJHA 4TKVA 2YIDA 4P4SB 1NWCA 4Q21A 3K16A 1V2HE 4EG6A 3NG1A 3KL2A 1CR1A 5FA6A 1X7GA 3VO1A 2EL7A 2AFIE 1ONNA 3MWGA 1KZYC 4HC4A 1SIOA 2HA0A 3EGEA 4KPGA 5F52A 4MV8A 5ELLA 4I6GA 2MR6A 4ZAXA 1GA1A 1YS2X 3PKJA 1QNLA 3ABQB 4JOCA 1G0OA 1KO7A 1PZXA 1X1TA 2QTLA 2G83A 1IG3A 1OUMA 1E2LA 1O97C 1FYEA 1ZM3A 4E11A 2PSEA 3B6IA 4DREA 1DCMA 4UBOA 5FWDA 2Q6LA 4D0GA 1JIUA 4M9ZA 4DRZA 3B36A 2CNWD 2ZGVA 1B0ZA 1J0EA 3FPBA 1XPUA 4KQEA 4ZCRA 1BGWA 3OU2A 3P19A 3BQ9A 3I6IA 3QVOA 2B8WA 2QD3A 1K89A 1YR7A 3IBTA 1MQ9A 1NFRA 2Q62A 3GJSA 2HMSA 1Y5RA 3ANLA 5REQA 4R1OA 2DUWA 2TMDA 5BT9A 3W6NA 1NMXA 3MLAA 4NU8X 1K7CA 1E64A 1XAHA 2IU6A 4BO8A 3P2MA 1KFCB 4DZTA 2O1XA 4M1YA 5GONA 1E0KA 4JEUA 4DMGA 4D8YA 5DEIA 4LFBB 1NV8A 3RRJA 1UOQA 1DINA 1QVWA 2WIBA 2YJ4A 3ZE1B 4GKKB 1DRVA 3D59A 2XMRA 2HU5A 3CRRA 4XJTA 3AUUA 2QLTA 2V7BA 1VSTA 4RD1A 3VSEA 3EARA 3RT7A 5HXAA 1CUAA 4NDZA 2NPOA 1UT8A 5IWAB 1A88A 4QODA 2YWGA 3U3DA 3RFVA 3JWEA 2QIPA 1Q0PA 2OXEA 3ODGA 1RPZA 1IOVA 1GSAA 1UWLA 2V4MA 4KQMA 1VYTA 4UD6A 4E2ZA 2CHGA 5EWMB 1Z06A 2CD9A 2I1LA 1WB4A 1XXHB 5FWYA 3MRTA 1D0VA 1U1DA 1X9GA 4P3XA 4Q4LA 2H9IA 2MSEB 4WOKA 1GLGA 3EUWA 4H7PA 2PD3A 3DBOB 4KHZA 4AO7A 5CB4B 1AA6A 1NLFA 3HBMA 3F9IA 3ZS8A 4JLVA 3ONFA 5ANRB 1M7HA 4BFSA 3H0KA 1RLMA 4YAJA 3VYUB 3OPMA 5LA6F 2VC2B 2XMGA 2FETA 4HMQA 4MWZA 2Q1WA 1BROA 2OD7A 1HDOA 4GI1A 4NVRA 3A28A 1P2DA 3ANSA 4OK5A 1WEKA 2E3JA 2EXXA 3W6OA 4I3GA 3WK8A 1DJOA 3M3HA 3QYFA 4M0UA 4CLEA 5CFNA 3RNOA 3L84A 1A04A 1C3VA 2M1ZA 3BL6A 2WD7B 2W6QA 4HNSA 2ZUDA 1OXUA 1M1NB 1PUJA 1YVEI 2IHVA 4FILA 4ZCPA 4WH0A 1SNYA 2RK4A 4CQLA 1JLKA 3ROXA 3NC1C 5LQRA 4I4LA 2P67A 1HZZA 3X44A 1FXUA 4TSRA 1QIFA 4AIRA 1Y8RA 1AKMA 2GHRA 3AEKA 1JQDA 2QMEA 4B17A 1U3WA 4ERXA 2PX0A 4R8SA 1BRMA 1J0XO 4W4TA 3X1KA 5FUQA 4RPCA 1WULS 2GYWA 2HK6A 2WUDA 2FP3A 3IUEA 5B3JA 3NIWA 2APJA 2POQX 2QZ9A 4YFVA 4A8HA 2WJ4A 3LJKA 1GXSA 1RRPA 1DC8A 3EASA 3HVIA 4N0EA 4PAQA 4Z99A 5IDWA 1U65A 2JAUA 2Z9BA 1JLLB 2X0IA 1YD7A 3AUFA 3OCWA 4LZJA 3TAXA 5BN3B 1H1LA 2JAQA 1EFRD 4Z7JA 4JYZA 2H5EA 1ZVVA 1YGYA 1ZRSA 3RU2A 3KQNA 3R3UA 5TPZD 3DBHB 1ZKDA 4YQZA 3JQ9A 4AYWA 1FDUA 3KZCA 4CF3A 1I2BA 4FFWA 4BO1A 1M6WA 1PX2A 3V42A 1H6AA 1XPRA 3A32A 2I7VA 2EARA 3H5OA 4PAMA 4TZ0A 3L8GA 5AOBA 2W6JA 4DF3A 4ZOLB 1K5PA 5CLGA 1RWQA 1SZJG 4DPKA 3FVTA 4FFPA 3L0YA 1QG2A 2FJ0A 3EVFA 5D01A 1GIAA 1VOTA 1DV2A 1HOTA 2IXGA 5J1TB 1CRLA 1K63A 1VBFA 2J6IA 1UP7A 3ZTYA 1YZTA 4Q4JB 3LBNA 2CWWA 5LJIA 3O2SB 4MIKA 1XWWA 1GKLA 3COVA 4GXTA 5CA1A 2DERA 4AJ2A 5LFAA 1XJWA 2YY6A 2JK1A 4YXFA 1RU3A 1DIAA 3LF2A 1KAOA 1H8HD 4LZLA 4IGIA 5LUBA 2P7IA 2Z2XA 4FFSA 4I9FA 4K9NA 2YRFA 4UEOA 5HS4A 2ZIAA 3V46A 1CEYA 4Q3NA 1XD9A 3GFVA 1BZYA 1C9JA 1TC1A 1RVDA 4GE3A 4H0FA 4IUBS 1YDWA 1E6WA 3I30X 4JD5A 3IEPA 4Y2PA 4B47A 1TYEB 1CUBA 4YAFA 1FSSA 3DBLA 4HDAA 1TKRA 1JDSA 1KI6A 4MEBA 4YRKA 3K5HA 1EEHA 2QZSA 3PDUA 2X1HA 3BGSA 4GPAA 5B30A 5BN1A 1FFAA 1A9QA 1M6NA 1L7PA 1Q91A 1R6TA 2GLUA 2H7VA 4OMUA 4WZAE 1QQAA 5EKTA 2GD6A 4L9AA 4QXRA 2GVDC 4KR3A 4QDTA 3CZCA 3MOGA 5BRNA 4F85A 4QFMA 5IABA 2EEPA 1USGA 1F5NA 4PF1A 2YV2A 3ZGOA 2BE7A 4DJJA 1BDIA 2OZLB 1XMVA 5FOWA 2XYGA 4HHEA 5FNVA 1DB3A 5LMCA 1VG9B 2O2YA 4OI4A 1QYWA 4JLAA 2H5LA 3AEZA 1WHTA 2G4VA 4WW0A 1ZQ1A 4RIFA 2IZ0A 4LN1A 2J0QA 2WSYB 1Q7CA 4QG3A 2YW2A 2ZYUX 2V58A 3D6FA 3H3JA 4DR5B 1E6CA 2DFDA 2NO5A 1MV8A 3H86A 3WLIA 4YRNA 5AKEA 3ETCA 4ND5A 1XNJA 5CIYA 5HTKA 3T1VA 4IJ5A 5JU6A 2NTYC 3FNIA 2G07A 5IWCA 4DPMA 3V8PA 1CDOA 1JMKC 1KDRA 1L4NA 2XB4A 2W93A 3KKZA 1USVA 2ETXA 2Q1UA 1D07A 2GCEA 3O91A 3OEHA 1YQGA 1RR6A 2AVNA 2ZYSA 4FLFA 4X1KB 1FZQA 4RX1A 3N5CA 4LTMA 4A73A 1QC5A 2VNIA 3VPAA 1L7DA 3OM9A 4YJKA 3V4SA 2PJUA 4F6RA 2J09A 4GVLA 4RDIA 4FNMA 1KI2A 1NKSA 2ZTMA 1OFTA 3C97A 1WAMA 4GF5A 4GYJA 1HNNA 4J16C 5LQDA 4H3HB 4HX5A 4JFRA 5EJMA 1QZ3A 2XB6A 5A5GA 4RK1A 1QE5A 2ZRPA 4OLBA 3DB2A 5CVEA 3FCYA 4AJ9A 5KVCA 1REQB 3QMVA 2GEJA 2JANA 5EQJB 2DPMA 4EEKA 4W5HA 2H4WA 3SJBA 3SS8A 2VFAA 1DKOA 2F90A 1K08A 4OREX 5CNIA 2IU0A 4O3MA 2QN2A 3KYBA 4L4UA 3O4GA 5B53A 1L4KA 4H17A 4NE7A 4KRFA 5A4IS 1A27A 2OCPA 3DGEC 2IOQA 4QGGA 2W11A 3L8HA 1RBMA 1YCDA 2WUEA 4ZT6A 4F4FA 5HRUA 1IXSB 3NHPA 3OUTA 2OCXA 3QU9A 5GIPE 1W5FA 5GQSA 1B1CA 3KBBA 5HILA 4G0VA 4B8YA 6ABPA 1GUFA 3JYQA 3CZPA 3IHWA 4RORA 1R37A 2D3WA 2O3JA 2YASA 2BFFB 4GC5A 4XWWA 1CR0A 5LQMA 4O4LB 3FAZA 4BX8A 5IC6A 1KF0A 3RV4A 4BQSA 1KZ9A 3CX4A 4MVYA 5U4XA 2CXUA 4L0CA 1ZUNB 2QX7A 3G2JA 4QFCA 5T3YA 1RZ3A 3L01A 2AD1A 4PZPA 3GY0A 1IHXA 1SC3A 3JTMA 4RE6A 5P8WA 3DE5X 4J3FA 4X54A 4D3DA 3BE5A 4X3OA 4KPUA 3OWXA 4O02B 1W35A 1I01A 1BN7A 2FF7A 3IT1A 4G5RA 3KUUA 1QH9A 1NXVA 5GONF 4NBUA 4FCVA 2WM2A 1MW9X 3QUCA 3QELA 1CY1A 3PGMA 3RUHA 1N6HA 1GKKA 3ZWDA 1VHQA 2QI9C 4IMRA 1CT9A 2WJPA 1IZ8A 3EAGA 1YC5A 2EBWA 3A25A 4U00A 3M4JA 3SKVA 2WSBA 4IVNA 1FP4B 4EB8A 1L4GA 2ZWVA 3HKEA 1NYLA 3QX8A 3O03A 1IJKA 2BVNA 3OM1A 4QRDA 3UOAB 5JD6A 4BPBA 3NOOA 4A2CA 1FNMA 1CLUA 1WY5A 1ND5A 1ONOA 2V7TA 2HPZA 4KR0A 2RAFA 3GEGA 2ZSIA 3AHCA 3N2ZB 4U7FA 1W4RA 3KHUA 1CIPA 1V5IA 4FXOA 2QKYA 2BJVA 1MF7A 3WP0A 1N2IA 2R47A 4IIEA 1PDVA 4YDQA 5FOQA 2GWHA 3WBFA 3NM4A 4NX2A 2PSFA 3PFNA 4OHZA 4IZOA 4XTCS 2O48X 1PWZA 3GZJA 3TFQA 4YFYA 3WLQA 3KVOA 1JIJA 1BWQA 1PR0A 5AUQA 3VH1A 1V1MA 4EHKA 4GPD1 4H15A 2PRIA 1KMCA 1MQ8B 3AETB 3IP3A 1S3SA 4KXXA 1PO7A 1GVNB 2Z09A 1SO8A 5NLLA 1QQ7A 2Q4BA 1T9GR 4PTYA 5LP6B 3MXOA 4GC9A 3OOHA 1N6OA 1NLYA 3KCQA 2FWJA 3CPJB 3OEWA 1XU4A 2IX9A 4H4DA 5EUBA 4A4DA 4B33A 4PO8A 2D1YA 4M46A 1X7WB 4QA9A 1KO5A 1KI8A 2EEZA 3K6KA 4HVAA 1C30A 2VK8A 4LDAA 4YONB 5BR4A 1ECJA 2VQ6A 1XEXA 2VYCA 3TE7A 1ZW6A 3HEMA 2FEKA 2IYAA 3K09A 3N8GA 1SKAA 4PYLA 3FM9A 2V96A 1RQ7A 3DDWA 5FUWA 2YQ4A 4EITA 3ZNNA 3GAFA 1NVFA 2ZWPA 3C3JA 3ME5A 1L6RA 4Q18A 4RV4A 1Z29A 5TJ9A 1WE2A 3C4VA 2FW7A 4IDPA 4DCJA 2WHXA 5FV4A 1E2DA 2AOTB 4RGQA 4CL2A 3VR2A 1IZ0A 1BC5A 1FQWA 1KYWA 4LJSA 4RGBA 1WSWA 3WNQA 4DWJA 1SZCA 1M66A 1DT5A 1Q77A 2WAOA 3F5SA 4J6EA 4MKHA 3JQBC 1UXIA 2F48A 3INNA 4TYMA 1FVOA 1QG4A 3IIIA 2VJKA 3HJCA 1YI8A 3QY0A 4QPNA 1QZTA 5LZ7A 4B44A 5CDUA 3HS3A 2XOXA 1P8JA 5COBA 4KSBA 4UCWA 4HRYA 3GMSA 1W5AA 1QYIA 3Q12A 2XOKD 3IH5A 4GMXA 4KKVA 1E79A 4QD3A 3TXXA 4XYEA 4BZWA 1FEZA 4CM7A 3EXG1 4WFKA 4ETIA 1NA5A 2HMWA 1FS4A 2P5YA 4D9CA 2VHEA 2Z2JA 4ZN6A 3KQWA 4G9BA 5JFGA 3SXUB 1HURA 1QF9A 1LZLA 3H87A 1RQXA 1NAIA 1ZLXA 2EFHB 2B99A 1LLQA 3OO0A 1R18A 1Z15A 3QLTA 4BUJA 1JB9A 1PNVA 4EF4A 5CA1F 4S04A 1GLNA 1UJCA 1GEEA 1GFZA 3AI3A 3LOQA 4OMFG 3I28A 1NPYA 1VLLA 2J9ZB 3GRUA 3CJRA 1P3Y1 4DM7A 4E07A 1W0KA 1M2OB 4KACA 1JG6A 1B74A 2GRJA 4IDAA 5BPFA 4YB8A 4DJ5X 1EFLA 3THXB 1VHDA 3ZHSA 4ZCTA 3DW1X 3HACA 4NJMA 3FHJA 1NMQA 1XAJA 2BI8A 2QLNA 1FLDA 3ZYCA 3BEOA 2XUJA 2ZE6A 1U8ZA 5MN6A 3C5WP 4UBIA 3JVUA 5HIIA 2L18A 1SKYE 1MX9A 4WCFC 1LNQA 1ULUA 2PYDA 2AJLI 4NICA 3NRJA 1HYGA 1C4XA 3ZLUA 3NEYA 1GZ3A 2QRZA 5GTDA 1KDZA 5CXSA 4OB6A 2I71A 5JWOA 2XCSB 5FWAA 2RMKA 1OREA 3S7ZA 4C6RA 5HKKD 4P0QB 3QU2A 2RARA 1G1MA 2XUPA 1H1TA 3DPSA 3VR4H 3P7MA 4RTPA 2O8BB 3KLPX 1P7ZA 4LY9A 3J7AC 3G2PA 3C7DB 3P71T 3CPSA 3TVDA 3NQ41 5ESRA 4LPSA 1Y9DA 5HF6A 3UFXA 2NVOA 4HR7A 1HE2A 5IHXA 5FNVF 3OH8A 1RPTA 3OIDA 3SQMA 1ONSA 2DY1A 1C7ZA 1Z22A 4FMDF 3RLIA 2O8CB 1XUOA 4M9XA 2R44A 3DTVD 1CJBA 2J9FB 4G0XA 5EJIA 1DQYA 1Y4AE 3G17A 4LAFA 4OQPA 4JJKA 2FP4B 3NHZA 4KWHA 4BIIA 1YJQA 4EL0A 5F3WB 4MKIA 1QRRA 4P3YA 5DNUA 1HORA 2WSMA 4IIGA 2A7XA 5DCWA 4YX9A 5DM70 1PT7A 4L6AA 3TQFA 5KX5F 4JEMA 3FZYA 1FP6A 2FEXA 3H8WA 4FHGA 1XEWY 1IK6A 1G3UA 4JKYA 3NBFA 3TW8B 1FA9A 4LY6A 1GAJA 5G0VA 1X9HA 2R6HA 1WJGA 2ZWIA 2QJRA 1L5NA 4BKQA 2C8JA 1YR8A 2YWJA 3TBKA 4UEKA 4GXNA 5AVTA 4G4SO 4MVJI 1L9KA 5IKMA 1HLPA 4Q9LA 1DBQA 2ZUUA 2MYPA 2DPGA 5DBGA 3UZUA 3U6KA 2ZZMA 4Z86A 2O0MA 3TMAA 2A14A 3QFFA 1MA3A 2YZMA 4X41A 4TUYF 1MBZA 2PO5A 5JMWA 1KE1A 1AA9A 1UP6A 3IBYA 2YFKA 4LXYA 1BA2A 2BCGY 1HO3A 3AIKA 1K27A 3RB8A 1E3WA 1FFXA 5JAOA 1M5UA 1VP9A 3I6BA 4UUOA 5DGTA 3LL7A 4R01A 3I0ZA 1MB9A 1B16A 2WMOB 4PX3A 2V7XA 4J1TA 1RYEA 3VVBA 3WYAA 2R4TA 3KTOA 5IT4A 5ITVA 3R0ZA 2OD9A 4JSYA 4RA9A 4BB5A 5I9NA 1LRLA 1Y89A 1FFEA 2Q4DA 3HLYA 4Z9AA 1J5PA 1TA0A 4Z0HO 1IWBB 4S2UA 3CH5A 5H82A 4C78A 1A98A 2O2HA 2WA1A 4ND4A 1DRKA 2QXTA 2X13A 2C59A 5JBQA 4C08A 3MJDA 1YCGA 4EHFA 2C0QA 1ZYUA 1H66A 3WL8A 3BAZA 2J33A 2RBGA 1ZD1A 1DNPA 1XVAA 5KKCA 1I6WA 1L1QA 4BVKA 1M2EA 3KE9A 2Y1KA 3FDJA 1ESZA 3RPEA 2AFHA 3FX2A 1X7ZB 2H2HA 5C7OO 2JF0A 2NX2A 4LZAA 3GJTA 3PUVA 3IUNA 4DRXA 3ESDA 3U09A 4I19A 3FWKA 3IYLW 2HBRA 1Z4NA 2LKCA 2QM8A 3DM5A 1RJ9A 3LWDA 4D4KA 3FOCA 3COJA 3BEDA 3IA7A 5KDOA 2QG4A 1TJ4A 3GVPA 3GRYA 4M7RA 3ZCSA 1JG3A 1SVKA 2HL6A 2QM0A 3R5TA 4BNUA 1NDQA 3RFTA 4DEVA 2QXYA 3OFKA 4IJQA 1AQ6A 5JATA 3IB6A 1B2RA 4GICA 4DV6B 1AKTA 4OAQA 1JECA 5E8RA 1RFLA 3L5OA 1ZHHA 1Q2XA 5K3DA 3AFIA 4GG1A 3S1AB 1NBEA 1Q3TA 3KXLA 4BAUA 5LM3A 4D7AA 5EHZA 3U7GA 1UCFA 4RJIA 3CONA 3ZH2A 1X7DA 2FPIB 4MHSA 5LU8A 1XZEA 1SU7A 5L40A 3ZHXA 3W3AD 4CQNA 1U8TA 3GPIA 3H9BA 3L92A 4QUKA 1XZLA 4URHA 3UJPA 4E7PA 3T41A 2XF8A 1M6EX 1R74A 4K46A 4Q66C 3MGAA 4YP7A 1PTJA 1YJXA 2Q3LA 3SF8A 3JRWA 1X94A 3N74A 2JL1A 2NTEA 1SHZA 1VSUA 2FCAA 4L5AA 2J7KA 4S0ZA 3WHPA 1U0SY 4I81A 1AB5A 1RJFA 3GFSA 3LOPA 4WZAA 2JCVA 5CIQA 2WW8A 1EFDN 4LDRA 4BNYA 4C6HA 4D1YA 1FXSA 2P9EA 2QPOA 5BVGB 2EIXA 1ORWA 4UEQA 2XX3A 3ROEA 5CNKA 5D6OA 1ADGA 1FTYA 4DA7A 2KBEA 3EW9A 2GXUA 5FFFA 4EVRA 3U6BA 4UOZA 2DY0A 2A94A 3GVXA 2HF7A 4G85A 4MKFA 3RR2A 3DFFA 3STTA 4ZCIA 1W93A 2ZYRA 3MB5A 5CDFA 2FFBA 4ESVA 5JTTA 3FTFA 4FFLA 2UVDA 2WSSD 2FQXA 3IUSA 2JKVA 4KWTA 4N6NA 5CVDA 1ORRA 3D4OA 1TVCA 5FF9A 4K1LA 1Y3BE 2GJ4A 3FD8A 4U8GA 3W5CA 1EXVA 1QP7A 4MHTA 3L6RA 5BWBA 1E59A 2BFPA 2XJ9A 1JBEA 4HDSA 1VSVA 1TKAA 5JASA 2Z1DA 1C80A 2SNIE 3S70A 2GRUA 3WMWA 2GJ8A 1NBMA 4NFSA 3ZQ6A 4IO1A 5JPIA 1BNCA 4BWYA 2SECE 4MW9A 2QT9A 5C35A 4C7VA 2YXEA 4UNQA 5C3MA 1BVHA 1J0CA 1PEKE 1K5GA 1N6RA 2P1DA 4WA7A 5U9CA 1RM3A 4TRNA 2JHAA 2Q4RA 4NU6A 4G63A 2YYAA 5K3FA 4BP9A 1K2WA 5H7XA 3CLRC 5KEIA 4ARZB 3NGLA 1XK7A 1KMNA 3R3JA 1CJMA 3M70A 4L3OA 3TQOA 1V6SA 5THQA 2YJGA 2OEPA 3ESZA 2HY7A 1MTZA 1J7JA 1VTKA 4JUCA 3K70D 5GIOE 2VG8A 4V3CA 1PZNA 4PYMA 4B7XA 4ZYUA 2FGJA 4JBGA 2MINB 5K0FA 1P1HA 4TLMB 2P11A 4G2NA 2PQMA 3M89A 1KAMA 1WXFA 3NPAA 3SFVA 3RRXA 4CM9D 2JJ8A 4HUQB 4OQXA 4UBKA 5DI3B 3H83A 2YWRA 1YBMA 3BCRA 4OQQA 1TA9A 3RRMA 4MO2A 4QDKA 3RO7A 2DR0A 3P2EA 5A5FA 1OR8A 3PNKA 3IA2A 3NBAA 1NTRA 1DO8A 4HWSA 1MDBA 2B0JA 3IV6A 2C4VA 2B2NA 4X7BA 3ED5A 3UWPA 2PO7A 3WK5A 1FU8A 1TVMA 2EERA 3ZE8A 2ZIUB 3R77A 4XLZA 3SEAA 3S40A 4ZYTA 1YC2A 1ZJYA 2WFLA 3EAQA 1TDJA 1AKYA 1B14A 2XDYA 3IUJA 4TS9A 1CRWG 5EMMA 3ZBQA 3ZHYA 1ZUWA 5JISA 2F4VB 5IJZA 5FKJA 3CUTA 4IXDA 3O2QB 3QMWA 2QUIA 4OP3A 2VPYA 4I66A 3SZOA 5JDIC 4Q4HA 2CV1A 3E1GA 4DJTA 1MXFA 1OFIA 3H1AA 3CMCO 3BGDA 3LCMA 4WASA 4HAZA 4PO1A 3FGZA 5H81A 4H60A 5FWXB 5INTA 3UAZA 2DLCX 4U0JA 3QEMB 1XLUA 2YQZA 3HG7A 5DHQA 3F71A 4YASA 3K4QA 3RVQA 1EIWA 2WNSA 1Q16A 2JIQA 2UU9B 4JU8A 2PZGA 4AWXA 2I6SA 4I9HA 1PLLA 1U2TA 3NKFA 3O73A 3K0BA 5LR6A 2BFOA 5UKDA 3FGOA 1XYYA 2CYCA 1LLFA 3NVAA 1LBIA 3CA8A 3OZGA 4B4UA 4L75A 4GOXA 4A1FA 2MOKA 4Z2AA 2FZCA 1J21A 1ODJA 3CFYA 4R9SA 4J0FA 4DIMA 4CIBA 1FL9A 1ATIA 2CVZA 4KYUA 1ZXBA 4JEHA 4OHBA 4L4YA 4UU7A 1SPXA 3ZW8A 2C1EA 4GM0A 5AQEA 1Q95A 1ZD9A 1KAEA 1KJIA 1XMPA 4FYHA 4MH0R 2ACKA 3IQGX 3ZY6A 5CXXA 2VOEA 1XRNA 1P9LA 1ZN9A 2RJNA 5KNDH 3CWCA 3A4NA 5DWDA 4I1PA 4X97A 1PG2A 1V3TA 1TTHA 2FQQA 3EGOA 3RI3A 3T9CA 2A5LA 2B7LA 2NQ8A 3UFBA 2K7ZA 1NJ6A 3KCNA 1KSJA 5HBGA 1Q12A 1PNTA 1BH6A 3AUSA 3AVPA 3IJ5A 1UPFA 1OFUX 2ZSAA 3O9ZA 4PPYA 5F9HA 2R79A 3OQMA 3LPMA 5C1DA 4D02A 2QTWB 3ER8A 4RSGA 5NULA 4CKWB 4BTVA 2QAIA 4AAYA 1FSFA 4WLVA 2EBHX 1K8RA 3HA5A 3LUDA 4XX0B 5FX2A 5B36A 1WZNA 3PLAE 4FFOA 1UBOS 1WDLA 3I42A 3KOWA 3TQIA 3MTGA 4D46A 4ARUA 1IXRC 4KQJA 4DC0A 4EUEA 5D1NA 1YA4A 3Q6MA 1DQRA 5JXIA 5K6AC 1RYFA 3M6VA 4IFIA 3SIWA 2ZLBA 4B83A 1YL6A 3OTOB 1FFBA 2R48A 2VJLA 4NONA 2UZ1A 3KS9A 2YMMA 4HB2A 5EEGA 2ODPA 1V16B 3HPRA 2PEYA 2PLFA 2ARKA 5BYJA 3W5VA 2PJZA 4X3CA 2WT4A 3OECA 1AO0A 2RGYA 1MFPA 2B4QA 1EBFA 1AQYA 2K2QB 2AR7A 3UW1A 1X14A 3R0IA 1RAGA 3PUJA 3QW4B 4WY8A 2YYSA 4TMYA 2GTPA 4CWAA 1NZJA 1WWKA 5ICMA 1U0HC 2H8KA 3B51X 1FJ2A 1NYRA 2CXRA 3EWSA 1NE7A 1HG1A 2ZKLA 3DMGA 2FFRA 3JQ6A 1NM5C 2W2OA 3BXEA 4TN1A 4C43A 2OP0A 3UAXA 2AMFA 1IEXA 1WB6A 4UNRA 1T3SA 1PFQA 2OO5A 3GYGA 4XOUA 5H59A 3VZPA 4JQZA 4QTUB 2WJIA 3DKRA 3ELBA 1NJ5A 3O93A 3MIZA 4UTXA 2EZ9A 1YBHA 1IAQA 2EKLA 4ZAWA 5FYDA 4Y1FA 2JH8A 2B2CA 1U31A 4GR4A 1C1XB 2A1IA 4DG8A 5A9SA 3G5AA 1P4RA 4FPXA 4JI6B 1Z5OA 2FG7C 1DZIA 3QFRA 3VR6A 4MB2A 4QPDA 2BFNA 4Q03A 4S0XA 1A8HA 4ZRDA 5F73A 2VTBA 3FOZA 1HNWB 3IT0A 4BZPA 1O89A 2H7XA 3K9GA 5A06A 1GUDA 4HYEA 3STUA 2ZANA 3WOVA 2IX3A 1WZCA 3LIPA 3Q40A 2GKGA 2XAAA 3P9KA 1FFWA 4MW4A 3W77A 1C7EA 1RJEA 1H4SA 4F9TA 1Z7BA 2GM5A 2IP4A 1JPJA 4M22A 5EZ6B 4BS9A 1ZMRA 4E2XA 1A5BB 4EW1A 3P0HA 3K9QO 3D31A 4F5ZA 4L07A 3AIMA 5A9RA 1NN3A 3GEMA 4OFZA 4C3VA 3AR4A 3UCXA 1T1SA 4ILEA 5GOZA 2WM3A 3A04A 1TF5A 2QTGA 3ST7A 1XWFA 2YV5A 2QYOA 3CVJA 4TTRA 5CLLA 4BGUA 3IEIA 5EE0A 5B1DA 4KTTE 3VAAA 1G5HA 2YN0A 3KKQA 1M73E 1MLDA 5IUJC 2GK7A 1QRAA 1XJ0A 3UPDA 5AI9A 3KD3A 1DBWA 4RFLA 4G01B 4TTIA 1OWLA 3IEKA 3WISA 2G0TA 3FMPB 3RSGA 5ALMA 4QOHA 3VO2A 2KLBA 4UVGA 1N2HA 1Q1EA 5C0OE 4G0WA 2J0SA 2G9ZA 3ZHVA 2BGJA 3F6RA 1A9XA 5G3ZA 1XGKA 3HJGA 5I7RA 4JCCA 1NKTA 1UZAA 4CQMD 3KQVA 3GA0A 2IWHA 3C8ZA 5L9AA 2GJKA 1E4VA 3R5JA 1IN4A 4DLUA 3ZJUA 2RGXA 1TM5E 4JSRA 4BO2A 4OHVA 1GG5A 2EFEB 2IXDA 1J8YF 1TI7A 3DV0A 3EZXA 3QWFA 4K9DA 2JVIA 3RE1A 2WOJA 3I64A 2JHGA 4L2IA 2F1OA 2ZETA 4FGUA 4PQRA 5EZYB 4DYDA 1DDOA 1LNSA 2GZSA 2KE5A 4KQCA 1CPYA 1TUIA 5CNJA 2IS2A 3KUDA 1YWGO 4MB6A 3DFIA 3K9LA 4LHSA 5HJ2A 2OLEA 3ABIA 4FHDA 5DZSA 4OQDA 3HKBB 3I5UA 1N5OX 3VKFA 2OT3B 4TYPA 1KPIA 2OXRA 4A92A 5JOQA 2HT1A 4GKJB 3ZDYB 1K6JA 1A82A 2VYVD 3ABOB 2FWMX 1EAMA 2DTEA 3G2MA 3PFHA 5A4MS 2B9VA 2EQAA 1SKBA 3AR9A 3PQDA 3KSAC 1FSPA 5MF6A 1MB3A 1VLQA 1U3FA 4YJFB 2AV6A 1C3OA 2ODQA 5FB3A 3DXZA 2O3RA 3L07A 3ZE6A 4DCCA 4DLBA 2B37A 1G8KA 1U8FO 3R3XA 4AJLA 3MQ2A 4FGSA 3MTIA 3INTA 1T9GS 3JQAD 1Z35A 2IJGX 3DAHA 3UMRA 2GZ2A 3KOXA 4G8DA 1SQ5A 2JLQA 3KB1A 1F2DA 1GOTA 3VJMA 1QKJA 3R6LA 4AP5A 3HN2A 4GBED 3ZWVA 1PGPA 1UPCA 4CG0A 2XMDA 3WNDA 1N5DA 4M0FA 4URVR 1QE3A 1CR6A 2JAXA 2GM3A 3KXDA 2IH5A 2EQ5A 3WQQA 5L3QA 5FUVA 1Y8QB 2YJZA 4MA4A 2Z5VA 1Y1QA 2RKOA 3LSTA 4J75A 2OBFA 4HQOA 4A16A 4EKYA 4OV6B 5E1DA 1GU1A 4OKNA 3D6JA 3VPBA 2CLFB 1XQXA 2LIPA 3DE7X 1OQAA 3FF4A 2E1PA 3OTHA 7AT1A 2CVOA 1A4UA 5KCZA 2QE6A 3TG2A 4LWZA 1ZD3A 2H5JA 4LV5B 1E2HA 3EOBI 4KU4A 5K4HA 3IMKA 2J6BA 2GXAA 4TS1A 4L5CA 4KPFC 1YOBA 3WRXA 4GE0A 5JNRA 3ESQA 3ZGLA 5KPDA 3M1IA 2D2XA 2FF5A 5EE9A 2YHAA 3OSZA 3PC3A 3FUXA 2EZTA 4KDEA 1X80B 5EIBD 3UAOA 3LDHA 4ZOQI 1KTIA 3U56A 1T36A 4S1OA 4MAAA 1H8EA 2BL4A 1Y0BA 2XA9A 3ICPA 5H3HA 2IRWA 4EG3A 3P2OA 1KBQA 1VJDA 5C2JB 3LK7A 3C7TA 5BNFA 2PRSA 4OGFA 1ZIYA 1D3AA 2HZ7A 2OSBA 1AQUA 2H4XA 3M9WA 4F8EA 2PGNA 5CHEA 1INLA 1N9ZA 2NO6A 4P4NA 5EI5A 4D3ZA 3BJMA 4FU0A 4YAOA 2BUBA 3LHIA 1H85A 2CJYA 2FEAA 4FINA 2CFIA 5IYZA 1FX0B 2OMEA 3Q2IA 4E5UA 4F91B 3L4KA 3BPSA 3PI7A 2JI7A 1JVSA 2JFOA 3DO6A 1QV9A 3LPLA 1L7NA 1B6SA 3CZAA 3N8IA 3AY3A 1JDJA 1YVUA 2HPAA 3SHOA 2HCJB 4F5EA 1R8YA 1TO2E 4C4ZA 3NFRA 4EM6A 5JJLA 4DZZA 3U4MA 3A0RB 1E99A 4GI7A 1P81A 2R0QC 3ZU2A 4BO5A 2YXBA 5L95A 3Q0EA 1CG6A 2DZDA 4GIBA 4HXGA 4XAQA 3DOHA 1G7SA 1CD5A 4MRRA 5D84A 5BRAA 4H3SA 1EZ1A 2NUBA 2OQ2A 4YALA 1AUQA 2OE2A 3DE2X 2VWPA 5DXFA 4RXUA 1NASA 4DKXA 3ET4A 1XXHA 1TMKA 1XD2A 3FCOA 4MUAA 4RMHA 4Y0AA 3LQ4A 3K73O 1FUUA 1NVGA 3RS2A 5CB4A 4HVTA 2XT0A 1MCZA 4JAVC 5CYOA 3VOAA 5CXUA 3OA0A 3F6SA 3KQYA 3PEWA 2HUPA 2P2GA 4MR9B 2C9MA 2HPHA 4OPMA 4CLRB 1KOJA 1BW9A 3D8SA 4ZV9A 4KQ1A 1SIBE 3PITA 1K2VN 4NNPA 3AC0A 2FUG6 5CK4A 2EWVA 1YZQA 1Q0HA 4AMBA 3IAS1 2XIJA 4HNAB 3KQMA 5AHRA 5ENZA 1W29A 3QTBA 3NJ4A 1YJCA 3O5AA 4I36A 2AN5A 3P2KA 4LCEA 2EHJA 3NBYC 3RVSA 3X1MA 3ZZ0A 2ISCA 4A6PA 3ZY3A 4EAQA 3C14C 1TW2A 3IKLA 2V0NA 3CRVA 4UM9D 4Y6RA 2J59A 4FZ5A 3LX6A 5CGQB 2KS6A 4BLVA 2P90A 4IKOA 1HZZC 1OF1A 1T9ZA 1X87A 3PSHA 2FRDC 3DNMA 3UCFA 3LFTA 1QHYA 3LG2A 2QRJA 4F2WA 2ZAYA 1Z6ZA 2ZJ8A 2ZITA 4U9HS 1GRQA 3SGLA 1GZ6A 1OWOA