1B8PA

Malate dehydrogenase from aquaspirillum arcticum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
KTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRNIKVLVVGNPANTNAYIAMKSAPSLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGASVKDMINDDAWNRDTFLPTVGKRGAAIIDARGVSSAASAANAAIDHIHDWVLGTAGKWTTMGIPSDGSYGIPEGVIFGFPVTTENGEYKIVQGLSIDAFSQERINVTLNELLEEQNGVQHLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MALATE DEHYDROGENASE)
publication title Structural basis for cold adaptation. Sequence, biochemical properties, and crystal structure of malate dehydrogenase from a psychrophile Aquaspirillium arcticum.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b8pA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1b8pA02
2CMDA 4WK6A 2P5UA 1UR5A 4R01A 4RZHA 1ISHA 3DR3A 1R12A 1HE4A 3WMXA 2B5VA 3AY3A 4UEOA 5DF1A 5JYEA 3NJ8A 5F1OA 1UAYA 4J4TA 1JTVA 3GVIA 1Y8QB 3LYLA 5CPBA 1HYEA 2JFHA 2Q2VA 3JV7A 1QYVA 1ADCA 2GPTA 2QRJA 1IPFA 1AXEA 1C0KA 1VSUA 1VPDA 4Y9DA 4E2ZA 1D1SA 3RCBA 4PN3A 2ZATA 3WOHA 4E13A 3IAHA 1QORA 5HRUA 1E7WA 1U2DA 1J6UA 3VPHA 4AJ1A 2PFGA 3C85A 1C0PA 3GY0A 4IDGA 1B8VA 4PLHA 1T2AA 1R4MB 1Y9EA 1LQTA 3EW7A 4RQTA 4YA6A 3V1YA 2XPCA 1MXHA 5KJ1A 4R1UA 3CZRA 2VYVD 2WE7A 5IG2A 3RI3A 4RF5A 3ANNA 4E5NA 1VI2A 1IHXA 2EJWA 3FBTA 1MB4A 1T25A 1KIFA 1HE2A 1NVGA 4ZRMA 4INAA 3ZWPA 1NPTO 1HDCA 1BXGA 5DT9A 2ZQYA 2HRBA 3AI3A 3V5NA 2J3HA 2EEZA 1DRVA 4UUOA 2ZCUA 1J0XO 4BGEA 1EEHA 3G17A 5IJZA 4BS9A 4JCOA 1A71A 5ENDA 3FNGA 2IRWA 2VUTA 4Z6KA 3BMCB 4A7PA 3OECA 3WX0A 4CR6A 3OA0A 4Z0PA 4GL4A 4DIFA 1T26A 1UAGA 5BSFA 3Q1LA 3S1LA 5U9CA 3JTMA 4E0BA 2HQ1A 1U8FO 1UDAA 2Q1SA 3I9JA 2I67A 3RC9A 1CYDA 3L9WA 1JVSA 4B3IA 3D3WA 5A02A 3EHEA 1TA4A 3G0OA 5TLSA 3MTGA 2WYVA 4TZKA 1PS0A 2QRKA 1LDYA 1QLHA 3QVWA 4DBZA 3DTTA 5T5QA 3G3EA 1FDVA 3PQEA 4PFJA 1YXMA 1IL0A 3IL2A 4BKQA 4CJXA 1PS8A 4EDFA 2CF5A 1Q0QA 1U5CA 1IHYA 3KYCB 4E2XA 1DRWA 1I10A 1P77A 2Q4BA 3MJTA 4LRTB 4UVIA 4W82A 1O9BA 3VPFA 5A4DA 3ZU3A 1NWHA 5B12A 1MG5A 4YB8A 4AJOA 2NADA 2UVDA 1ZK1A 2ZB4A 3AI2A 2PH3A 2VHYA 3PPIA 3SLGA 1F06A 3GVXA 4NZ9A 3BMOA 4BNJA 5DBIA 4PG8A 4B4OA 1PIWA 2AG5A 5L45A 3E82A 1XQ1A 2WD7A 1ZSVA 3OH8A 4XQCA 4J1QA 4OH1A 5DBFA 4E6PA 1IB6A 2Q1UA 1CDOA 4HFMA 4XRRA 2E6UX 4LN1A 1AHHA 1ISJA 4IXWA 3OSUA 3D5TA 4DQUA 1Z74A 1E3LA 1V6AA 2AG8A 2IYPA 1IZ0A 1DO8A 4GVLA 2D2IA 4DQVA 2WD8A 1LUAA 3WFIA 1YRLA 1HRDA 3LLVA 4YBZA 1K2WA 4J2OA 2I6TA 4PLVA 2E37A 3LC1O 3GAZA 3E6AA 2QW8A 3GN2A 1Y7TA 4AICA 1LC3A 4R16A 3U09A 1ONPA 1I36A 5G0UA 4TSKA 1I2CA 2GERA 4NBUA 2W2KA 4NDNE 4PZEA 3GDFA 2XOXA 1LSJA 3BXXA 2O3QA 1ZK3A 4NU5A 1OZAA 4GLLA 4JK3A 3VZPA 1B0AA 3WYEA 4LVUA 1MG0A 2IE0A 4AL4A 2JAPA 1NYTA 2B4TO 1ADBA 1N8KA 3A14A 1DIBA 1K89A 4IJVA 2NACA 4JBHA 1PR3A 1I2ZA 1VJTA 1K5HA 4GH5A 3RKUA 1XLTA 4KP7A 3HHPA 2B4RO 2HK8A 4ZHSA 2PWZA 5AXAA 2CDBA 1SBYA 2VYVA 1RM5A 3JYPA 1XQ6A 2O4CA 1N92A 3GUYA 3KSDO 1RYEA 3B70A 4EZBA 2ILTA 2WYUA 4E21A 1FDUA 1IY8A 3H8VA 2CNBA 2WD7B 2GUGA 4TZTA 3ZWMA 4CQMA 4MVJA 1PZEA 2X23A 5B4UA 1LSUA 4DVJA 3OIGA 3VVBA 1LLCA 2PGJA 1F17A 3FD8A 5JXWA 1WXDA 4D0RA 3R0IA 3W8FA 3FWZA 2PGDA 1M66A 2A9FA 2X9NA 5TRTA 1W4ZA 1BXZA 3JD4A 4ITUA 3ZHYA 2Q99A 4E5YA 4BO0A 1C14A 1UZNA 1KEVA 4LRSB 4WLVA 3GNSA 2GYYA 4O63O 9LDTA 1TT7A 4WCFA 5L40A 2PA3A 4BB6A 2NU8A 2A4KA 3UCEA 1XKQA 3SLKA 5AQ1A 2OBYA 2QZ9A 4BO7A 4CM4A 3JYOA 2FPIA 1YWGO 4EGFA 3WR5A 1IPEA 3ENNA 1Y5MA 2PD3A 1M67A 1MA0A 2Z1NA 4ZA2A 2HK9A 4J9UE 5IN5A 3I83A 3PHIA 3RJ9A 2X1HA 4G65A 3OEWA 3CXRA 4R4JA 3RC7A 4Z3KA 2O23A 3IP1A 4NU6A 4N5NA 2UV8A 4JJFA 1U2GA 3WMWA 4NPCA 1K0UA 2IEBA 2VRBA 5C37A 3Q6IA 1H2HA 1E5QA 1W73A 3B1FA 5G4LA 3JQFC 1PJLA 4MKRA 1ENYA 3DL2A 3QW2A 4PIVA 2NVUB 5AXDA 4OO3A 2QZZA 1CRWG 4EITA 4LVCA 1U3TA 1V3TA 3ZDFA 4CQMB 1KETA 3KHUA 5A9TA 1WNTA 5THKA 3I52A 3AW9A 1GUFA 1U7TA 2VHZA 3I3OA 1XWFA 1VKOA 3PWZA 4B4VA 5JAIA 3RU7A 3PLNA 1VL8A 2NQ8A 2ZTUA 3D4NA 3UFXA 2DBVO 4QQRA 2AW5A 4WUVA 4KQXA 4CPDA 2ZTVA 1JKIA 1A7AA 1H6AA 3RQSA 1TLTA 1LA2A 3M1LA 4MO2A 5FI5A 3I9MA 4IXTA 4GKVA 3LF1A 4BNWA 1DC5A 3B1JA 4KDEA 3HDQA 5K9ZA 3WQSB 2F00A 2DLDA 1ISIA 4J7XA 1XU7A 2GZ1A 2P9GA 3MWDB 3NV9A 3QA9A 2OOSA 3DFZA 5CDYA 5H82A 4I9HA 5TS3A 1E1MA 3HNPA 3QRWA 4M8SA 4ZU3A 3F5SA 2P91A 1R6DA 3WGQA 2O48X 2VWPA 5TF4A 5CG1A 3F1KA 5L95A 1A4UA 1SAYA 3WICA 1EVJA 2Q49A 1KEUA 5T8KC 3L07A 4J91A 3E03A 3UAGA 3GNTA 1LC0A 3KEQA 3G1UA 3KVOA 4II3A 1WDKA 5IDWA 2H5LA 4BNGA 3R3JA 4IBOA 4J1TA 2RCYA 1E6WA 2EGHA 3T7CA 1ENOA 4YAKA 5DCUA 4XX0A 1RM0A 1ZO8A 2AE1A 4TQGA 4XKJA 4XR4A 3VOSA 4RDHA 1SOVA 3DOJA 2X7HA 1E3WA 3PYLA 3RUCA 1EE2A 4L74A 1E1LA 3OQ1A 4S1VA 5A03A 3DAGA 3X2FA 3PK0A 1IYZA 2R00A 2AEJA 4MVJH 1MC5A 2J8ZA 3ONEA 4I8XA 4DRYA 1QG6A 4UVEA 1HYGA 3RBVA 5JDIA 4XYBA 3NGXA 3EK2A 3W8DA 1MP0A 2C54A 1MLDA 1HDOA 3TZKA 3VTFA 3H9GA 3KM0A 4J7UA 6ADHA 1O0SA 3E1KA 2YW9A 3D64A 2GLXA 5EESA 4Z3DA 3UW3A 3JD1A 1KERA 4ZQGA 4NH4A 4B8WA 1B3RA 5L7YA 1B2LA 3OIDA 1PJCA 3GVPA 5KJCA 2VYND 4Y6RA 4GX5A 1BHSA 4FFNA 4DWVA 3H7AA 1BDMA 3KUXA 1UDCA 4GPD1 3UKOA 4R1NA 4EYEA 5JDCA 2BLLA 1E0DA 3L4BC 2YFQA 2CY0A 3EVTA 1YBAA 2OXIA 1KY4A 1P1HA 4QSMA 1YB1A 1YQXA 3DB2A 5AVOA 1O95A 1X0XA 2QIOA 1LRKA 3OQ6A 3A1NA 3F1LA 1E3JA 2Q1WA 4R3WA 1EQ2A 2HJRA 3MCVA 1ZIDA 1UXKA 1YB4A 2JFGA 3EZYA 1UP4A 1GD1O 1NQ5A 3FF4A 3K5PA 1NX6A 3AJRA 4GX1A 3ZHBA 3Q9UA 2DUUA 3DZKA 4IMPA 2RHCA 3N74A 4ALLA 3WIEA 4DPKA 5T6BA 1HSZA 2UAGA 3GPDG 3IOYA 3W4KA 4Q9NA 4CMIA 4HNGA 4L4XA 4BNIA 2PD4A 1ZJZA 2V6MA 4PLWA 4DBVO 3D7LA 2PZMA 2YJZA 3QP9A 4MVJG 2VT2A 1IUKA 2Q3EA 1DEHA 1JWAB 2GGSA 4IDAA 3GOHA 2QHXA 3U62A 3H2ZA 4DPMA 2B69A 1T4BA 4GSKA 1E7RA 4PG6A 5DP2A 4J0EA 2I3AA 1LLDA 4W7HA 4D42A 4FR5A 5FWNA 1JU9A 2SCUA 4JNKA 4XJSA 4ZRNA 4EJMA 3ZWXA 2A94A 4IDDA 4J16A 3NDJA 1P45A 4CM6A 4IJKA 2C7VA 5ILOA 3GG2A 1I5RA 3CMMA 1QXSA 2FPGA 5DULA 5AXCA 4HADA 3QY9A 4CMEC 4XGIA 2X5JO 4W9NA 1FF9A 2AA3A 4XWYA 3UICA 4ZVVA 4YVFA 3LC2O 3GZ4A 5ADHA 3BA1A 4WLFA 5C5IA 5EN4A 1I33A 2AHRA 2PKQO 4B79A 2I9PA 1DIRA 2P5YA 4I08A 4MVJF 5L9AA 4ALJA 1SEVA 5KJEA 3PFFA 4LMRA 5KCZA 2O7QA 5K6AA 1U7HA 2GSDA 2E82A 3LDHA 1VJ1A 4XQ9A 1NWCA 4C7KA 4KZPA 4D3FA 4J43A 1EUDA 4CMIB 4Q3CA 3KZVA 3TSCA 3VKUA 4J9VA 3ABIA 5JSFA 2TMDA 3DXFA 4KDFA 2NSDA 1GUZA 4LSWA 4NBVA 2X0NA 4RVGA 5L53A 4DL9A 5JMPA 3QLJA 1CQIA 3IS3A 3ETDA 5G0TA 4E5MA 1QP8A 4RF3A 4ALKA 3I9NA 1A7KA 1Q2XA 2G5CA 4A26A 1EVIA 3SXPA 2DVMA 4PLCA 1U4SA 2QG4A 3U3XA 2D5CA 2V6FA 3TQHA 2VYNA 2VN8A 3JQ8B 2NTJA 4TVBA 3TL3A 3NTOA 4BMSA 1NNUA 4EBFA 2NV6A 4FB5A 3ICPA 2Y1GA 1QYCA 3RWBA 3UH1A 5C7IO 5FEUA 1SEPA 3H3FA 3KO8A 1VM6A 3DWFA 3ZWBA 1DFGA 4XGKA 3GEDA 4MIOA 2V7PA 1C0LA 3WGHA 3JCZA 4F6LA 5EERA 5FFFA 1PQPA 4BNNA 4WJZA 4JROA 1R16A 3AK4A 3QWIA 1TT5A 3GMDA 4BO6A 4O59O 3VH4A 4CL8A 4CLEA 2W4QA 5A9SA 5J23A 3DQPA 3E18A 1VL6A 3KOUA 1XR3A 1C1XA 2AE2A 3HB5X 2C59A 3WDSA 2C0CA 5CEFA 2EW2A 4AJPA 3NJ4A 4PVDA 3ROMA 5JS6A 1SO8A 4AJ2A 3MWEB 3E8XA 3AFMA 3DFUA 5JY6A 4Y6PA 4G5HA 1MFPA 3I6IA 3K8ZA 3NGLA 4FFPA 4FFRA 5FF9A 4MPDA 3T4XA 4F45A 1Y8QA 1LSSA 3E5RA 1R15A 1JA9A 2EW8A 2JKVA 3H2SA 2DC1A 3M2PA 3FI9A 1Q7CA 3MJEA 1SC6A 2G1UA 3NDRA 4CL3A 3CH6A 2H1SA 1Y81A 1Z7BA 4B4WA 1DAPA 4GGOA 2BF7A 3K2EA 4RPGA 4QXMA 1E7MA 3Q0EA 4FJ2A 3MJVA 4HFRA 3QQPA 1WLYA 5I9NA 2BGKA 1BW9A 1P1KA 2E49A 1W6UA 1WDLA 4DTIA 1R4MA 3GLQA 3TFOA 3CPSA 3FSRA 1B16A 3RKRA 1HLPA 1V3VA 1WZEA 3EAGA 1X7GA 4GAEA 1JAXA 2Y93A 3LT2A 1KOLA 2C20A 1ONNA 4M54A 4NHEA 4R9RA 2DTDA 4FOOA 2NU9A 4KMSA 3C24A 4F46A 3WGGA 1EE9A 4PLTA 3K73O 1O8CA 3GK3A 4QO7A 3EZLA 3BMCA 1C1XB 3HN2A 4YWJA 5A05A 4E3ZA 2EP7A 2D59A 2B36A 5DDIP 5DCYA 3HSKA 4CUKA 1E5LA 7ADHA 2Q2WA 4Q3DA 4NBRA 4XZ3A 3NTRA 1P1IA 4LCJA 2Y1EA 4BKPA 5A3JA 5DP1A 1JW9B 7MDHA 3GNQA 3U4IA 4K1LA 4JN6B 3RROA 3BTUA 4I9NA 2JCXA 4CMBA 4U0JA 4BO9A 4NNJA 5JO9A 3KYCA 2J6IA 2YQ5A 3V1UA 4AJ4A 4B7UA 3LVFO 3A06A 3F3SA 3VZSA 4ZQHA 3DMTC 3LSYA 2WEKA 4EUEA 1ISMA 1GFSA 4E32A 4ONEA 4AFNA 4K6CA 4PZCA 5DN9A 2CVOA 5EQDA 3ZN2A 3BMNA 3ST7A 5B4VA 2OORA 1C1DB 1AXGA 1BW9B 3BTVA 5TGDA 1PGNA 1C3VA 1NPDA 3M1AA 3D1LA 1EDZA 2FSSA 3JD0A 2HU2A 1IOLA 4ZGWA 5IZ4A 5JDIC 3FR8A 1EUZA 4CUZA 1ADGA 3H65A 2NU7A 3GFGA 2FR0A 3LT1A 1B8PA 4ZQFA 2Y67A 5IDXA 2BFPA 4FN4A 4CM8A 4CQMD 4LW8A 3ROPA 4MVJD 1L7EA 4MJLA 3VH3A 5HTOA 3F6YA 1SB8A 2YHUA 3K31A 3HB4X 4W7IA 4BB5A 3G1TA 2FZEA 5IDQA 4JLWA 1TB4A 2Z1MA 1W0CA 1XG5A 4NJOA 3OJFA 3WYCA 3C1OA 1Q7BA 2NVWA 3PYXA 4JBGA 3U4HA 5CG2A 1VKNA 4WLUA 2J5KA 3W4JA 4D3DA 5JDCC 4ALIA 2D4AA 2XXJA 5IZCA 4K6FA 1VLLA 1X0VA 3KRTA 1UJMA 1W8DA 2Z5LA 1U8XX 2DPGA 2RHRA 4XIJA 1CEQA 3GVCA 1ULSA 3LT0A 5JO0A 5BT9A 5JMWA 5JBIA 2OFPA 2Q50A 1A27A 2GN8A 4LMPA 3E9MA 1AE1A 1BMDA 4H3VA 5CDTA 2X6TA 2RH4A 4GI2A 1JKJA 3D4OA 1YBMA 4XB2A 4RLHA 3HDYA 4MIYA 5CHEA 3GMSA 4QECA 1T2FA 1J49A 3GC6A 5IDYA 4BNLA 2CDCA 1B26A 3I4FA 4E5KA 2FR8A 1LLQA 3VKVA 1WMAA 1ID1A 5JC8A 5KKAA 5KNLA 3BMNB 4E2YA 4CMKA 4GVXA 4HWKA 3ONDA 1P9LA 5JC1A 5KIAA 1ML3A 2VUUA 3H9JA 3ZWNA 1F8GA 2FN7A 4CLXA 2P4QA 4WLNA 4WNIA 1U9JA 2PKQP 3ITDA 3NAQA 4DLAA 2LDBA 4P22A 3ZU2A 2HMSA 4RQUA 4OSOA 2V65A 4D43A 2O2YA 3ZWCA 4UEJA 2BI8A 3RAJA 4UUPA 3OQBA 1GEEA 2B0JA 2VWQA 4D45A 2HK7A 4MDHA 1E7YA 5BNFA 4CM8B 2EV9A 5CPFA 1NVTA 1VSVA 2NQTA 1U3VA 4FOSA 2VNSA 4G81A 2VNAA 4OAQA 4HBGA 3E9QA 5FYDA 3VH2A 1LU9A 1ZZEA 2OHXA 3AY6A 3STHA 2DKNA 4D0SA 4OMUA 1JDJA 1ZBQA 3VTZA 4ND1A 1SCUA 2ZCVA 3HFSA 3FR7A 1DLIA 3AI1A 4BO8A 1DC3A 4WLEA 3K92A 3UHAA 1FK8A 1PU2A 4BHTA 1I2BA 2Y66A 2DT5A 3WWZA 2GD1O 1HE3A 3PZRA 2J5RA 1U5AA 2C82A 4BKOA 1RYDA 1OAAA 3GT0A 1LXCA 3L9XA 1O89A 4NBWA 4E2WA 2VTDA 3ZW9A 3GQVA 1F8FA 1I8TA 1IE3A 4YEDA 3TNLA 1HDXA 5I7EA 1N1EA 2GRAA 1MXFA 4WPGA 3CKYA 5AYVA 2NVUA 5L4NA 2IYOA 4CM3A 1RKXA 2G82A 3OJ0A 2YHIB 2DBQA 1BSVA 4NQZA 2Y0EA 2Q46A 3KSZO 1C0IA 2RBEA 3L0DA 3WFJA 3NTQA 4OSPA 1P1RA 3WS7A 1DAOA 5ILGA 3ZGYA 5GZ1A 2CVQA 1T1SA 2HO5A 2X8LA 3E5MA 1HDGO 4GLOA 4WE3A 3H5RA 3ZV4A 3H9EO 2QX7A 3PP8A 3QSGA 4BO3A 1CERA 1GU7A 3DZGA 4FSHA 1CJCA 1ZSYA 3JQ7B 5HA5A 4BO2A 4H15A 3DHEA 5ER6A 1GQ2A 4KQWA 3SBOA 1O94A 4TVOA 3AOEC 4FW8A 4CUJA 1HLDA 2CSUA 1H6CA 4IUYA 3OBBA 1A9ZA 1LRJA 2ET6A 4A73A 2F1KA 4B7CA 3TZ6A 5F3RA 2GN9A 1ZFNA 2W98A 1J5PA 3GF4A 3JQ9A 4RJTA 5C7LO 3JQBC 5AXBA 1KS9A 4M1QA 3N58A 5DBGA 1YB5A 3QIVA 2FHSA 4D41A 3PYMA 3NDIA 2GN6A 4PGFA 3HDHA 5A5EA 1KC1A 4WEOA 4F3YA 3F5QA 4BMNA 5HS4A 4HV4A 1E1NA 2A35A 4RF2A 2J5QA 3WTBA 3MTJA 4U6QA 1ZCJA 1YH3A 3RFXA 1YJ8A 3ZNQA 4R51A 5U4QA 4AJIA 3ZHXA 3PHGA 3Q2IA 4U5QA 1H6BA 1I24A 2UDPA 3OJEA 3QWBA 1PS9A 4IDEA 1PGQA 1R4NB 5B4TA 1KBZA 1H93A 1DIHA 4ROSA 1HETA 4OOEA 3I9KA 3WGYA 1Z6ZA 3DOCA 2HMVA 1BWSA 1ISGA 1YGYA 3AUUA 1U3UA 2Z95A 4OXYA 1T24A 4CLHA 3WLEA 3GHYA 1NVMB 2W90A 3CZMA 3NRCA 2V6BA 1CIVA 1ZNQO 3CMCO 3JQEA 4KUGA 3CUKA 1GYQA 4JJIA 3WBFA 4U0KA 4CLDA 2GCGA 3WIDA 4CMJA 2CFCA 3V1TC 2OO5A 3LLSA 3C3XA 3DBHA 4BNYA 1H94A 4W99A 1JWBB 1HE5A 1HTBA 1XDWA 3UVEA 4D3SA 2WYWA 3PQDA 3A4VA 1R0SA 4HUJA 4N18A 4UAGA 3WB9A 1ENPA 5TQVA 1DSSG 4FJ0A 3B6ZA 4K28A 1K6JA 3TFQA 4XYEA 2EKLA 2JHFA 4H16A 1UXGA 1PX0A 2VZ0A 4PRLA 1MUUA 1N9GB 4IS2A 3QWAA 4Q3EA 4OKNA 2BH9A 1JAYA 1LX6A 4UVDA 1SPXA 3GPIA 3HN7A 3OF2A 3G49A 3INRA 4KWIA 3WGIA 2E48A 1VC2A 4IPTA 4CM7A 1RM4A 1PL6A 1UXJA 3SJUA 4BNFA 5A5FA 4L75A 1YL7A 5JAZA 5L4LA 3C7AA 4I5GA 4Z0HO 3MJCA 2C5AA 4I1IA 2AEMA 3RUIA 4P38A 4XGNA 2O4UX 3NKLA 3FTPA 2POQX 3ZNNA 4BMVA 9LDBA 2VCYA 5L51A 1NFRA 3JYLA 3RU9A 4CV0A 1QLJA 3AFNA 4PRKA 1P0CA 4R1SA 4XD2A 4Z9XA 4XYLA 3TF5A 2ZJ0A 3JQCA 2PK3A 3OJLA 3LF2A 1E1KA 1ONOA 4AJKA 4TWRA 3R1IA 4GWKA 3RSHA 5CFZA 4NIMA 2HLPA 4NR0A 3WXBA 1H0KA 5EJ2A 4CMHA 5ICSA 1RM3A 3H3JA 1GZ4A 4FGWA 1K3TA 3TWOA 3V2HA 2G76A 2VT3A 3L6DA 3AM4A 4LK3A 1VJ0A 4OYRA 5JAMA 1PSDA 5IN4A 3BTSA 4NG5A 4PVCA 1M75A 3KYBA 4UVHA 1I3KA 2WE8A 3DBHB 3EDMA 3P2YA 4GKBA 4OJNA 1QMGA 1NQTA 4FCCA 4LSMA 1T1RA 3P2OA 4J2HA 3RD5A 4YT4A 2PZLA 1NAIA 3GR6A 2IZ1A 2FY8A 3BMQB 4OXKA 3W4IA 4PLGA 3BAZA 2YQ4A 4NK4A 3PWKA 3ROKA 2FSVA 3FHLA 5TX7A 1QYWA 4R1TA 1L1FA 4KUHA 2EERA 2Y0CA 4FJ1A 2XF8A 3K96A 3ANLA 4CLOB 2D8AA 3ENKA 3CINA 4GBJA 3TDKA 4DYVA 2H9IA 1PJ2A 3INTA 5EPOA 3VZQA 5KOIA 3F4LA 1YQGA 4MVJP 4BO1A 3TZHA 3EVNA 4Q39A 3UUWA 5JCJD 4E4YA 2TMGA 2IEDA 2NVBA 1XYGA 3RC2A 4MIEA 3RASA 1LTHR 4BV9A 1GR0A 1DXYA 1PJ4A 3WNQA 4J4HA 1Y8RA 1ENZA 4DREA 4Q3AA 1UP6A 2P9EA 4NJMB 3GVHA 4D79A 4D46A 2PD6A 3DBRB 4R68A 2RIRA 4YRBA 3T4EA 5COQA 1KVRA 1S7CA 3NYWA 2PY6A 2A92A 3S2EA 3O26A 1PL8A 4IZIA 1M2WA 5TNXA 1EQUA 3L6EA 3TJRA 5F5NA 3ZNPA 5TJ9A 3O9ZA 1OMOA 3DAFA 2CD9A 4KWHA 4R5HA 1HWYA 1AUPA 2B4QA 1DB3A 4YT2A 8LDHA 1AN9A 2PR2A 3S8MA 4IJUA 3HFGA 2O3TA 3JQ8A 3KXDA 4HKTA 4CM9D 2HRZA 3SJ7A 2BELA 5G2OA 4RZIA 4MINA 3ONFA 4WNCA 4E33A 5HBRA 1MGOA 2YY7A 2H6EA 1DJQA 4BO4A 1WDMA 2YDYA 4UULA 1E92A 2D0IA 2LDXA 3F46A 1EBUA 1LQUA 3E9NA 4IDBA 3TRIA 4A0SA 3H9QA 4WKGA 1M6HA 1B3BA 2IZ0A 3D0OA 3KSUA 2RAFA 3ZU5A 4D44A 4GX0A 4AJNA 1X7HA 3G79A 3U49A 4YJFA 1NQOA 2HAEA 3TN7A 4MOWA 1D4FA 3BHIA 3A9WA 1HSOA 4GGPA 3BTOA 1Z82A 2OP1A 4OQZA 3LK7A 4TMFA 4Y67A 3AM3A 2HMTA 3SEFA 3ZWAA 4FFMA 5BSGA 3D4PA 1P1FA 1A5ZA 4A03A 3KV3O 2NNLD 3I23A 1YOVB 1E77A 3GFBA 1QKIA 3ON5A 1UUFA 5IXYA 3U5TA 5EIOA 3LC7O 5BR7A 5L7WA 3PJFA 1GY8A 1EMDA 4OKIA 1T2CA 1Y8RB 1GEGA 1YS4A 4HXYA 1LNQA 1NQAO 1HDRA 3DONA 4J1NA 1N7GA 4YRAA 3AY7A 3DZFA 3KLPX 2Q1TA 2HCTA 3M2TA 3IJPA 1GYRA 2NWQA 3DBVO 1Z7EA 2BGMA 5CP8A 5I8WA 1GCOA 1GPDG 1N5DA 3IP3A 3U0BA 4M87A 4RVDA 1S6YA 1B8UA 1D1TA 3IC5A 4J4BA 1M76A 3OFSA 2CVZA 5DOZA 4BKUA 3UN1A 4FC6A 2FMUA 4DIOA 2EKQA 1N7HA 1BDBA 2GASA 3S2GA 1HEUA 4IY1A 2W8ZA 5T57A 1E3EA 3DZIA 1DIAA 1U3WA 4BNVA 3VVCA 2PV7A 3OIFA 4JGBA 5B37A 3TOZA 4JXKA 2WTBA 4EUHA 3ZV5A 2QRLA 4XDYA 4LCEA 3RIHA 3DHYA 1TXGA 1JN0A 2GO1A 3GN1A 4FPXA 4IGEA 4XCVA 4YJFB 5HWSA 4FFOA 4OHUA 4WCFC 3F47A 3K2BA 4J6FA 4PG7A 5TIIA 3MOGA 2AMFA 4I5EA 2PLAA 3GZNB 4YAEA 5JCJA 3FCOA 3L4SO 4CMCA 3S55A 5KWEA 1OC4A 4RPHA 1NFQA 3GG9A 3QVXA 8ADHA 1XA0A 1GZ6A 3H9UA 3O38A 4A27A 4MVJM 3VPSA 4CMAA 4R3NA 2E4AA 2EJVA 1YQDA 2YDXA 4BQRA 4KOAA 1KVQA 2D1YA 1P44A 1ZK2A 4HNHA 4NFSA 4CM5A 2VRCD 2QYTA 4N5LA 1LDNA 3GGOA 1CWUA 2J3JA 1ZEMA 1D3AA 4M55A 2HMWA 5THQA 4JP3A 4AJHA 5TC4A 2NLOA 2JCVA 1K6IA 1ZKMA 1ZUD1 2BMAA 2FPPA 3JQGB 4M49A 4DLBA 4CM9A 4E5PA 4ESOA 5JYDA 4FC7A 4J0FA 5JPIA 1X15A 4Z9YA 4PZDA 3IDSA 2X4GA 2ZB8A 4YACA 3BIOA 2JL1A 3O4RA 1SMKA 3UCXA 4YAJA 4HP8A 4XJTA 3NT4A 4PLFA 4H7PA 1C1DA 1P31A 3KYDB 5KVCA 4JQCA 4JX8A 3WNVA 2B5WA 3TPCA 3GDOA 1DLJA 2VTEA 3GH3A 4QUKA 4XR9A 4OM8A 2BFAA 1B14A 4AJJA 3NT2A 2EF1A 1TI7A 4UREA 5ITWA 4II2A 4MP8A 4X54A 2PZKA 3M6IA 4OQYA 4DPLA 1X14A 3I5MA 4BNZA 3RUFA 4QTZA 4OIMA 4I5DA 5BSEA 5KTKA 5KVQA 4L0QA 2C5EA 4TKMA 4G2NA 2NTVA 3KETA 1PZFA 1FDTA 2HMUA 3QHAA 4ALMA 2X9VA 1GYPA 1V8BA 2DU8A 4I5FA 4O0LA 6LDHA 2IZZA 4RF4A 4PLYA 1NM5A 5BSHA 2XXBA 4TKLA 4PLZA 1OBFO 4RO0A 3JSAA 4RGBA 1E3SA 3CIFA 4GMGA 3IKTA 4B3HA 1ZW1A 2I76A 3OEYA 3QWHA 5F1PA 4CR8A 4IZHA 4RVHA 3LT4A 3ZWYA 2BRUA 5IXSA 4ZD6A 1FMCA 1F14A 3HDJA 1GDHA 4J3FA 1V0JA 4OXNA 4E31A 4WGGA 1MX3A 1X7DA 3F4BA 1JKFA 2CF6A 5LDHA 3HG7A 3H4VA 1AGNA 2OUIA 2AEFA 4YR9A 5C3MA 3DHNA 1XELA 5T8KA 1NR1A 3PDJA 4FQ8A 4P8RA 3H6KA 1OI7A 3EUWA 5I8ZA 4EI2A 1R66A 2GZ3A 1BVUA 1NR7A 2D3TA 5A1TA 4Z0TA 1FDWA 4BNXA 1I30A 3AWDA 1A9YA 3W6UA 3COSA 3ZWOA 1KC3A 1PZHA 2R00C 1PQWA 5KKCA 2DQ4A 3HJAA 1OC2A 2EWMA 4PG4A 1FDSA 1XU9A 3K9QO 3JQ6A 4QX6A 4UVGA 2EKPA 4O1MA 3I9LA 2C2YA 2YFHA 1BGVA 4DC0A 1WMBA 3U9LA 4NFYA 4IIVA 4YCAA 3D5QA 3O8QB 3HUDA 1AHIA 2DBRA 2DFVA 4XB1A 3VPGA 1R0LA 2P9CA 5I9LA 2VWHA 2VRCA 4MP3A 4QO8A 1LDGA 2Y0DA 5H81A 1NPYA 1LSOA 4BQPA 4ZICA 1QRRA 2EXXA 4ILKA 4BNHA 5MDHA 3WG9A 4FGSA 5TSDA 2Y99A 4TRNA 3IMFA 4R54A 1KEPA 2G0TA 3ASVA 3JQAB 1YVEI 2JD1A 3GDGA 1PZGA 4M89A 4HX5A 3NUGA 1UZMA 3ASUA 1BRMA 2X22A 3CEAA 2O50A 4RPJA 2B35A 3VDQA 3FWNA 5IAAA 3PI7A 1ARZA 1ZK4A 5CDGA 3L4BA 1H2BA 1UXHA 3EY4A 4GSLA 3ORFA 3TZQA 1U28A 4IJWA 2HSDA 3TL2A 3Q9NA 4M86A 3ZWVA 2PNFA 4WOKA 2EGGA 4YJHA 3OJOA 4EW6A 1Y5RA 3OA2A 3QE3A 3ZV3A 2I3GA 4YDRA 5A06A 1PWXA 2XAAA 1EK5A 4DC1A 3I4CA 1MFZA 1E6EA 2YHIA 1WP4A 3DZBA 4HFNA 4N54A 4O5OA 2DFDA 1EBFA 4MP6A 4XRGA 1YDEA 4XYMA 2JFFA 4WEQA 1ZVMA 1Y1PA 3ADPA 3UCFA 4C4OA 3Q11A 4UUMA 1EZ4A 3RUEA 1D7OA 5MGBA 3DEYX 5G0WA 3MJSA 4J1SA 1RPNA 3CTMA 1GAEO 4JJGA 1BTOA 2B37A 4GQAA 3JQ7A 2GNAA 1DFHA 4ZJUA 4DIBA 5ITVA 3ZW8A 2G17A 1EUCA 3DZHA 1VRWA 3KLMX 3VHRA 4EJ6A 1FJHA 4GX2A 3DAPA 5L3ZA 4U8GA 2YV1A 4W9NC 3WWYA 3KTDA 4BKRA 4DYDA 1LRLA 1TEHA 1EFLA 1XCBA 3I6QA 3JYNA 1LDBA 3I9OA 2PH5A 1BXGB 1Q1NA 3LZ6A 4CMEA 1I0ZA 1VE9A 4BGUA 5C7OO 1QV6A 4DGSA 4NBTA 4IM7A 3F9IA 1JVBA 4P4NA 2O3JA 3RFTA 1PQUA 2X0JA 1NHWA 1A4IA 3JYQA 4BUCA 5K6AC 5TT1A 3IQDB 1GZ3A 2ZTLA 3UOGA 2UYYA 1B7GO 1DRUA 2P2SA 2YV2A 5JFOA 5JNLA 1LEHA 4HFJA 3ROQA 5GZ3A 3BYZA 2JHGA 5A3VA 1SB9A 4CV1A 4TRMA 1LDEA 3D3WB 2B83A 4YJHB 2FOIA 1HKUA 3GA0A 2PTGA 3GEGA 5COBA 2UUOA 1CETA 3FNHA 3OETA 3MOIA 2OBNA 2ZB7A 2C07A 4YT5A 2GR9A 4E12A 4EUFA 2EP5A 2OGUA 1R4NA 4BOYA 3FPCA 4TROA 3LU1A 1ZEJA 4IMRA 5GY7A 4IQ8A 2WJPA 5TT0A 1VL0A 1E7QA 3RFVA 1PGJA 3B20A 5KJFA 1WAMA 5A9RA 4R9SA 2PKRA 3WQQA 4S3MA 3ETGA 4BO5A 3SVTA 3ETEA 4GMFA 2DM6A 5G0SA 5GMOA 4RPKA 3BMOB 3NX4A 3RBZA 4AVYA 2O3RA 3KBOA 3AUSA 4CV2A 1QYXA 3WSWA 2FP4A 3GAFA 1ZK0A 3ZZNA 1H6DA 2RH8A 2ZYAA 4R5MA 5EL0A 4JIGA 4PCVA 3PIDA 3VC7A 2ZTMA 5F5LA 2HDHA 1P0FA 3I1JA 4I9UA 4L4SA 4DA9A 1WWKA 3W1VA 2ZIZA 4WASA 2CDAA 3GGPA 2HUNA 1GL3A 1OOEA 3DTYA 3V8BA 2Y1FA 5JCXA 5G4KA 4BNUA 4FFLA 3DC2A 3RVDA 3H5NA 4YT8A 4NFHA 1N9GA 2PZJA 2ZKLA 3OM9A 1WVGA 1HF3A 1P3DA 1TVEA 1GPJA 4XEHA 2QQ5A 1BVRA 1Q0HA 3JQDA 4ND5A 3V2UA 1IZ9A 1NHGA 2J3IA 5JE8A 2DBZA 2JD0A 3FBGA 3FNEA 1PGPA 5EQFA 2W2KB 1EVZA 3O03A 3ZWWA 3ZH2A 4LISA 3WGOA 1FXSA 1WPQA 1PJ3A 3OHSX 3K6JA 3PWSA 1OFGA 4DUPA 5COAA 5EMHA 1PJTA 3DZJA 4A5OA 2D5AA 3AU9A 1QV7A 1DOHA 1DDOA 3WGZA 2ZK7A 3DBLA 1UXIA 5DOVA 1ZXLA 2H63A 3AOGA 2Y1CA 3VDRA 1DC4A 1LDMA 4RL6A 3AUTA 1ADFA 1GQQA 2GN4A 3DO5A 3SX2A 4RVFA 3PTZA 1UP7A 1H9AA 4ND4A 3V2GA 2X9GA 1ZH8A 2VOEA 1I3LA 1RWBA 1LLUA 1ZSNA 2Q45A 1QSGA 4MKZA 4HY3A 4BL5A 5HS6A 2YZ7A 3PVZA 3WJ7A 2FZWA 4MKXA 1JLLA 1YBVA 3UXYA 1P1JA 2YV3A 2X0RA 5JLAA 1L7DA 4R41A 3WSVA 2DPHA 4B7XA 1LJ8A 1DHRA 1H9BA 2BFMA 3EGOA 3EYWA 1HDYA 3PJEA 3UF0A 1Y9AA 3BMQA 5G4KB 3C1TA 2VHVA 3QWFA 2GDZA 1F0YA 3FPLA 1BG6A 3SC4A 4WCFB 4FDAA 3INGA 4J7CA 1H5QA 3NT5A 2X5KO 4QFDA 4CLOA 1T4DA 5H83A 3VPXA 2ZYDA 4CM4B 2WSBA 2CUKA 4RORA 3GHHA 2JJYA 4IQGA 4Y6SA 3ZHZA 1V9LA 1EDOA 4YQZA 4E30A 3KEOA 3MEQA 3C7DB 1KEWA 1Z73A 3PHJA 4QEDA 1HZZA 3AUAA 3R6DA 4NI5A 2DTXA 2NUAA 1XGKA 4ZQBA 1YJQA 2I66A 4ZQEA 3WJAA 4C7JA 4IIUA 3EC7A 3L6OO 5ES3A 2VQ3A 4U6SA 5CAEA 2ZJ1A 3DBLB 2DTEA 1GQYA 4RCVA 4NJMA 2IXBA 4OL9A 1E6UA 3H5AA 5T64A 1GTMA 3DBRA 4RDIA 5DCWA 3ULKA 4MVJI 1P33A 2DAPA 1Z75A 2O3SA 4CMGA 5GZ6A 5BNIA 3DMTA 5ICMA 3PQFA 4FBGA 3BHJA 2YUTA 3P19A 3OP4A 1KY5A 2EIHA 2UUPA 3GEMA 1YE3A 4TRRA 1I01A 5HM8A 2PGLA 1SOWA 1UDBA 2X86A 1DFIA 3WQRA 1R37A 4DMLA 3AM5A 2C2XA 1V35A 5ER9A 4K9DA 3SC6A 4J90A 1T2EA 3P5SA 4L8VA 2P4HX 3FN4A 4RVSA 1WW8A 3BHMA 3ZU4A 4R69A 1GCUA 1G0NA 1PGOA 4WCDA 3QVSA 2OZPA 1HT0A 4URFA 3PGXA 4L4RA 1YO6A 4AJLA 5IF3A 4N7RA 1Z45A 2X58A 1E3IA 4MVJE 2BHLA 1HXHA 2W2LD 5IZCC 2DUWA 3RJ5A 1ZJYA 1NTOA 1YOVA 1ZMTA 4CQLA 2Y1OA 4CV3A 1G1AA 4QFCA 3PRJA 2VHXA 3QVTA 4K26A 2Y1DA 4ND3A 4YTEA 1GADO 5I7FA 1YONA 1YDWA 2NM0A 4BNTA 4QT0A 2GF2A 4NMHA 3TOXA 2VWGA 5I7SA 1K6XA 2X0IA 1Q0LA 1PR9A 2AQKA 2JAHA 2YYYA 4IINA 1U4OA 3C8MA 3HADA 2BKAA 1NASA 4Z9FA 4Q3BA 1DBVO 3D3EA 2O7SA 4J49A 4YJDA 3WGTA 3WBBA 3ZCXA 4DMMA 2BFOA 2WM3A 5EINA 4IGFA 1I3MA 3PXXA 4JBIA 4XDZA 1EVYA 4IDFA 3HQ4O 2QYSA 4ZN6A 3S2IA 1YKFA 1KVSA 4RVUA 2I65A 1PJSA 3PZBA 4RLSA 1E3WB 5L4SA 4P4LA 3FTNA 3PFWO 1DPGA 3L77A 4YJGA 3MJ4A 1HYHA 2O3UA 2WDZA 3A28A 1X13A 4XYGA 1GUYA 5G0VA 5U1PA 3ANMA 3K30A 4JP2A 4KTVE 2OMEA 3IIEA 1G6KA 4IS3A 4BVAA 1SNYA 1O5IA 2Y68A 1UH5A 2VUSA 1MC4A 5B1YA 3GZNA 4WLOA 1YL5A 3BZUA 1NXQA 3DMYA 4U7WA 1LBEA 5CDSA 3NEPX 5KVSA 2X5OA 1HL3A 2OP0A 4CQLB 3PJGA 4O6VA 1ZMOA 1PL7A 3ZV6A 3PHHA 1O6ZA 3GGGA 2V6GA 2O2SA 5T67A 5CDUA 3JD2A 4B8ZA 4BNKA 3PHLA 4A10A 2I99A 3W8EA 3RBXA 4OGWA 2HKIA 3QV1A 4YYZA 1PEDA 2C29D 3JQAD 1G0OA 1QR6A 3E48A 1PJBA 3CE6A 5AOVA 4AG3A 3JQGA 1ISFA 2WWRA 3ADOA 5DZSA 3U4CA 1U1IA 3C7CB 3DDNA 5A04A 3HWRA 4EEXA 1NFFA 3ITKA 1A72A 2OL4A 3VZRA 1PTJA 5LC1A 3PEFA 5CEEA 1XHLA 4CR7A 3EMKA 3T7EA 1JQBA 3AU8A 2AXQA 2I5PO 2R6JA 2NTNA 2P68A 3KYDA 2Q2QA 4D7AA 4ALNA 5JAQA 5K0ZA 2ZQZA 4CLRA 1KVUA 3TZCA 2VOJA 5CEJA 5BQFA 5BNTA 4PLPA 3ICCA 3PIIA 3U4DA 4IQ0A 4N5MA 4YJGB 4EEZA 1PJQA 2C7GA 2BI7A 4F6CA 1E7SA 1SZJG 2GZ2A 4PG5A 4YAIA 3HE3A 3JD3A 1ZXBA 2W2LA 4NK5A 3WYBA 4AJEA 4BIIA 1EFKA 1F12A 4YPOA 3RUAA 3CSDA 2VHWA 1T2DA 4ND2A 3Q2KA 5JW6A 2IODA 4Y8VA 1RJWA 3JQ9C 5KJ6A 2VZ8A 4XIYA 1CF2O 1GV0A 3AOEA 2EHDA 3R3SA 3VAZA 1Q7GA 3Q3CA 3X2EA 4RV9A 5FI3A 4FS3A 2IDZA 4B3JA 3WLFA 4CODB 1KYQA 1N2SA 3JQBA 4DLLA 3PDUA 3PLRA 3GRKA 2JD2A 2BD0A 2FWMX 4L76A 4BNMA 1GV1A 1IULA 3QJ5A 1BXKA 1DHTA 5I9MA 4P4GA 3PGJA 3OMLA 3IJRA 1D8AA 2ZYGA 4WOJA 4KTTE 1XEAA 2IXAA 4UEKA 1QYDA 1ULUA 3JQFA 1HZJA 3QVOA 1WZIA 4W4TA 1EK6A 2VZ9A 4W6ZA 2EG9A 4BGIA 4OOFA 4XA8A 4XQEA 3UGKA 5IFLA 3GUCA 4TRJA 1Y6JA 4CLRB 3FRJA 5KVVA 5JY1A 1I3NA 4UUNA 5DNAA 2JCYA 2CZCA 3IKVA 3WTCA 3KB6A 1CQJA 1NBOA 4Y98A 3ZI0A 1DC6A 4DQXA 1NP3A 3DOOA 5TJHA 3IUPA 4YAGA 4GWGA 5F1KA 3B1KA 3IUSA 3HZZA 1DIGA 3MZ0A 4FIZA 4A2CA 4B4UA 1M6WA 1N1GA 3RC1A 4ID9A 3O8QA 1UZLA 1XIVA 1B15A 4DXHA 1LI4A 2HJSA 2WMDA 2Y05A 2BGLA 4YXFA 4L9RA 1DJNA 2ZB3A 5LCXA 3S2FA 1YL6A 2NU6A 3RUDA 2AQ8A 4WECA 4FD3A 3LQFA 1R0KA 3N7UA 1XSEA 3P7MA 1KVTA 3FNFA 4BGVA 1X1EA 1P74A 2Q4EA 3JQAA 4LGVA 5ENVA 5LDGA 4BV8A 1ORRA 4XQGA 3VH1A 2J3KA 1X1TA 1TT5B 1V3UA 4Q3NA 2AQHA 1NAHA 4IDCA 3ZNOA 5I7VA 5A9SB 3PJDA 5L7TA 2R2GA 1I32A 3OICA 2FR1A 2AQIA 4L73A 4RPLA 2FRDA 3GRPA 5F21A 4KUEA 3W6ZA 4EJ0A 4YRDA 1PWZA 1J4AA 1HDZA 1MV8A 3C1AA 3RUHA 4CM1A 4YQYA
chains in the Genus database with same CATH superfamily
2WAAA 2Q0SA 3ELBA 2P5UA 4QOFA 4R01A 4J3NA 4A16A 4R7GA 1ISHA 3SXJA 2QQ0A 4Q9KA 5CVCA 5HRAA 5A0VA 1R12A 1HE4A 1O96B 1VHJA 1W76A 5DEOA 4D8XA 5DF1A 3TOSA 1ONSA 1PVOA 2DLNA 4S1PA 4X6XA 5F1OA 3SZMA 1M10A 1AZTA 1JTVA 5EE9A 3EFEA 3LYLA 4HGOA 3T7SA 3AF4A 1R8SA 2O2EA 1ADCA 2G63A 2GPTA 3FHOA 3KQYA 3E4CA 4HN9A 1IPFA 4HYYA 2QD2A 1VSUA 4B2PA 1D1SA 4PN3A 2PGIA 1MJ5A 1YI8A 2GN1A 3WOHA 3GAAA 4Z3OA 3JRXA 4JELA 3CCFA 4K03A 3IAHA 4S0ZA 4ZC1A 1EGHA 1G21A 1CUZA 1D9XA 1QORA 3DFFA 3M6XA 3NETA 3NOOA 4PAWA 2RH5A 1J6UA 1NU6A 1XFAA 4DDVA 2P0YA 2W2NA 4AJ1A 5IPFA 5A4AA 3TD6A 3U3OA 1C0PA 2NP6A 3VISA 1V26A 3QFTA 1JXMA 2PT6A 3PCRB 5JMOA 3JATA 2AFIA 1R4MB 3EW7A 1LQTA 4MV5A 3FUXA 2IYAA 1O2DA 1E89A 4QRHA 3D6HA 3I37X 5E9WA 3SXUB 3RAGA 3UA4A 3CZRA 2IX3A 1AT1A 4OL0A 2X0KA 2RI1A 4XLTA 3CF6R 1V39A 1M6YA 1YJBA 2LIPA 4Y1RB 5B5SA 2ZWPA 2G67A 3FBTA 2R8BA 4U9UA 1KIFA 1ZZGA 4MA0A 4RD3A 4JYPA 4U4AA 3ZCTA 5AW3A 3F6BX 1JBKA 2BDEA 2FSVC 1B42A 3BBPA 1M3SA 2A9OA 2HDOA 3AEYA 2PQ6A 3DA8A 4I1OA 4I50B 1OAOA 2G07A 4N65A 4YREA 2WZBA 3V5NA 4CGYA 2EEZA 4EPVA 3LY7A 3VKFA 4DL9A 3OM1A 2UVPB 3GLRA 3OAAD 5IJZA 3B6MA 5HQJA 1YR9A 5ENDA 2JHPA 2IRWA 3AL2A 5J40A 3OECA 1WB9A 4MS3B 4M8LA 4Q7KA 2ZG6A 4TTPA 4GL4A 5GOTA 2WU0A 3G59A 1T26A 3LIPA 3U3MA 1BH2A 4QYIA 2HCRA 1T15A 2H3HA 3G2HA 5JZOA 1BS1A 5BURA 5TVKA 4B3IA 1WRBA 1S8OA 4GLFA 5A02A 4N5HX 4HB3A 5JXHA 1J25A 1J9EA 3AFGA 1QJ4A 2CNKA 2WUDA 3RG8A 5TLSA 1F4LA 4G1BA 5FUYA 2Y6UA 1P2VA 5T5QA 2GS9A 3OQJA 3HZHA 2WAXA 4MDEA 1X8LA 2BGJA 4NZNA 2C7OA 3MT8A 3OMXA 3IL2A 1JHAA 4UOZA 4CJXA 1IQ0A 2XNHA 5KWVA 4JVOA 3DH0A 1Q0QA 1KIMA 4LVNA 1IHYA 3AGPA 2BJWA 4E2XA 1XKXA 3W79A 1GRRA 1DRWA 2WMNB 2P41A 4Q6WA 2R44A 1IQRA 2HV8A 3HJBA 5JJBA 4X1IB 1QHHA 3PUJA 1OA1A 2PL5A 3Q40A 1TAQA 4TSFA 1IMJA 1VYUA 3HR8A 4AJOA 1XZNA 2OSBA 1J7KA 4LX0A 2ZB4A 1V45E 3HLKA 4FCTA 1OVMA 1ODCA 2PH3A 2KW5A 2VHYA 4W5QA 5CLHA 4UTNA 1QHXA 2X1LA 3GUZA 3GVXA 4NZ9A 2A0FA 5JNUA 4M1YA 1O6BA 2HSJA 4IV0A 5L45A 3GW8A 1Z5PA 1JEEA 2FFHA 4JSYA 5BN3B 3GJ5A 3K9WA 1IB6A 1PR5A 2Q1UA 2Y9PB 2QBYA 4DEYA 1H65A 3A7EA 2E6UX 4HDAA 4KAXA 4XRRA 1KAOA 2E4WA 1NVWQ 4EFKA 2XKJE 4TYWA 1JQKA 1PEAA 1IN7A 1MB0A 1GSIA 3NHAA 5K5EA 2OV3A 3WRWA 1RXUA 4URUR 1Y6ZA 3R5SA 4N0EA 2D2IA 4KN6A 1T3LA 1B0UA 4GC9A 3WMGA 1OVGA 3DKIA 3TDMA 5E4JA 3OT1B 2YZMA 3O92A 3D2CA 4J7AA 4ZGBA 4YBZA 1H8ED 1K2WA 2EFHB 2I6TA 2ZT7A 3NASA 3LC1O 3UOWA 1AXRA 1UBLS 1TTPB 4Q18A 4EVQA 5JXJA 3U56A 5DHAA 3GN2A 2Y1XA 3OIUA 3R9WA 1C4KA 2H1FA 1AZSC 1LC3A 4R16A 5LBTA 2GYWA 1JTEA 1L1EA 3AFHA 4JUFA 1I36A 4NCIA 2UXDB 1OE0A 3UJ6A 2GERA 4G07A 1TC1A 5FBWB 1W1UA 3TTSA 3L41A 1XC7A 4NESA 4C6SA 5K7SA 1ZJJA 1DUVG 1NMEA 3PGLA 1YUBA 3D7RA 1OZAA 5B7GA 1USGA 4ITRC 3VZPA 4BZQA 2PYDA 3VJMA 3TRFA 1DG9A 2CW5A 3SBDA 4OLJA 2Y27A 2WTUA 3LCVB 2BDTA 2XZDA 1TK3A 2EZ8A 3ONWA 2NACA 4HHEA 2ZVJA 1YE8A 3GJ0A 1W5FA 4AQDA 4PRYA 4BLWA 5DLDA 5JMTA 4ZODA 3A2MA 3MS4A 4UPDA 4WK0B 1DTEA 2PWZA 3QFSA 3GFPA 5AXAA 3KS9A 3HACA 3OCWA 1SBYA 1Q74A 2VYVA 3W5BA 3IUMA 1DRJA 1E4YA 2FETA 3GUYA 3HCEA 3S4YA 2LE0A 1KPGA 4TYQA 4EZBA 2WYUA 1RQPA 5JALA 1IY8A 1U8CB 1FP7A 3C87A 2WD7B 1RBQA 1ZU5A 2WOJA 5DM70 4KNYA 2R47A 3NC0C 1Z8DA 3NB0A 4QBIA 4MVJA 4X91A 1KI2A 1PZEA 3ZQ4A 1RAEA 5ALFA 3KZXA 4EL5A 3GT4A 2FZ5A 3MBKA 1G1MA 3QHQA 4IIJB 1K1EA 3S2UA 3HBFA 3TRHA 4AYWA 5JXWA 2QUJA 1WXDA 1PCXA 3ZYZA 3GLIB 4HO1X 3QTTA 2PWBA 4R6WA 4IHAA 2DLCX 2A9FA 3FZEA 4RJJA 3WV5A 2DHQA 2CXHA 2Q3JA 3FXAA 3S7TA 5ICCA 4BX8A 3WJ2A 2J5XA 3EW9A 1PKXA 2QN8A 2FN4A 1UZNA 4LRSB 2FWAA 2NN3C 3NXKA 5B7QA 4O63O 5FDFA 3G9TA 1LF5A 1CY7A 3TH5A 5L40A 3QLEA 1RVV1 1SUWA 4LGCA 1G5IA 1EH5A 5HEKA 1T6NA 4Z7NB 3QTLA 4FE4A 1MENA 3AKZA 4EYOA 1R7RA 1ZRSA 2C5BA 4YASA 3JAKB 1GL6A 5FTKA 1IPEA 4KI7A 4QU8A 5H3HA 2XUFA 1NI3A 3Q7RA 1JR6A 2GILA 2PD3A 1QGZA 2QIPA 1M67A 1XD2A 5EZQA 4DCGA 5HIAA 2Z1NA 4MGHA 3E2PA 4Y2JA 4JGGA 3PHIA 2EQBA 1MF7A 1Q22A 1WY7A 4R4JA 4UDOA 1J5EB 1SXJE 3O8OB 4V38A 5CFPA 3A31A 4D0NA 4Z3KA 3IP1A 4EEKA 1LBTA 2HO4A 3NWBA 1N9KA 4RV4A 3SVLA 1JH8A 4P2GA 1K0UA 2JBHA 1NURA 3BFKA 3Q6IA 5C37A 1H2HA 2PN1A 2C7RA 1DGQA 1E99A 1W73A 3B1FA 3PVSA 4OP1A 5G4LA 3E8MA 4MKRA 3SYLA 4B82A 5BNWA 5LOVB 4Q4HA 3DDWA 3QW2A 4PIVA 2KYRA 3C14C 1AOXA 2HWWA 5AXDA 2ZPUA 4DJEC 3N2ZB 4F3CA 2OXRA 2Z2KA 4OO3A 5C7YA 4P7GA 2COKA 2WMOB 4JWKA 3BRCA 5IU6A 1V3TA 1CUDA 2HSZA 1G20A 3ZDFA 3JWJA 4R2KA 4CQMB 1WNTA 2CL6X 1QZTA 4GQIA 1QBGA 5ALMA 1WZUA 4AUNA 1E1CA 1GL9B 2AOTB 3NXSA 3RGWS 2VHZA 2AV6A 3OCUA 3BERA 3DKPA 2UZAA 1SJ9A 5DIZA 5K8UA 3TUJC 4B4VA 5JATA 4BRUA 2H4FA 1L5KA 2XMSA 3SYTA 3TD2A 4C88A 1J9ZA 4QBGB 3W6NA 3GRRA 4ENVA 1DT3A 5IJWA 2PRSA 4ZAFA 2NQ8A 2OHFA 4N7BA 1S3FA 3SJAA 1UPAA 3UFXA 3DGEC 1OFUX 1E61A 3KCQA 4TKZA 4KNWA 3UMSA 4CPDA 3NEAA 4V02A 1H6AA 2FDXA 3H5LA 3Q2OA 4OBBA 5IYZF 3RQSA 4DNFA 1VSQA 4GGMX 2O8CA 2GYUA 2VFAA 4HGQA 5K03A 3FOZA 3LF1A 2E55A 2WPNA 2N47A 4NF2A 4BNWA 4KDEA 4KXVA 4MYHA 5EJ9A 4HZUA 1NX9A 2F00A 3AHHA 1XZAA 2YOGA 1XU7A 2P9GA 2I80A 3NV9A 4FUQA 2OOSA 5EJEA 3DFZA 5CDYA 1P80A 3PE6A 2WVHA 5TS3A 3KWJA 1CR6A 3VGJA 2VNKA 2C83A 5LU9A 1OFTA 5K09A 2H59A 2JH8A 2F8LA 4LOHA 4QHTA 2FRDC 4YRJA 4LS3A 3KQLA 1QYRA 5EKDA 5TF4A 2WWHA 3QI7A 3Q5DA 4FWBA 2GFIA 1KEZA 3IE2A 5AVTA 4MQFA 1T0BA 2GN0A 4LBVA 3G7UA 3PGVA 4RKRA 1Z06A 1W2HA 4ZT7A 3I6ZA 3JVDA 1WKCA 2XF2A 1P72A 3A4LA 3BAFA 2UZ3A 1TZCA 3MBOA 2V4ZA 4JLKA 3GNTA 4Q1FA 1LC0A 4II3A 1NUTA 2ZT8A 1JFFB 1B2RA 3R3JA 4IBOA 1ZIPA 2RCYA 1G8PA 1ENOA 1TJYA 1ZIOA 4RTQA 4HNSA 5DCUA 2O2DA 4XX0A 4ZXPA 2AE1A 4IOLA 1J21A 2CE2X 4OBEA 3AESA 3F4KA 2XAUA 4DDTA 1MJHA 4U9HS 1Z4JA 4JBWA 1E3WA 3BC1A 5HPYB 3R7NA 3A1UA 3WWPA 4PW0A 1KI3A 4NECA 2PGAA 4QQNA 1IYZA 4U2EA 2AEJA 4B34A 1L1RA 3QYAA 1LVUA 1Q6YA 3D6VA 5IJ0A 3AR4A 4XW2A 5FL3A 3EK2A 3S1AA 4EKEA 2IX9A 1XMOB 3KM0A 4J7UA 3DOUA 1O0SA 4LNAA 4NOMA 5DI3B 2YW9A 3FPAA 5AHKA 2GLXA 2P0EA 1AGYA 2GBFA 4GXQA 5EIHA 4DLNA 3JD1A 1KERA 3PFBA 3DDUA 4HWTA 3PKIA 4FONA 3ACCA 3CLSD 4NH4A 1B3RA 4ZQGA 4B8WA 1B2LA 5F4ZA 4C04A 1PJCA 4D9IA 4JEMA 4NY1A 3MT7A 5KJCA 2VYND 4DE5A 2JCGA 4Y6RA 4FMPA 1Q16A 4XE5A 1BHSA 1QH1A 4FFNA 5H3CA 4DWVA 2HQRA 4MRAA 5FIUA 2ZSIA 4GPD1 3UKOA 3CRRA 1K06A 5EXPA 1QIEA 2P2LA 2VJMB 3P94A 1E0DA 2AXPA 4F6RB 4W9MC 3QVJA 2YFQA 4LTNA 1X19A 2GOYA 1NRXA 1EFCA 1KY4A 1T8PA 5JH7B 2D2VA 1YB1A 2EBHX 2ZAMA 1JG7A 3M6WA 1Z6AA 3KZCA 3OQ6A 3MQ2A 4KIJA 5JD4A 2X4DA 2R6R1 3A9RA 3FVQA 2BFEA 2C77A 5BMVF 3CY6A 1UP4A 3EOAI 2GBGA 3G2NA 1NX6A 3LL4A 4QYMA 1U8UA 2DUUA 4GPAA 4IMPA 3FGNA 3WIEA 5JISA 1UBJS 3DP9A 2A9PA 3GPDG 5CGZA 4EJSC 2ZIGA 3O1JC 4U00A 2EG5A 4P7BA 2HHAA 1A8SA 1RYMA 2ORIA 2WT8A 4G89A 5KPJA 4EAQA 2V03A 2C7QA 2Z8XA 1MRSA 5IT5A 5JFGA 4BNIA 3IODA 1JHUA 1ABBA 4ZHQB 2ZRNA 2VF8A 3H9CA 3R23A 2BZ1A 4BGDA 1ZXXA 2R1ZA 3QP9A 4MWBA 4RJKA 3GLHB 4MJXA 3FPGA 4IDAA 3IOMA 3GOHA 1W19A 1XK6A 3H2JA 3H2ZA 1DDGA 1K7SN 2VC2B 4MQ6A 5E3IA 4DPMA 4YCSA 2QN6A 4O4HB 1SVUA 3L79A 4J0EA 4W7HA 1LLDA 5FWNA 3SMVA 1UWVA 2P40A 3C8UA 3WL4A 3RSSA 4BDTA 3PCXA 4IDDA 4LHEA 2ZVDA 1WBBA 1P45A 4CM6A 3CONA 2Z4RA 2QB5A 4G0QA 2FMKA 5JFTA 1DBWA 2JJ2D 3BKXA 4IP0A 2VDOB 3CMMA 1QG0A 1CX9B 1QXSA 2JHAA 4W5RA 4MDFA 4B6EA 4ROTA 4MB2A 1L7QA 1XCMA 3NVAA 2NTEA 3EAFA 5G40A 3AIMA 1DG3A 2AA3A 1GPMA 5CBPA 4F85A 2BJVA 3E1SA 3IPLA 4JYCA 4CKXA 2R6HA 2JGMA 1COZA 3GZ4A 3V7NA 1DUIA 1PQYA 1OV6A 3BA1A 3H8WA 3N2IA 1VBFA 5EN4A 2AZ4A 3FTFA 2PVPA 1AH2A 2X0EA 2I9PA 3F8SA 2PUWA 4RSMA 2PA0A 4UW9A 1GO2A 2YS7A 4W1RA 2ZJZA 4BYGA 4J0JA 2FQWA 3TCXB 3A58B 4ALJA 5FQNA 5FUMA 4BRWA 4RFSB 2OD7A 3MM4A 5EA2A 3RO7A 5JEEA 1G8YA 2BBOA 2I4TA 2F9MA 1Q0PA 4M3NA 4NEGA 1AURA 2EFCB 2PMBA 5AQEA 5CCEA 4DLWA 2E82A 4PO1A 3RSZA 1YKSA 4C9BA 1VJ1A 3U60B 1NWCA 2XMZA 4LZLA 3T1YB 2QGNA 2VP3A 2PUJA 4MI3A 3UHFA 1WQ1R 2FFRA 2HOQA 4H08A 4ARBA 1EUDA 1ODTC 4UTXA 4N47A 3ZDQA 3PA8A 1RWVA 2AZTA 2ZANA 2TMDA 3OTOB 4TQ9A 4FXOA 4KDFA 3F97A 4TQAA 2PE5A 1W0KD 2JEYA 4MR8B 3ZTTA 3RU2A 4HDRA 4UM8B 2MJLA 3EZGA 1E96A 1F6DA 1NY6A 1YMQA 2ISQA 3FCYA 4RVGA 3S2SA 2Q5OA 5JMPA 3IO5A 1PAUA 2IOHA 4OQEA 1QGED 3ETDA 1DJPA 2BGNA 2C98A 1QP8A 3P97A 4LTMA 5FUVA 5HIIA 4KE7A 3SHOA 2HGSA 1EVIA 3A2LA 2B1RA 3C98A 3N0RA 4MQEB 3N6RA 4A36A 2SCUB 4JFAA 3EVAA 3JYHA 2OPHA 4Y0VA 2QG4A 2RC6A 2ZW9A 4WESA 4XWTA 3VHXB 4D99A 2D5CA 3DAHA 1NVAA 5KOYA 4CEJA 5F3WB 5FWDA 1Z4PX 4LZWA 3BE6A 1A2QA 1SIOA 3MB5A 5FNZA 3SP1A 2XB8A 3USES 2ZBGA 2ZRFA 1CEEA 4UUBA 4MA4A 1MKYA 5KTOA 5ELXA 1UZAA 3ICPA 1XMPA 5C7IO 5FEUA 3EE6A 1QQTA 3U44A 2B94A 2C7BA 4YBRA 1R2QA 1SEPA 1NLFA 2CUTA 3AB8A 3H3FA 2ONCA 1VM6A 3DWFA 4XGKA 1Z5ZA 1BNCA 4TVSA 1NDHA 1C9NA 1AV7A 3UMJA 4GS5A 1IC6A 3ZDCA 1JZSA 2OECA 2IXGA 1CJVC 2Y1LA 1AKEA 1Z8FA 3EGCA 3LPCA 3I01A 1A0OA 1N2CE 1IBKB 4D4KA 3T9AA 2W22A 1R16A 5JRZA 2V7VA 3L0SA 1UC5B 3QWIA 2IYUA 1NNLA 4JD5A 4ZJZA 4CL8A 3MUFA 4DRXA 5J23A 5MN4A 1L5SA 1W85A 4QNRA 2RAVA 3DQPA 5JASA 4RK6A 5M7EA 3KOUA 3C3MA 1Q11A 1KDYA 1KZ4A 3ZDXB 1XZLA 4HLQB 1IBLB 2ZUTA 5HK8A 1F4VA 2XQJA 1JQLB 2P3QA 5IH7A 4LNUA 2H0RA 4JX9A 4DJFC 1CUFA 2A5GA 2W71A 3HR7A 5JS6A 3KJGA 3HCPA 1S4MA 3R6LA 4AJ2A 4RA6B 4D8WA 4Q9JA 5K3SA 1M1NB 1KZ7B 3AFMA 3DFUA 4Y6PA 1CJMA 2W0MA 2GCPA 4BMXA 3NGLA 3PBKA 4FFPA 1DEXA 3AONB 1KQPA 3DYIA 4FFRA 4UD6A 5FF9A 4EPRA 2XIQA 2VHUA 2GZAA 1Y8QA 1LSSA 3FPBA 4XJVA 3E5RA 1R15A 3RF6A 1GPWB 3STYA 5KNBH 1U0BB 2DC1A 1YASA 3M2PA 5E4TA 1YZQA 3FI9A 1ULAA 2J3EA 3CRVA 4FGZA 3K1AB 5IFKA 3D43A 3CH6A 5EMLA 2P1DA 4CEJB 2CT8A 1OW3B 2D7DA 4FKMA 3P9ZA 4FN5A 2P6RA 1G5HA 4Y6OA 2PJUA 4FJ2A 2OEPA 2OWDA 3RYIA 3QQPA 3ZXUB 5BW8A 1IRXA 3FPKA 4M36A 1P1KA 2E49A 4DTIA 1IN6A 2JLVA 1FLVA 2VSQA 5GIOE 2R84A 2A5DA 4TS9A 3T0GA 1R6TA 2QVBA 1T6ZA 3ZCQA 1M34E 3N8HA 1N1MA 4TL8A 5AKKA 1I9CA 4YRCA 4F9EA 2VNHA 1YHZA 3OZAA 4NJEB 4HATA 4X63A 1X7GA 4GICA 2Y93A 2J41A 5ALKA 4BQFA 3ELDA 4DKXA 4B6PA 2XV1A 4NHEA 1UMDB 1QAOA 4KR2A 4F1KA 2D74A 5NULA 4AWBA 5K6TA 3A6HA 3IHWA 3QKWA 2NU9A 1W25A 4AY6A 4H59A 4EHDA 4TMVA 1K6EA 1EE9A 3MCZA 4PNPA 5BV2P 1ULHA 4ZOLB 3MIZA 4DCOA 1SHUX 2F8SA 1OB2A 1JNYA 3BMCA 3DMRA 3HN2A 1S8NA 4U8HA 4UM9D 5A05A 4C7XA 3COZA 4IIYA 4E3ZA 1HFWA 2AFRA 5IF9A 4X5OA 1JG6A 4KFRA 4DSTA 2H29A 3CR8A 3R9XA 3BK7A 3LFTA 2IBMA 2SICE 4CFZA 2Q2WA 1CY1A 4Z7JA 1P5HA 1WD7A 3BWCA 4C3VA 4K9PA 3F8TA 3EBPA 2WJVA 3IP7A 3NTRA 1IFXA 3VOTA 3VR4H 1H4QA 2Y1EA 4BKPA 2XUOA 4HN4B 1XEWY 2HTFA 2PWYA 4YAFA 3F96A 2CJPA 1G63A 2OMKA 3G0IA 1RHJA 3MRSA 3LCCA 4JN6B 4JVNA 3FZNA 2JCXA 3NLLA 3U4GA 1QG2A 1RPTA 1Q14A 2I34A 4BO9A 4AF8A 4NNJA 4QULA 2J6IA 2YQ5A 3RVLA 2AN4A 4JUCA 1WUTA 1V43A 3GX1A 2YHAA 4FOTA 2YZKA 1MCZA 5ERYA 3P9CA 1SKBA 4LEIA 1PL0A 3R3XA 5FOQA 5EZYA 16PKA 4HDNA 2PU5A 1GFSA 5K0FA 3Q8XB 1Q0UA 5DISB 2WWYA 4ONEA 4YRIA 2AH5A 4K6CA 2VHEA 1XT6A 1M8FA 3GQBB 1HNZB 2WU4A 4UHHA 4MLZA 4MW9A 5TE9A 4BP8A 2GTHA 2OORA 2GD2A 1HDEA 2QTCA 1BW9B 3I1IA 1N0HA 3OTIA 4QAJA 4R1OA 3UAOA 3RFFA 1TM5E 5DNCA 3JZFA 2DFPA 4PYOA 2V4UA 2X8JA 4JVLA 3D1LA 5E2AA 2FSSA 3JD0A 3KIPA 3W5CA 1SZDA 2R9VA 4O02B 1IOLA 3CX4A 4HDQB 5L6LB 4U2DA 1J90A 1SA0A 5EHZA 4F12A 4CUZA 3IEIA 4FYKA 1M2OA 1J42A 2FR0A 4LZOA 3LT1A 3RB8A 2Y67A 4II7A 1KQNA 4EI8A 4MVJD 3VH3A 4MJLA 4NMLA 1QK5A 4O33A 5IVDA 3BXOA 2PL9A 4F0JA 1SB8A 4WKOA 4Q16A 1IG0A 2AG0A 2JAXA 1HUQA 1YS9A 1SXJA 3G1TA 5J2UB 4ZMRA 2OM2A 1L8QA 2XH8A 1QE3A 4TS3A 3CVOA 2OC4A 4ZRDA 5EIAA 3IEXA 1TB4A 1G9XA 1Z0SA 2CHUA 2GEBA 3OLQA 3O74A 3HVRA 1XG5A 4LQLA 1Y7LA 3WYCA 1FZQA 2EFGA 3GPCA 3C1OA 1JG4A 4G0XA 4JBGA 4F2HA 3IPAA 4IZ6A 2X9QA 3WV4A 2P9HA 4BQQA 1VKNA 4LHXA 2FU5C 1I7LA 5AUNB 1QP0A 4D3DA 4FDUA 1J0BA 1NRIA 2BP7A 3VYSB 2W6CX 2P11A 1W8DA 1U2QA 3HGQA 4W1PA 2JI6A 1LK0A 3GVCA 2ZR7A 4MUFA 3LT0A 4TSRA 4F4FA 5BT9A 4BECA 1BMFA 2OFPA 1A27A 4KYVA 1MAUA 1E5XA 1BMDA 1Z08A 1JKJA 2CNNA 5K0CA 3IPRA 4CF5A 4BFZA 1RSZA 2JASA 2J7PA 2C5GA 4K0RA 4ESHA 4JI5B 1EESA 4NSNA 4DT1B 1B26A 4E5KA 1VCIA 1A9RA 3RRYA 1WMAA 3H7IA 1GUDA 1XX6A 5FPPA 5KX5B 4HGZA 4LJ5A 5KNLA 3TUZC 5LQMA 5ESDA 1XVLA 1SOAA 5JI3E 2VUUA 3H9JA 1PBTA 2XUKA 5IHXA 4WLNA 3IIMA 1P4AA 3KQQA 3T7IA 1W88A 2VJNA 3A1DA 4C76A 4DLAA 4MAMA 3UT6A 1IOZA 2J87A 5LP6B 1T0PA 4TL7A 3WLJA 4CU2A 5CIWA 1ZU4A 2BI8A 1I0LA 1X92A 2QTWB 5KYUA 1B0PA 2QF7A 4YROA 5JSZA 3PD7A 3OUTA 3JZDA 5KBYA 3VFDA 1GEEA 3D7SA 5TQ2B 4D45A 1EGQA 2XT6A 2WMYA 1D9ZA 5HW0A 2YRXA 5LYJB 3LS2A 4YXWA 4CM8B 5JSYA 4MW6A 2BFCA 1NVTA 3FMFA 3C3JA 4TKUB 3IEKA 5CPFA 3R0QA 5DJ5A 2RHTA 1U3VA 1RW4A 4RSRA 4CETA 2YY6A 4MARA 4RZXA 3PC8C 3LUDA 3ID6C 4AUEA 2M32A 3ESAA 4L85A 4U7TB 5FYDA 3BXGA 1A9QA 1RWWA 3JQRA 5C8DA 4F91B 1OLUA 3URKA 3WIUA 1TYAE 2ZUEA 5EIWA 2LCQA 3MXOA 2DKNA 1E98A 3BQMB 3DMFA 1R88A 2O19A 3B9QA 4ND1A 3SBXA 1JYEA 2J6CA 1SCUA 4CTOA 3IGFA 2WM2A 1DAGA 1HK7A 2JIDA 3HFSA 3FR7A 3IQFA 1N4DA 1TYCA 1O3YA 2YVKA 3FHCB 1FK8A 3KR2A 1GRVA 5EGNA 1I2BA 5FOUA 3UHAA 2DT5A 4BHTA 2B3DA 1RRPA 2VSXA 4RQAA 1HE3A 2HJGA 3WOVA 4B9EA 1JA1A 3DE4X 1E2JA 2BFDB 2POCA 2CLHB 4C20A 4ENPA 3CPHA 3EWNA 4NBWA 1O89A 5FBLB 3V3TA 5LVAA 3PV0A 4E2WA 4MW7A 1N2HA 1W35A 2EKDA 1I3OA 2VBGA 1KI7A 2J9RA 5FR2A 1DZ3A 1F8FA 3WWZA 1KZ9A 1FPQA 3FGPA 5AJWA 4JYZA 5AJTA 4E94A 4TV8A 1VA5A 4BKMA 1RXIA 4CWAA 1C4WA 2CL0X 1Z4MA 1MXFA 2DPXA 4W5OA 3CKYA 2CLSA 3NO4A 5IBRA 5BV8A 5KHLB 5L4NA 2QLBA 3PQ2A 4RUKA 3BZBA 1G5PA 3D0KA 2YHIB 3FOWA 3W8NA 4BBZA 3JX9A 4BRZA 3CUEF 1TIKA 2Q46A 4QLAA 4HB4A 2Y4NA 2OE2A 3KJZA 3L0DA 4KWTA 1T5HX 4OSPA 3KJHA 3CF2A 5DGDA 2E5LB 5AOBA 4A8JB 3OU2A 2CVQA 1Z18A 2CVPA 3WAGA 2IY7A 2JI8A 4R1LA 3TG2A 3C0KA 4WE3A 3CLSC 1JBEA 1Z8HA 4MPJA 5DEIA 5A0TA 3UQZA 3QE2A 1RP7A 3ZJ5A 5A62A 5DTJA 2P9FA 4MH0R 4GOMD 2CMKA 4QUJA 5CD1A 4N4AA 2REQA 4YGYA 1GTZA 1S8FA 1FYEA 2HWUA 2MR6A 1ZSYA 5GJBA 5HA5A 1C7EA 3DHEA 1ZL2A 3KDPA 4A8TA 3D6NB 2QT1A 3DMHA 1GQ2A 4RMGA 2BE7A 1VPTA 3N2KB 3DEFA 1H2YA 3GCWA 3OE4A 4PCLA 4CUJA 2CSUA 2ZFUA 2PG3A 3LECA 1CJKC 1H66A 2C58A 2H2AA 1LRJA 4IXNA 3S8YA 1STOA 2DHCA 4G85A 1XKTA 3T52A 5BXQC 5A3QA 1O58A 2XT9A 1E2DA 1BCSB 3JQ9A 5AXBA 4EUSA 1FE8A 2AMVA 5B58T 3AHGA 4RVNA 4IUBS 4D97A 2G80A 3NBAA 4EECA 5IWCA 2QBYB 2GD6A 3WGVA 3NDIA 2GN6A 1QFSA 3WI7A 4O4JF 4J0KA 4JGIA 1OWLA 4F3YA 4CG0A 4DUYB 3UAXA 3NTUA 1X7WB 4BLTA 2OXCA 1DKQA 2VK1A 4RF2A 2Z2JA 5FX2A 4RLQA 4HRYA 4Q66C 3V9AA 2O52A 4KIUA 3H0EA 3ETJA 4K9MA 4B9AA 5CGQB 2CV2A 4ZYYA 2MU1A 4P3XA 3PQ6A 4JLBA 2R8PA 4L22A 4QWWA 2PUDA 3ZNQA 2V96A 3QLVA 4FB4A 2CXXA 3IT2A 4UUAA 4JKYA 5U4QA 4I50F 1S7GA 1ORTA 3CWQA 3IV9A 2UDPA 3BWBA 4NULA 4RELA 4IDEA 4YUXA 1KBZA 1F60A 2V54A 1YE5A 3EF3A 1JEYB 4A0GA 2I9KA 1DIHA 3I2HA 4G4JA 4BE9A 1P29A 1T6BY 3DNMA 2CFIA 4WBNF 2HMVA 2SHKA 5JAPA 1ISGA 3AUUA 5CX1A 1U3UA 1NLYA 1OFUA 4Q19A 3G9UA 4OXYA 1M2NA 4FHCA 4UKDA 5FBQB 2D7JA 1W4AA 2YFYA 3GHYA 2ZVQX 3RWOA 2BL4A 4ND7A 4DR4B 1HKHA 1Y42X 3CZMA 2ANCA 4F21A 4LFCB 4L28A 3C6MA 5LMNB 3T3OA 2YMQA 1CIJA 2ACVA 3DUFA 4LOLA 3RKSA 3JQEA 3RLIA 3ZJYA 4EY5A 3LA6A 1OU4A 2VP6A 5EE3A 3WBJA 2QR2A 2XVZA 3NKFA 4JJIA 2R2AA 5B6IA 4BAUA 1MAWA 1CZOA 5EJ6A 3WIDA 5IW8A 4CMJA 1MAVA 2CFCA 3V1TC 3WRYC 1NVEA 3O75A 1WHTA 2QD3A 1UM8A 3D1VA 4OHCA 3WKBA 1SVIA 5BRJA 4ZALA 1G8AA 4G23A 3W6PA 2UUBB 1YK0A 1M2HA 3H2KA 4BBJA 2BC9A 4HDKA 1CRZA 1HTBA 1XDWA 3SC3A 3EUEA 3TLZA 3IELA 3PQDA 1SQ6A 4N18A 3UVEA 2O5EA 2B61A 3K2IA 1SZCA 2ZRCA 4DCPA 1DSSG 5BUZA 1CYEA 4MV8A 4ML3A 4RLFA 1BO6A 1ZH4A 2J4FA 2M6RA 1C9EA 1EVQA 4I55B 5AJVB 3SM3A 2PKCA 1TO2E 1N9GB 4IS2A 5EE5B 4NKRA 2I8AA 3L40A 4PU0A 1KYYA 1JAYA 3KVVA 4O4IF 1AS3A 4X8OA 1BFDA 2BUCA 2J3DA 2Y2UA 3TW4A 4LE2A 1W0JD 4LC9A 4ATNA 3AHFA 3L5KA 3R3YA 3P5BA 4KWIA 4OTZA 3G8YA 1OSNA 1A2OA 3ANXA 1VC2A 3CV3A 4IPTA 3UJDA 1W5AA 1I3CA 2H9YA 4KXUA 3Q3EA 4MWDA 4PPQA 3VR2A 3G5MA 4R83A 2R97A 5CHYA 4E46A 2R8EA 3MJCA 3KUUA 2C5AA 2IYZA 5JNTA 2RHHA 3AJ9A 3M49A 4ARSA 4P38A 4UNIA 2Y6VA 4DTCA 4GI1A 2POQX 4BMVA 2VCYA 2F1OA 3JYLA 4KNVA 4PQGA 3OQMA 2RGBA 1T2UA 1C30B 1QLJA 3QMVA 4KQ9A 5I47A 2FPMA 1Z4QA 1QS0A 3IQGX 4R1SA 4XD2A 3JU3A 3ILXA 3L6BA 3M9WA 3BXPA 3PR3A 1IY9A 3TF5A 2ZJ0A 1Y80A 3OJLA 5ESWA 3K6SA 3LF2A 2VHTA 2B4YA 2XD4A 4LXXA 3V1MA 4TWRA 2JLUA 2C1EA 5C81A 2JVJA 2ZYWX 3R1IA 4GWKA 3RSHA 2EFJA 3ZVKA 1ZNWA 1GA1A 1GA6A 2HLPA 2X41A 3MGKA 1N2CA 3WXBA 5TARA 4DLUA 2P0AA 1VOTA 4ER7A 1RM3A 4FGWA 1GZ4A 2CLOB 1K3TA 5H16A 5ALXA 2G76A 3TR0A 1M6VA 2O2GA 4MCIA 3AM4A 4YP1A 1YB6A 1TJNA 2C4WA 5IN4A 3DMGA 4PVCA 1GA4A 4EW3A 1ANKA 3DBHB 3C1UA 2XR1A 3P2YA 4GKBA 5F98A 4B0OA 4LSMA 1WM1A 2NQ2C 3I45A 3P2OA 5CFLA 2RHGB 5D3KA 1IXZA 1OAOC 4MS4A 2ATEA 2PZLA 1NAIA 1DVRA 5EQJB 3GR6A 4RIGA 2ZULA 2FY8A 1OFIA 5BW4A 1K92A 4KSCA 4KLCA 2ZLBA 2PJRA 3ROKA 1Z22A 3T41A 4Z4IA 4EG1A 3A26A 1N5JA 3MTIA 4FJ1A 4DMKA 3A4MA 4OI0A 3FMOB 2VJPA 3U48A 3BJRA 3ANLA 4W5HA 5K05A 2UZIR 1HMYA 2FK7A 1US8A 4Q47A 1JPJA 3EZ6A 3VR6H 4IIJF 1NRJB 3WK8A 3WLMA 5B55A 2I4IA 2QR5A 4G5XA 4BZZA 3THYA 2AR9A 1JX6A 5E2IA 4KIFA 1EJ6A 1I7DA 3ZHSA 1GG9A 3HY6A 4K5QA 4F6RA 4JQYA 3KD2A 3UUWA 3WP1B 3STVA 1HV8A 3UTCA 3RC2A 2QD4A 3ZKWB 1BE0A 3VV3A 3EASA 3HO8A 4PIMA 4BV9A 5HKKA 1GR0A 4B80A 3BFVA 5E7IA 1ZD2P 3PL1A 3RH0A 3DEZA 3HGMA 3F7MA 4XIGS 1M34A 1HQKA 3CEHA 5IRCD 4NENB 4U7FA 1LW6E 3ER9A 1T4GA 2PD6A 2ZT5A 3CHYA 3DBRB 4R68A 4JI4B 1ELOA 1YU6A 5COQA 1S7CA 3LDGA 3NYWA 2PY6A 3V6MA 2DQKA 2Y3IA 2RB4A 4FWIB 2O20A 5M2QA 4BU0A 3G9QA 3AY0A 2WJZB 5F5NA 1JIUA 2XYVA 3ZNPA 3M6AA 2HRCA 4UNQA 3O9ZA 2WAOA 3VSAA 4KWHA 4R5HA 2ZXEA 3KPVA 1AUPA 2B4QA 4H60A 4KDCA 2PR2A 1JB1A 2BBSA 3JQ8A 1WZCA 2FF5A 4HKTA 4TXNA 5HDQA 2HRZA 4YN3A 1ITZA 4ER3A 4RGYA 4TXLA 2J3MA 3ELYA 1VIAA 1I13A 4Q9LA 3TGWA 4AZTA 1KTVA 4C0WA 1D1QA 3EXIA 2YY7A 3PJRA 1QF6A 2CLKB 1DJQA 1WDMA 1E92A 4GOLD 3TE7A 3WLLA 2C4TA 1JMYA 4A0SA 3GCGA 5C31A 1E0JA 4WQMA 1FVXA 1AQIA 1N5IA 1ZM4A 2J4DA 1E64A 3KSUA 2RAFA 3ZU5A 1X7HA 4XVRA 5FNVA 5JHHB 1Y8CA 1MB2A 1YZNA 3A9WA 3C45A 3G2OA 3LX8A 3DWGA 1Z82A 2OP1A 5EUQB 2XDAA 5AVYA 1MDBA 1TRHA 3SEFA 2DFTA 4HTAA 4FFMA 1XDGA 5T4EA 3WO1A 3F6CA 4INZA 2DHRA 1A5ZA 3O73A 3N2LA 1A9SA 1GQRA 1N6KA 1FYDA 3NBYC 2G9VA 2NNLD 4RW0A 4PFSA 3GFBA 4FDMA 3BXZA 3TSAA 2PEZA 2GWHA 2G28A 4IV5A 4S1TA 1SPBS 5GJCA 1NXVA 5IVKA 1T10A 3EXFA 1I2AA 2YRWA 3ER6A 5C53B 1U2ZA 1T2CA 3HB7A 3RODA 4HXYA 3V4ZA 1LNQA 1U0RA 4B4DA 4J1NA 2UYOA 3AY7A 3RS2A 4YRAA 4X1YB 1WF6A 1TEVA 5HXAA 1HEYA 4D9HA 2WWTA 3JWPA 2CHVA 2Q1TA 5FPYA 4B47A 3CZAA 3OM0A 3M2TA 2P5TB 1GYRA 2NWQA 4G2TA 4QASA 5J5VA 5A3SA 1OA0A 5CP8A 1S9DA 1C7ZA 3QU4A 3FLAA 4HXEB 2QLNA 1R9JA 3IP3A 3QOWA 2WKPA 2AX4A 2WWWA 4RVDA 1L5OA 2RHOA 1E9AA 3B1VA 1NULA 3QEJA 4PX5A 1LK5A 1KK1A 2E1PA 2XUZA 4HH0A 2FEKA 4R8LA 5CU7A 5DWDA 4BKUA 5AVRA 4GKJB 2RGCA 3JWGA 3QEAZ 1WXWA 2O06A 3QXXA 3TIGA 4PTLA 2HLDD 3KEMA 1J99A 1OLOA 2HYDA 3PQ4A 4WW0A 2NUTB 5T57A 2W8ZA 1ZUNB 5G02A 4ZI7F 4DUGA 1HDIA 4WVLA 1YR7A 2PV7A 1V2HE 3MFQA 4JGBA 4KQ2A 2WFLA 4XPIA 4D8UA 2PRKA 3EPPA 4LKOA 5KC9A 1VG0B 4DLKA 3JAMA 2WTBA 5EWMB 3ACDA 4XDYA 2UU9B 3GJ4A 3TRKA 3E3AA 3I32A 3BK1A 5JD3A 2R1TB 1JN0A 2GO1A 2HLHA 3R5TA 2EQ5A 2IUUA 5F51A 3VYRB 4FFOA 2PRIA 1P7WA 1SQSA 5TIIA 4HL6A 4L0DA 4D92A 4L5AA 3OWXA 3CX6A 4LYYA 2X5NA 2PLAA 1DWOA 3EY9A 3PNPA 3D6TB 2D1RA 3IQHX 5E1DA 3QE9Y 4WUTA 1ZNZA 4UDYX 5JCJA 4BPRA 1P1CA 1ZOOA 2I29A 3RS0A 4EKIA 4OK6A 2JGKA 1DS6A 4IWYA 3EIQA 4CHGA 3W04A 1XA0A 3CO0S 5B2FA 1U7OA 4DCTA 4HDCA 7AT1A 1IXKA 3VGPA 2QI9C 3OZTA 2CXQA 1XTVA 3PIRA 4R3NA 1NXSA 2E4AA 5AI9A 1SHLA 1ZH2A 2HRRA 1YJAA 4BNDA 2D1YA 3AFIA 2DBYA 4CM5A 4IICA 1VJGA 1X9IA 3SK0A 5JJIA 3DEJA 5BN5B 1FCJA 1CWUA 5HF6A 1ZEMA 2A7QA 1FFXA 1HPLA 1D3AA 1EJBA 4KXLA 3CRMA 4PO9A 3O1HB 4U2GA 4R05A 4RMIA 4RS4A 3ZTWA 3LQ1A 2R8RA 2IP2A 4B75A 4JP3A 5EWJB 3UKDA 1E2IA 1GGKA 2NLOA 4FEGA 2BMAA 3JQGB 4DLBA 4FGUA 4E5PA 3GT3A 2EGUA 1MT0A 3GJRA