1B8PA

Malate dehydrogenase from aquaspirillum arcticum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
KTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRNIKVLVVGNPANTNAYIAMKSAPSLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGASVKDMINDDAWNRDTFLPTVGKRGAAIIDARGVSSAASAANAAIDHIHDWVLGTAGKWTTMGIPSDGSYGIPEGVIFGFPVTTENGEYKIVQGLSIDAFSQERINVTLNELLEEQNGVQHLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cold adaptation. Sequence, biochemical properties, and crystal structure of malate dehydrogenase from a psychrophile Aquaspirillium arcticum.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (MALATE DEHYDROGENASE)
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b8pA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1b8pA02
5TT1A 3DO5A 2PFGA 3AUUA 1DJNA 1KVTA 3E1KA 2AMFA 5DCYA 4CV2A 5JDIC 5JC1A 1UDAA 3OM9A 2UUPA 3VH1A 1ZXBA 2NVWA 4PLYA 4H15A 4NZ9A 2YDXA 2GGSA 2ZYAA 5JBIA 3JQ7A 3AU8A 3PP8A 4YJHB 1XU7A 1K6IA 4FDAA 4MOWA 1IULA 4D79A 2ZB7A 3M6IA 3WJ7A 1Q7BA 2X5JO 1HE5A 3TOZA 4GQAA 1XQ1A 3IKVA 2HKIA 2W2KB 1BHSA 1P44A 3LC1O 3TL3A 1KY4A 4J4TA 4I5DA 3TOXA 3ZU3A 3Q9UA 2RAFA 3WXBA 2X7HA 5IZ4A 4U8GA 4YXFA 1S6YA 5L45A 1B15A 3GOHA 4NNJA 1HF3A 4GI2A 3RU9A 3A4VA 3CE6A 4TRJA 1OBFO 4GX0A 4II3A 2SCUA 3JD0A 4J1QA 2VWPA 2P68A 2EERA 3BA1A 2R00C 4YJGA 5T5QA 5EN4A 4IINA 3VZSA 1G1AA 1PR3A 2Q4BA 4RJTA 2Q3EA 3BMQB 1ZSNA 4MIOA 4UUMA 3OICA 3U62A 1EQ2A 1M2WA 2Y1DA 1PJSA 3VTZA 7ADHA 4MKXA 2YY7A 5G0UA 2NQ8A 3DOCA 5C7LO 2Y1GA 4FPXA 3E8XA 5DBFA 3GZNB 3PLNA 5FI5A 3ZU5A 3RAJA 1LLDA 4LCEA 4OXYA 3GG9A 1LUAA 1Q0LA 1V35A 2NU9A 1HTBA 3KXDA 4CQMD 4IQ8A 4CLHA 3PJEA 5I7FA 3CMCO 1MFPA 4YRAA 1LJ8A 5G0WA 5EESA 3C7AA 2I5PO 2W2LD 3STHA 4IQGA 3BMNB 3VOSA 3JQ9C 1U3TA 2NUAA 1UXGA 1UP6A 1CQJA 1KEVA 3KLPX 3NX4A 4FFNA 2ZTMA 2HMTA 2VHYA 4WKGA 1A7KA 3FF4A 3G0OA 3IUPA 5U4QA 5AXAA 1ISIA 1IHXA 2D5CA 3FRJA 4DPMA 3OP4A 1UP4A 3ZV4A 2R6JA 2AEJA 1NR1A 1LSOA 2QZZA 1B16A 3AU9A 2J5RA 3PIDA 5EMHA 3KYDA 1Q2XA 4XIJA 4A2CA 4HWKA 4MIYA 1WP4A 5I7VA 3KM0A 1YH3A 3WNVA 1O6ZA 4BKRA 5KVVA 4EEXA 2J5KA 2YDYA 4XJTA 2QRLA 4IMRA 1I2ZA 4DC0A 1DSSG 3U5TA 2WYUA 1RM4A 1P33A 4RGBA 3UICA 1T2EA 1I3NA 2B36A 4KZPA 1J5PA 1UZNA 2XAAA 1PS0A 2WE7A 4NMHA 4K28A 2X0NA 2EJWA 2VYVA 3V1YA 4PRKA 1LSSA 1YBMA 3RUDA 1E3LA 1QXSA 3U49A 4DGSA 4Y8VA 2ZYGA 1SOVA 2CF5A 2VYNA 3HG7A 4Q3EA 4WECA 4CODB 3C1AA 4MP6A 1VKOA 5I7EA 4JROA 4YVFA 1A7AA 1P1JA 3U09A 4KMSA 1AGNA 3P19A 4C7KA 3ZU4A 3ITKA 5IFLA 2CMDA 3RU7A 1X0VA 4KTTE 4RORA 3QQPA 1NPYA 3GGPA 5FF9A 5ES3A 5IAAA 3FR7A 4BHTA 3ANLA 3CSDA 3DHNA 4ID9A 1NXQA 4R5MA 1YQGA 3JD1A 4DIBA 5JYDA 3LLVA 3SXPA 2YZ7A 3RUAA 1MLDA 4Z3DA 1U3WA 3SX2A 2CDAA 5BT9A 2V65A 2ILTA 1HDRA 2PZKA 4A03A 4CQMA 2C5EA 3H5NA 3KLMX 5L3ZA 4KDFA 3PFWO 1NVMB 2ZQZA 1L7DA 5B12A 3JQFA 1C1XB 5JAIA 1JWBB 4R16A 4CPDA 4ALNA 2WM3A 1F17A 2PKQO 1O89A 1VJTA 2ZB4A 4MINA 4XR9A 1SEVA 5ADHA 4OKNA 4UEJA 3TZHA 3UHAA 3NEPX 2JAPA 1L1FA 4G2NA 4WASA 1N7GA 1QKIA 3BIOA 4ALIA 2ZB8A 1YRLA 1YB1A 4O59O 3WB9A 1PL7A 4QSMA 1HSOA 3FNHA 1E7SA 1PJLA 2B37A 3JCZA 4IDCA 3Q11A 4KP7A 4XWYA 1I33A 1GZ6A 1GQYA 3AUAA 3DZIA 3D1LA 1F0YA 4B7CA 4BS9A 3ZV3A 2QW8A 4BNGA 5K9ZA 2HQ1A 5L4NA 3RQSA 1QYXA 4W9NC 4YJFA 1IE3A 1MG0A 4E13A 3WGYA 5A9SB 2PGLA 4CMGA 4E5PA 1P1KA 3HDJA 1V0JA 2CZCA 3PGXA 3D0OA 3RBZA 3NTQA 3GC6A 3IAHA 4D3FA 3PJGA 4Y9DA 4ALKA 3F3SA 1LLQA 1X15A 4NI5A 1K0UA 5IN5A 1T1SA 4BO4A 4WGGA 4NQZA 4FCCA 1NAHA 1M67A 1T2CA 1N92A 4UVIA 3DTYA 2PWZA 5BNIA 3H8VA 1Z74A 5H83A 3NT5A 4AICA 1ZIDA 1GEEA 1I5RA 1R15A 1QORA 2GN6A 2HMSA 4AJIA 4E12A 1PEDA 1V8BA 4CM9D 1LRJA 4YJGB 3U3XA 5DF1A 4U5QA 3WGTA 3KHUA 2GF2A 3H9UA 4RCVA 2NVUB 4CR8A 5JO0A 3F1KA 3U0BA 5KWEA 4E4YA 3RWBA 3GUYA 3BHJA 2BH9A 4NU6A 4IS2A 4CLRB 5KJFA 4I9UA 3RC7A 3OJ0A 4OIMA 4G81A 2GZ3A 4NBTA 4XRGA 3FWNA 1A72A 4NJOA 1P1IA 2Q46A 4DYDA 5DBGA 3I9JA 3UKOA 4EITA 4PLPA 2O4UX 3H5RA 2FWMX 4X54A 2Q4EA 1GDHA 1EEHA 2Z5LA 4L0QA 3WR5A 4CL8A 3DMYA 4CM8B 3MWDB 1ZK4A 4GBJA 3Q9NA 1WWKA 5L7TA 3EY4A 3MWEB 4GVLA 4E33A 3FTNA 3PFFA 5F1KA 1ULUA 3F46A 5EJ2A 1ID1A 2D59A 3ZWYA 4PZCA 5BR7A 3LU1A 3QVOA 2RIRA 1LRKA 1IHYA 1X7DA 3GNTA 4PGFA 3WJAA 4KUHA 4ESOA 4QECA 1N5DA 3WLEA 3QLJA 4J4BA 1DFIA 4EJMA 3KB6A 1WLYA 1ENYA 5IXSA 4K6CA 4GKVA 1U2GA 3WX0A 3RASA 3F5QA 3K9QO 5DCUA 3QSGA 3ZN2A 1UP7A 2RBEA 1FDSA 4I9NA 4XYMA 1HL3A 1SOWA 1QMGA 3SC6A 3DXFA 3OIGA 4IM7A 4Q3BA 4DVJA 4F6CA 1P3DA 3WICA 2BD0A 1GZ4A 1HDYA 3MTGA 3S2IA 1CWUA 1ZK0A 3BTUA 4AJ1A 2Y05A 4L76A 1PL6A 4M87A 4YAEA 5JO9A 1ISMA 1A5ZA 3OEYA 3PWZA 1NPTO 1TT7A 4EUHA 1UZMA 4DRYA 2QYTA 2DTDA 4EEZA 1M6HA 2GLXA 3PHJA 2WD7A 3WQQA 4CM9A 4FW8A 4BGVA 1BXGA 5CAEA 3LQFA 5TF4A 3W8DA 2HRBA 4B3JA 5CFZA 1H94A 3L9XA 3RROA 4RQUA 2P9EA 4ILKA 1GZ3A 3G1UA 4DWVA 2W2KA 3PVZA 2PH3A 3E9NA 4EUFA 4OOEA 4CMBA 2YHIB 1UXHA 1MA0A 2VNAA 3T7EA 4XDZA 1A71A 1DHTA 1PJ3A 3JD3A 2XPCA 3KO8A 3VVCA 3TZCA 1XIVA 1LEHA 1Y8RA 3NRCA 4BGEA 1SBYA 3LT2A 3DZJA 4CMEA 1XGKA 3PYXA 2D0IA 4QX6A 4F6LA 1YB5A 5KKCA 3RKRA 3WS7A 2JHFA 1N8KA 1PS8A 5T6BA 2PGJA 1R4NB 1FDVA 4A26A 2UAGA 1VI2A 1H0KA 1R66A 3ADOA 1YONA 3IS3A 2ZJ1A 1TLTA 4ND1A 2TMDA 3V2HA 3RC9A 2NU7A 5B4TA 4Y6SA 2C2XA 4N7RA 4UAGA 4XYBA 3GZNA 5EINA 3G3EA 1LDMA 3I4CA 3RJ5A 4IPTA 4J90A 3KZVA 4YQYA 4JBHA 1RM5A 4ZVVA 2C07A 2DT5A 3VZQA 2HMWA 5TC4A 2OO5A 4ZRNA 5IDYA 2C54A 4A5OA 3EDMA 1LNQA 5DULA 2Y0EA 3NYWA 1DFGA 5TX7A 1PJ2A 3EVNA 4JCOA 4K9DA 4INAA 3CMMA 2J5QA 1HZJA 3AFMA 1G0NA 4NBWA 1RYEA 3IOYA 1CJCA 1ORRA 1JVSA 3JD2A 3WTBA 4I1IA 4IZIA 4Z6KA 1EE9A 2V6GA 1SNYA 1A9ZA 5JFOA 4A73A 4OM8A 5JYEA 4N5NA 3TZKA 5G4LA 2DUWA 3PDUA 3WIEA 2P2SA 1V6AA 4P4NA 1NQOA 4JBIA 2I3AA 3C85A 1LSJA 5ER9A 4BO5A 2Y1FA 3L77A 3MJSA 4ZN6A 3JQGB 2AQIA 3I9NA 4LVCA 4WPGA 4BNKA 1NVGA 2OFPA 2OHXA 3GK3A 4FBGA 1IUKA 1I36A 1P31A 4GH5A 2B5WA 5L4LA 1CF2O 1HLPA 3G17A 5I8WA 2TMGA 4R1NA 1R37A 5A03A 1X7GA 4CL3A 1YBAA 3OEWA 5G0SA 4DPLA 4Z9YA 3EK2A 2X23A 2D3TA 1DIAA 3I4FA 1U1IA 4FC6A 2E37A 1T4DA 5JMWA 1GU7A 1QYVA 2R2GA 3GFGA 2PV7A 2HO5A 2DTXA 4HV4A 2PZMA 3O38A 4PFJA 3BMOA 4PLWA 4NFSA 4CMKA 3DBLB 5AXCA 3O8QB 3KSUA 1YQXA 2IEBA 4MVJD 3S1LA 4FOSA 1VRWA 2QYSA 1VJ0A 2VHXA 3BXXA 3GN2A 1EBUA 1HEUA 3JYNA 2BFMA 3RC2A 1BSVA 4RPJA 4BNMA 1XQ6A 1UH5A 2WD8A 1C0KA 2V6BA 1KYQA 1Y9AA 3ZU2A 1Y9EA 3K73O 4FB5A 5IXYA 4CR7A 2DBZA 1AE1A 2GN8A 4YT2A 2Y66A 3PGJA 2HUNA 4GLLA 3O26A 4DMLA 1E3IA 1JKJA 5DNAA 3PYLA 2VRBA 4CM6A 5KVCA 4CQMB 4XGKA 4XGNA 2J3HA 4MP8A 3WSWA 4MVJG 2O4CA 3W6UA 1HXHA 3ZW9A 2B0JA 1UDBA 1KETA 4RPKA 2A94A 3OJOA 3GH3A 1H6DA 2UUOA 4OOFA 4ZQFA 2NM0A 3E48A 2J6IA 2QX7A 3RCBA 3OFSA 1XSEA 5DCWA 2OGUA 1YDEA 3Q1LA 2CUKA 3OA0A 3L6DA 4JN6B 4XB2A 4JX8A 4W82A 1DIRA 4NR0A 4FFLA 4J2HA 4OH1A 4YT5A 2AG8A 3KETA 1SAYA 1T25A 4CMHA 1U2DA 5JDCA 5TRTA 2QZ9A 1YJ8A 3VTFA 1NQAO 3GDGA 4J43A 4CUZA 3MJCA 3WG9A 2ZIZA 3BHMA 3H9GA 5HBRA 1VPDA 3ZWCA 3UOGA 4Z0TA 2VT3A 2GRAA 4EW6A 3LT4A 1E1NA 2BRUA 2DC1A 3RFTA 3EZLA 3F6YA 3FPLA 3DONA 5THQA 5KOIA 4ZU3A 1FDTA 3F47A 3K2EA 5DT9A 5JAMA 1DAOA 2ZQYA 4QEDA 4II2A 4R9SA 3QA9A 4KQXA 2BFPA 2IZ0A 4BIIA 1ISHA 2O23A 4JK3A 4MVJM 3IKTA 2WYVA 1YKFA 3ZWNA 5CPFA 5JAQA 5JMPA 5I7SA 4UREA 2C2YA 4XRRA 2WDZA 4WNIA 5KNLA 2YHIA 5FFFA 1JA9A 1FXSA 1CYDA 4R41A 3LT0A 3ROMA 1GD1O 5A05A 4O0LA 5I9LA 4E31A 3BMCA 5BSGA 4JNKA 1OZAA 3S2FA 3ZHYA 4HADA 1V3TA 3HB5X 4DTIA 2VWHA 1DPGA 3GVIA 1W6UA 4F45A 2X86A 4MIEA 5ENVA 3U4HA 1K89A 3U4IA 2OMEA 2AW5A 1UXIA 3JQEA 3UH1A 1KS9A 1XA0A 1EDOA 2NTNA 2NVUA 1MGOA 3D7LA 4YBZA 4DREA 2DPHA 3B20A 4EYEA 4DL9A 2DUUA 1NHGA 4FFRA 1PZGA 2HK9A 2VCYA 3RBXA 5TJ9A 3CINA 3O03A 1DC5A 4PG5A 3QIVA 4ND5A 2BHLA 3TZQA 4AJHA 2B5VA 5G4KA 1LXCA 4YTEA 2V6FA 1PGPA 1ISJA 4U0KA 1Z7BA 4CLDA 4DBVO 4E5NA 4M1QA 2Y0DA 2C5AA 1Y81A 4AJPA 1B8PA 2EF1A 5TIIA 3OIFA 3OQ6A 3AM5A 5I9MA 1QG6A 1LQUA 2IZ1A 1QV6A 1ZH8A 5MDHA 4CV1A 4RZHA 2Y1EA 3CUKA 1PWZA 2D4AA 3DWFA 6LDHA 4PLHA 3OMLA 3VZRA 2EXXA 1P1HA 4IIUA 4B4OA 2EKLA 1J0XO 3TPCA 3AOEC 3AY6A 3I6IA 4MP3A 4P38A 4UVGA 1I32A 4U7WA 3KYCB 1PQWA 3RUFA 3WQRA 4MDHA 3ZWAA 3T4EA 4CM3A 4O6VA 2A92A 1CERA 3RSHA 3ZHBA 1I3KA 4BNNA 1EUZA 3ASVA 4FD3A 3ANMA 2YV2A 1E6EA 4KTVE 4JIGA 2P5UA 1BDBA 3K30A 5JCXA 2JAHA 3F4LA 1WZIA 1NHWA 3JQDA 4XD2A 2PLAA 1X7HA 3R6DA 4KDEA 1NX6A 5F3RA 1D4FA 4J1NA 4TZKA 2NADA 2WWRA 4BMSA 1V3VA 1X13A 3GRPA 2X9NA 2O3RA 4R68A 1HKUA 1M6WA 1W0CA 4JXKA 1XDWA 3DFUA 3DMTA 4HX5A 3UVEA 1E3SA 1YOVB 3JQ9A 3I9LA 4L8VA 1B7GO 2YV3A 3E9MA 4O63O 1O94A 4BNLA 2O3UA 2NU8A 3OJLA 2GD1O 5IN4A 2FR8A 3BMOB 1OAAA 2OZPA 3TFQA 3OBBA 4WCFB 3WFJA 2Q1SA 2LDXA 3F9IA 3PRJA 3TL2A 4XR4A 3H9QA 3WGGA 4P22A 1H9AA 1KVSA 4RVHA 4A0SA 1ZJZA 4Y6RA 2O3JA 3EC7A 3AUSA 1WDKA 4BO3A 1E7WA 1TA4A 1G0OA 1N9GA 1EUCA 4O5OA 1JAXA 1IZ9A 1VSUA 4WEOA 2VYVD 5DN9A 3KEQA 2BGLA 1MX3A 1ONPA 2FPPA 1V3UA 4EZBA 4ZQGA 4BUCA 3SJUA 4B8WA 3H4VA 1C14A 4H16A 4WCDA 1ENPA 2A9FA 1SEPA 1IB6A 1EK5A 4NK4A 4NFHA 2H9IA 4Z0HO 4J0EA 1H6AA 3L07A 4GX2A 2O3SA 4AJJA 4PIVA 5AQ1A 2BLLA 1E5QA 2B4QA 2HK8A 4BGUA 3UAGA 2IXAA 2ZATA 2JKVA 1TEHA 5L7WA 4PLFA 3OQ1A 2PGDA 5KTKA 1WNTA 3HN2A 3N74A 4W7HA 2ZB3A 2OP0A 5TT0A 4HY3A 2YJZA 5ILOA 4E6PA 1ZVMA 3DHEA 4XQCA 3CZRA 3W4IA 1PX0A 1O8CA 4NG5A 3PK0A 4E5MA 5DOZA 5T57A 3BYZA 4E5YA 4JJFA 2GDZA 3E5RA 3ZWOA 4QFCA 2C20A 2RHCA 3HFGA 4CLXA 4ZGWA 3KSZO 3ZGYA 2OL4A 2YFQA 3NJ8A 1RJWA 3NAQA 1XEAA 4MKRA 4UVDA 3GAFA 3ENNA 3JQAA 3TFOA 2YYYA 3GHYA 4UULA 2A35A 1ENOA 3EMKA 2O2YA 3BMCB 3E03A 3RI3A 4ZJUA 2GNAA 2FN7A 3D3WA 2F00A 3WOHA 2VTEA 4LSWA 4BV8A 5ITWA 1R4NA 2GERA 1EVZA 3OETA 3WMXA 4HFMA 3TRIA 1ISGA 4ZQBA 1Q7CA 1AXEA 1NR7A 1QSGA 2Y99A 4R69A 3DBHA 4JLWA 2A4KA 3HUDA 4BNXA 1YL7A 3Q3CA 4MVJP 2WD7B 4QO8A 1P1RA 3AUTA 1BXGB 3ITDA 2IYOA 4W6ZA 4WEQA 5TSDA 1MC4A 4B7XA 4BNUA 1RYDA 3F4BA 3AJRA 3DBVO 4GWKA 1TB4A 5HTOA 3QWBA 2CSUA 5DOVA 5G0TA 3UGKA 2YQ5A 2CVOA 5THKA 4H3VA 1T2FA 4R1SA 1NTOA 3ZV5A 1PZFA 4J7UA 1U4SA 2ZCVA 1KY5A 3FI9A 3JYLA 4UUOA 2VN8A 4RF5A 2CF6A 1H9BA 1NBOA 3GZ4A 3GF4A 3SJ7A 5GZ6A 1T2DA 3BMQA 5KJ1A 2RH4A 1CEQA 1U7HA 1DDOA 3OECA 3IMFA 1PGQA 3SLGA 5U1PA 4ND2A 1AN9A 1X14A 4Q3DA 3LYLA 1LX6A 4Z3KA 3HDHA 2Q2QA 3PXXA 4BB5A 2DBVO 4WK6A 1HRDA 1HE2A 1AUPA 2CVZA 3MOIA 4XQGA 5KIAA 1D3AA 4UUPA 2HRZA 3ADPA 3KTDA 4GX1A 5BSHA 1Q1NA 3DR3A 3R0IA 4YT4A 1GEGA 4I5GA 4D7AA 1WDLA 3GRKA 3VAZA 1FDUA 1KBZA 3WDSA 5JCJD 1BWSA 1IOLA 1PGNA 2WJPA 5F5NA 5C3MA 4R1TA 3NV9A 1YGYA 1DO8A 4QT0A 5COBA 3MJTA 5DDIP 2PKQP 3IP3A 4Q3CA 3BTOA 1VC2A 3DZFA 1U5CA 2NV6A 1NFRA 2X0RA 1U8FO 3O8QA 3R1IA 1CRWG 4HKTA 4AJKA 1Z82A 3W8EA 1ZJYA 4ZQEA 1I2CA 1ULSA 3RJ9A 1R4MA 1UZLA 3H5AA 3F5SA 4OSOA 4PZDA 5CHEA 2CFCA 3OIDA 1U5AA 2QG4A 4MVJH 4IDGA 2BF7A 2YV1A 3WQSB 4FFPA 4H7PA 4WLOA 1UAGA 2YHUA 2E48A 1U28A 4OHUA 3TF5A 5CDGA 1HWYA 1PJCA 2D1YA 1GYQA 5JDCC 4YPOA 4YT8A 4AG3A 4GPD1 1HYHA 3ZNNA 3HJAA 4NBRA 2JD2A 2PY6A 3JQBC 2IDZA 3ONFA 4JP3A 3HZZA 4FSHA 1XU9A 1CQIA 4B4WA 4JQCA 3EW7A 1P45A 5C37A 1YL6A 4LRTB 1DEHA 4I8XA 2X58A 4TRMA 1IY8A 3PWKA 4F3YA 4RPGA 3DBRA 2IRWA 3Q6IA 3DBLA 1JU9A 5IF3A 5A5FA 2EWMA 1KIFA 4M86A 4WJZA 3SVTA 5A4DA 3GNQA 1BVUA 2V6MA 2WEKA 5JC8A 2Z1NA 3AW9A 5L51A 1SMKA 2I65A 1JLLA 3PYMA 1BMDA 3GQVA 4XDYA 1I10A 1E1KA 3WGZA 2OUIA 3PDJA 5BSEA 3KV3O 1JDJA 3R3SA 5A3JA 2H5LA 4GMFA 4PLZA 4G65A 2BGKA 3S8MA 1HZZA 1D1TA 1T1RA 3JQ7B 3E18A 3PWSA 5AXBA 3AWDA 5JCJA 5TQVA 4D41A 2Y68A 3ZV6A 1M75A 3RFXA 4XYLA 3GR6A 4NJMA 4DBZA 1J49A 1FJHA 3H9JA 1AHIA 4IIVA 4RLHA 3GUCA 9LDTA 5BNTA 4S1VA 3ZNQA 1GPJA 1VL6A 5F1OA 2NNLD 2H1SA 3E9QA 4JJIA 1XHLA 3NGXA 3D4OA 1EUDA 3RUCA 4DYVA 2Y1CA 2GUGA 4N54A 3EVTA 2UVDA 1Z45A 3NDIA 4D0SA 3QVTA 3ZHXA 4TRNA 4AJ4A 4HFJA 3OH8A 4RF4A 4BO8A 4NFYA 4I08A 3L6OO 3O9ZA 3QE3A 4ZD6A 2HJSA 2C29D 3ORFA 4IZHA 4MKZA 4A7PA 8ADHA 1MXFA 3LLSA 1ZCJA 3NGLA 1W8DA 1LC0A 4IDAA 4IDEA 1PJTA 1S7CA 1DFHA 2GO1A 4D45A 4E32A 2O48X 4CMIB 1ARZA 3ZWWA 4EBFA 2DPGA 1KEUA 4JGBA 5G2OA 4Q39A 3VPSA 1YWGO 5GZ1A 4D43A 1QYWA 4R5HA 2E6UX 5HM8A 2AEFA 2NSDA 4QUKA 1Y7TA 5CEJA 3HSKA 3P5SA 1X1TA 3MTJA 1PGJA 5F5LA 4CLOB 2RCYA 2IZZA 3RFVA 2IXBA 2JD1A 3HWRA 2XXBA 5IG2A 1DC4A 4KWIA 2ZTVA 1A4UA 2VNSA 3NTOA 1N1EA 1UXJA 1DBVO 1ADGA 4BO1A 5FWNA 4R51A 3IIEA 4BO9A 2VUSA 5IZCC 5TGDA 2B35A 1YVEI 5FYDA 1LDYA 5CPBA 1I3LA 1LTHR 1ZO8A 2EW2A 2H63A 3RKUA 1HDCA 1I2BA 2AQKA 4YACA 3KYCA 1HE4A 3NDJA 4Z9FA 5EQDA 3BTSA 3L4SO 4L75A 4TWRA 2JFFA 4TVBA 1VKNA 1QR6A 1GY8A 5ER6A 4CMJA 4CLRA 5AVOA 1LDNA 4NBVA 3TN7A 4W99A 3V2GA 2BI8A 1D7OA 2Y93A 3AY7A 3FPCA 3B1FA 4BKOA 3FCOA 3AI2A 3I9OA 2I6TA 3N7UA 3A14A 2QQ5A 3DC2A 1C0PA 2I9PA 1H6BA 1OFGA 2LDBA 4TKMA 4RVUA 3DB2A 5MGBA 1HSZA 1OI7A 3AM4A 4J6FA 3GDFA 4HFNA 1QV7A 1DIBA 3MOGA 3GDOA 1YOVA 1MC5A 4YAGA 1ZMOA 1OMOA 4E21A 1LLCA 1KVRA 4YYZA 3ULKA 2PD6A 1O9BA 2EIHA 3FBGA 5DBIA 1B0AA 5DP2A 5KKAA 1GUFA 1XG5A 4M8SA 5EIOA 4ALJA 4BNWA 1XYGA 4DIOA 3GVCA 3PPIA 3C7CB 1E92A 1BGVA 1NQTA 3GGOA 4MO2A 3DZKA 3WIDA 5KCZA 3N58A 4CV3A 3QVWA 1JQBA 1SPXA 2ET6A 3ZDFA 3D64A 4LN1A 3X2FA 2NLOA 3INTA 1DXYA 4GSLA 3NKLA 4NBUA 4YEDA 3ENKA 4HNGA 4E0BA 1N1GA 3OJEA 3BTVA 2WYWA 3DFZA 1TXGA 1B3BA 4KUEA 4J1SA 3ICCA 1TVEA 3CEAA 4XX0A 4RO0A 4Y6PA 4LRSB 5T67A 4EJ6A 5H81A 4CR6A 3JYOA 1O0SA 4ZRMA 3AFNA 5GMOA 3INGA 4FN4A 3E5MA 1QLHA 3WYEA 3VH2A 1BXZA 4EI2A 2DU8A 4IJUA 4R4JA 3KYDB 5CDUA 3DBHB 4MVJF 2P4QA 2Q1TA 3DTTA 3GPDG 2E49A 1HYEA 4Q3NA 1V9LA 1YO6A 1D1SA 1E1MA 1VLLA 1N9GB 2VZ0A 2ZTLA 4EGFA 3VH3A 3OQBA 4BGIA 1DRVA 4LVUA 4DQUA 3FTPA 1NYTA 1P1FA 1Y8RB 3LVFO 1J4AA 2IYPA 2FMUA 3DZGA 4L4XA 1HT0A 3K8ZA 4TROA 3S55A 3FNGA 3B6ZA 1ZK1A 1EK6A 2DKNA 3GA0A 1AXGA 3D5QA 4KQWA 3IQDB 2Q1WA 2V7PA 1NAIA 5GY7A 5A1TA 4J0FA 3A9WA 4IDDA 2I99A 4RF2A 3ETEA 4BKPA 1YL5A 1E77A 3VC7A 4K26A 1MFZA 3KOUA 2X9GA 2ZCUA 3I9KA 1BVRA 2DQ4A 2X1HA 3ONEA 5I8ZA 4RLSA 4YAKA 5A5EA 2EJVA 4PVDA 5HS6A 1HYGA 1PZEA 5KJCA 3ZI0A 3OA2A 1GTMA 1SZJG 4GLOA 2CDCA 2JHGA 4Z0PA 1Z75A 3QWIA 4RQTA 1Y8QB 2D2IA 3ROKA 2GYYA 4LMRA 3JQ6A 3FHLA 2FP4A 4XCVA 4U6SA 4BQRA 2VWQA 4GL4A 1ZK3A 3V2UA 2BMAA 1KERA 4RVFA 3KSDO 2P9GA 3SLKA 1RKXA 3IDSA 4BO7A 1UXKA 3SEFA 1ZFNA 3FWZA 4BNHA 2JJYA 4URFA 4BMNA 4FC7A 2W90A 3D3WB 3U4CA 2FY8A 4Q3AA 4DIFA 4BKUA 4YJFB 5EL0A 3HFSA 4YCAA 1K2WA 1EDZA 1GCUA 1H93A 3JQGA 4RDIA 2IODA 4F46A 4TKLA 1B14A 2PKRA 1GUZA 2AQ8A 1ZXLA 3WSVA 5BSFA 4HP8A 1B26A 4CLEA 1K5HA 3ZNPA 3F1LA 4ZHSA 5CDTA 5LDHA 1R0KA 4O1MA 4C7JA 4J49A 3RC1A 3WLFA 5CDSA 4CJXA 3WBBA 3CTMA 1ZEMA 3GEGA 3RUHA 1XKQA 4OL9A 1I01A 4RPLA 1FF9A 3UCEA 4W4TA 3KRTA 2HCTA 4JJGA 4YB8A 1E6UA 4PG8A 4PRLA 1DIHA 1U8XX 3QWAA 3V1UA 2VHZA 3PLRA 5I9NA 5ICMA 4W7IA 4WLVA 3ZZNA 1Z7EA 5C7OO 1MB4A 3NT2A 4OO3A 4CM7A 2VRCA 3LZ6A 3ZHZA 3Q2KA 1ZKMA 1EZ4A 2GN9A 2HJRA 3A06A 2X0IA 4YRDA 2GZ1A 3MEQA 3M1LA 3OJFA 5HS4A 3PHIA 1T26A 2EEZA 4OXKA 3PQEA 3TQHA 4CUKA 5KJ6A 1CIVA 4MVJE 3PIIA 4E2XA 2X4GA 4D42A 3D4NA 3H9EO 3WGHA 1JW9B 3DL2A 4GMGA 3BHIA 4XYGA 1DB3A 4HFRA 3GMSA 1G6KA 3RD5A 1DOHA 1KC1A 2EGHA 4R9RA 4PG7A 3FR8A 3A1NA 3HE3A 2X6TA 5A3VA 3PQFA 2C7GA 3DOOA 4IMPA 1LSUA 1ZNQO 3UCXA 2YFHA 3HDQA 1I8TA 4LSMA 2NVBA 4BNZA 5CG2A 4ND4A 3AOGA 1F14A 2VQ3A 4XQEA 1PQPA 3T4XA 1EMDA 2ZJ0A 3SBOA 1C3VA 1WMAA 3QJ5A 1ZEJA 3CZMA 5KVQA 2GCGA 4NH4A 1EFLA 3JYQA 5F1PA 3T7CA 3AOEA 4B4UA 5IZCA 1I0ZA 1A27A 1TT5B 2FOIA 3KVOA 2VOEA 3AI1A 2D5AA 3DOJA 4EJ0A 4Z9XA 3VPFA 2DLDA 3TDKA 1PJBA 3TWOA 1LI4A 2J3JA 3KYBA 4OXNA 4Q9NA 3ZWVA 2GN4A 4NK5A 3KUXA 1NNUA 2XOXA 2C7VA 3K5PA 4E5KA 2G76A 1E0DA 1JKIA 4FJ0A 3PJFA 5JW6A 2EG9A 5IDQA 4QTZA 3G1TA 3ANNA 2ZKLA 4LMPA 4RL6A 3WGIA 4J7CA 3DHYA 3WGOA 1FMCA 1U4OA 2NWQA 1E5LA 3VHRA 3TNLA 5JXWA 2WE8A 2G0TA 4XQ9A 4BV9A 2AA3A 1EE2A 4YAJA 1K3TA 2NQTA 1LU9A 3LK7A 4RV9A 1HDXA 5CP8A 4CLOA 2EP7A 1UDCA 1ZMTA 4MVJI 7MDHA 1PQUA 3NT4A 2Q2WA 2JCXA 4GGOA 3IUSA 1R6DA 4D44A 3W6ZA 1DRWA 3ZNOA 3ETDA 5B4VA 4EUEA 1E7MA 3G79A 4WLEA 3DZHA 5TLSA 3DAFA 4CMIA 1MV8A 2HDHA 4B4VA 5L4SA 1T4BA 3Q2IA 4DQVA 3S2EA 3R3JA 2FSVA 3D3EA 1T24A 3PI7A 3QVXA 1AHHA 2VWGA 3GHHA 4R01A 3NUGA 3JQCA 1GQQA 3KBOA 3MCVA 3EYWA 1WPQA 5L53A 1ZSVA 2X5OA 1WZEA 1DAPA 3H2SA 3IL2A 3PTZA 1QP8A 1TI7A 2HLPA 4HNHA 4BL5A 1YB4A 2Q49A 4P4LA 1VL0A 3IP1A 2PTGA 1UR5A 3JQFC 4L73A 2HMUA 1K6XA 1SB8A 4CMAA 3IJPA 3OHSX 5JY1A 4AJ2A 1R12A 4WUVA 3DEYX 3ZWPA 4CM4A 3JYPA 4DLAA 3G49A 2J3KA 3P2YA 1U3UA 3UN1A 1BG6A 1WMBA 3L4BC 4DA9A 1F06A 4BQPA 4P8RA 2RH8A 4BNVA 1B2LA 3GGGA 3ASUA 4PG6A 3HDYA 4FR5A 1PSDA 2VOJA 2FZWA 2PH5A 3I3OA 4N5LA 3C1OA 4CM1A 1LDBA 4I5FA 1MXHA 1YQDA 3ETGA 3I23A 3GVHA 4RPHA 4YA6A 2GPTA 1VL8A 5IJZA 2BELA 5AXDA 5CG1A 1LDGA 4I5EA 2ZK7A 3DAPA 2OORA 4J1TA 3ROQA 3EHEA 3QV1A 5L9AA 1FDWA 1SB9A 3LC7O 1NWCA 3Q0EA 1A9YA 1DLIA 4D3SA 3DQPA 1LQTA 2Q50A 2FSSA 2I76A 2DFDA 1BW9B 3W4JA 4IS3A 1E3WB 4BO6A 1PS9A 4IJVA 1YS4A 2QHXA 1CDOA 4OGWA 1DC3A 1I3MA 3CIFA 1UUFA 3FNFA 4RDHA 4YQZA 5JSFA 5L7YA 1SCUA 1J6UA 1ML3A 4DQXA 1GYRA 3W8FA 4YWJA 1GAEO 5HA5A 2C0CA 4CQLA 4UVHA 1FK8A 3K92A 4C4OA 2H6EA 4JP2A 2Q45A 2XF8A 3VKVA 2D8AA 2HAEA 3QWHA 4R54A 3GY0A 4TZTA 4U6QA 1IYZA 3MZ0A 5LC1A 2BFOA 3LF1A 2OBYA 2E82A 2Z1MA 1Y5MA 4IXWA 4TQGA 1ADFA 4ZQHA 4A27A 2GR9A 5K6AC 5LDGA 2GSDA 1P0FA 5CEEA 3TZ6A 3QVSA 5DZSA 1WAMA 3VH4A 1YE3A 3K96A 5JE8A 3UFXA 3WFIA 4L4RA 3B70A 1EVJA 1EVYA 5A9TA 5BNFA 2PZJA 1E1LA 2C82A 3QRWA 1T2AA 2FR0A 2O3QA 1HETA 4RVSA 4WLUA 2Z95A 1B8VA 5T8KA 1C1DB 2VT2A 2EP5A 1IL0A 3VVBA 2Q1UA 3PEFA 3I9MA 3PHHA 3VDQA 5G0VA 4MVJA 2WMDA 4RVDA 4WE3A 4M54A 3WYBA 4KOAA 3V5NA 1HLDA 3FN4A 4YJHA 1OC2A 1E7QA 4HXYA 4L4SA 1HDOA 1GCOA 1W4ZA 2CD9A 1RWBA 4J91A 1GV1A 4IQ0A 4WOKA 4WLNA 3C7DB 2DFVA 4QQRA 4J4HA 4BNFA 2E4AA 3ZWMA 4BNIA 1I30A 2BFAA 3WBFA 1HDZA 4B3IA 1GV0A 4D0RA 5JY6A 3C8MA 2W2LA 1GPDG 5C7IO 4CM5A 2B4TO 2Y0CA 1GYPA 4AJLA 1Z6ZA 4GKBA 4FGWA 1PJ4A 4QFDA 3CH6A 4XGIA 4ZA2A 5K0ZA 3K6JA 3MJ4A 5A04A 5ICSA 1UJMA 4TMFA 2B4RO 2W8ZA 3HB4X 4K6FA 3PQDA 3NTRA 2GZ2A 2O50A 4LCJA 1H6CA 3JQBA 2YQ4A 4P4GA 4BNYA 4UEOA 1LDEA 1I24A 2UDPA 1WDMA 4OQZA 1DC6A 4BKQA 3C24A 2JL1A 1ZBQA 3GG2A 4FJ2A 2Y1OA 1KOLA 3JQ8B 3QW2A 1KC3A 1QYDA 1NQ5A 4FFOA 1B3RA 2VZ8A 2OXIA 3B1KA 4PLTA 4U0JA 4WCFC 3TJRA 1Y8QA 4PLCA 1R0LA 2HK7A 4LW8A 1JTVA 2DBRA 4FIZA 4IUYA 4OKIA 1BTOA 1C0LA 1R16A 1QLJA 4AL4A 4IXTA 4M55A 4GVXA 1P9LA 3LF2A 2P91A 4I9HA 4D46A 4A10A 3L9WA 2ZYDA 4IY1A 1P77A 1MP0A 3IC5A 4J9UE 2O7SA 2GASA 4DPKA 5K6AA 3LT1A 4XEHA 2FPIA 3COSA 1IZ0A 3QP9A 1WXDA 5T64A 4YAIA 5KVSA 3O4RA 4BO2A 2HMVA 4YJDA 1DLJA 1E6WA 3QY9A 1EBFA 1Y1PA 2PR2A 1E7YA 4QXMA 2FRDA 2ZTUA 2AE2A 4XIYA 3GVPA 1F12A 1LRLA 1QYCA 3WWZA 3LC2O 5EERA 4D3DA 4FS3A 3TSCA 4NIMA 3ON5A 3RUIA 5COQA 2BGMA 5HRUA 1HDGO 1ADCA 1K6JA 3VKUA 3EZYA 3E82A 2X22A 3GNSA 3M2TA 1Z73A 3H3JA 1ZSYA 1KVUA 5TJHA 4ITUA 1EFKA 3VDRA 1YBVA 4J2OA 5G4KB 3I83A 3ZWXA 4E2YA 4BMVA 4L9RA 4GX5A 2G1UA 4HUJA 2DTEA 2BKAA 3EGOA 3GEDA 3SC4A 4YR9A 2IEDA 5L40A 1U3VA 3GPIA 3AM3A 4DLLA 2X9VA 4R3WA 4ROSA 3ZWBA 1N2SA 1SC6A 1KEPA 3A28A 1CETA 3VPXA 4N18A 1N7HA 1O5IA 3RUEA 4XB1A 3DMTC 1U7TA 5C5IA 1M66A 2EV9A 3JSAA 5B37A 2JFHA 4HBGA 5BQFA 4IDBA 2WTBA 4IGEA 4TSKA 4BB6A 2X8LA 3L4BA 3HHPA 4ONEA 2OP1A 2EHDA 4WLFA 5F21A 4BVAA 3HN7A 1X0XA 1NFFA 1PJQA 1BXKA 3EUWA 3OF2A 2UYYA 3OSUA 3W4KA 1D8AA 2PD3A 3BMNA 3HADA 2QRJA 4Y67A 4AJOA 4CMEC 4J16A 1GR0A 4KUGA 3H65A 3GT0A 1EQUA 3AY3A 3GFBA 3K2BA 4GWGA 2W98A 3BZUA 4J9VA 2J8ZA 3LSYA 2O7QA 2VRCD 2JCYA 3H2ZA 4J3FA 4IJWA 4GSKA 5AOVA 3UXYA 1PWXA 3QWFA 1X1EA 3U4DA 1ZW1A 2R00A 1E3EA 3ROPA 4LGVA 1ENZA 4DLBA 4FQ8A 1DRUA 2PZLA 5EQFA 3WWYA 3RIHA 1M76A 1NWHA 3D4PA 3JD4A 4RF3A 1YJQA 3JTMA 4N5MA 2G5CA 3P2OA 3WMWA 4K1LA 2BI7A 4DC1A 2QRKA 5JNLA 2IE0A 4ALLA 1A4IA 4B8ZA 3M2PA 1Q0QA 3EAGA 1P0CA 2VUUA 4NDNE 3AI3A 1KEWA 5JLAA 3AK4A 4IJKA 1ZK2A 3WGQA 1BDMA 4GGPA 3MJVA 4E2ZA 4UEKA 2XXJA 3VZPA 3C1TA 4WCFA 3FNEA 4YRBA 2OOSA 5COAA 2P5YA 5GZ3A 4JBGA 3GVXA 5JDIA 5DP1A 3UW3A 3ST7A 4ZICA 4NU5A 1VJ1A 2NTVA 2UV8A 3I5MA 5CEFA 1SO8A 4OMUA 4WOJA 2F1KA 3WYCA 1PGOA 1JWAB 3WNQA 3BAZA 1OC4A 1ZUD1 3JQ8A 5HWSA 1NFQA 3PZRA 2AQHA 2PNFA 2B69A 3MJEA 2O3TA 2PK3A 4OYRA 3INRA 4CUJA 1MG5A 4CM4B 1YXMA 1ADBA 1TT5A 1XR3A 3S2GA 2Q99A 1GFSA 2CNBA 3HNPA 1H5QA 1JAYA 1NM5A 1QRRA 2DAPA 1C0IA 1H2BA 3V1TC 4XA8A 4UUNA 1XELA 3UCFA 4OAQA 4RZIA 3FD8A 5ILGA 3E6AA 3GAZA 4BNTA 3L6EA 4MJLA 2FZEA 2VHWA 4B7UA 2NU6A 1DIGA 2Q2VA 3I6QA 4GAEA 1XWFA 1C1XA 2HU2A 5AYVA 4E2WA 3NDRA 3UF0A 4KWHA 4IGFA 3C3XA 2I67A 1W73A 1PL8A 4QO7A 3JQAD 2CVQA 3ZW8A 4J7XA 4OJNA 2RHRA 3PHGA 2Y67A 4BNJA 2X0JA 4M49A 2HSDA 4FGSA 2I66A 2PA3A 1YDWA 1JKFA 2VYND 2VUTA 1E7RA 2QIOA 3LDHA 2I3GA 1DJQA 1Y5RA 5A06A 5J23A 2FR1A 3KEOA 2NTJA 1E3WA 4L74A 1GUYA 2P4HX 3NJ4A 1Q0HA 3CXRA 3DDNA 5EPOA 4XJSA 1LBEA 2CDBA 2EW8A 3CPSA 2VZ9A 5TS3A 1XCBA 2G82A 2VHVA 2J3IA 1O95A 2AG5A 1IPEA 1B8UA 5A9SA 4MPDA 3IJRA 1PU2A 4OQYA 3PJDA 3GN1A 1F8GA 3U9LA 4CV0A 1KVQA 2PD4A 1JVBA 3ONDA 1E3JA 5FEUA 2B83A 3V8BA 1F8FA 3H3FA 4OSPA 4FFMA 5JAZA 2CY0A 1GQ2A 5CDYA 4NPCA 1PTJA 2NACA 3VPGA 1LA2A 1WW8A 3K31A 4PCVA 4PG4A 8LDHA 3JV7A 3RBVA 1MUUA 4ALMA 4PZEA 4CMCA 3FSRA 1WVGA 5ENDA 2POQX 4YDRA 4PN3A 1NASA 4TRRA 4AFNA 3GEMA 2VTDA 4BO0A 2JD0A 1PZHA 1C1DA 2W4QA 4WNCA 4CQLB 4E30A 3DZBA 5JPIA 4CM8A 1PIWA 2AE1A 2JFGA 1NPDA 3VPHA 2YUTA 5JS6A 1OOEA 3RVDA 1VM6A 4PLVA 3UUWA 5IDXA 3DBRB 2YW9A 5KJEA 2O2SA 5A9RA 5IDWA 3GMDA 3W1VA 1VE9A 2DVMA 2JCVA 1XLTA 1DHRA 3CKYA 3L0DA 1JN0A 5A02A 4M89A 4XYEA 1VSVA 3ICPA 1RM3A 3FBTA 4LISA 1H2HA 3H6KA 4XZ3A 5B4UA 1R4MB 1HE3A 1L7EA 4PLGA 4W9NA 4PVCA 4DXHA 5B1YA 4XKJA 3GLQA 3ZH2A 1LLUA 5L95A 3PHLA 1NP3A 1UAYA 2OBNA 4ND3A 2X5KO 3H7AA 4UVEA 1U9JA 2AEMA 4AVYA 1BW9A 1PR9A 3DAGA 5T8KC 1BRMA 3D5TA 1RPNA 3PZBA 4LK3A 3WTCA 1GL3A 4AJEA 3B1JA 4NHEA 4B3HA 1GADO 6ADHA 4NJMB 4TVOA 5H82A 2WSBA 1ONOA 1P74A 1Q7GA 3HQ4O 4S3MA 4BOYA 5FI3A 5LCXA 2DM6A 4Y98A 4E3ZA 1ONNA 4B79A 2EKPA 5ITVA 2AHRA 5TNXA 2C59A 3X2EA 5U9CA 2DBQA 3QHAA 2FPGA 3P7MA 4FJ1A 4RVGA 2EKQA 3ABIA 3I52A 1Y6JA 1EVIA 4FOOA 2G17A 4IDFA 1ZZEA 1IPFA 4R3NA 2AXQA 4EDFA 1ISFA 1R0SA 4DMMA 3JQAB 1NVTA 3M1AA 4IBOA 1RM0A 3ZCXA 3I1JA 4G5HA 4DUPA 2FHSA 4R1UA 2P9CA 4AJNA 1LC3A 9LDBA 2EGGA
chains in the Genus database with same CATH superfamily
1RD4A 4FFWA 4PYJA 3N8DA 1M2NA 4AKEA 1GTG1 2AMFA 5JDIC 5JZMA 1N9ZA 1UDAA 1PJRA 5I7OA 4P92A 4HQFA 1ZXBA 1NKTA 1G17A 2NVWA 4KPUA 4PSUA 5CR9A 1S2LA 2YDXA 3WKEA 3ZGZA 1KI6B 4M0MA 4BZWA 2ZYAA 5E1MA 5FLKA 4OLBA 5JBIA 4Y2VA 1VA5A 3FGPA 1Z8NA 2ENUA 2WFLB 1CKEA 1K6IA 4MOWA 4XGRA 1U1DA 4UM8B 3UKDA 3WJ7A 3R4VA 3HEMA 1Z5PA 2AX3A 3AFHA 1PFUA 5AESA 2AOXA 4PONA 1APBA 5DX1A 1HO3A 2HKIA 3RRJA 4AX8A 1CG6A 5CX1A 1OWOA 1TKRA 1P44A 1VB3A 4N8EA 3S40A 4ZAVA 2ADFA 4TLLB 3B78A 3SWWA 1VZ2A 3S99A 3TRDA 3W6NA 4EFNA 4YXFA 1P7PA 1S6YA 3RU9A 1F6DA 4GI2A 4JYCA 1A69A 3MG9A 1LPOA 3OSZA 4GX0A 4NAVA 3USCS 4II3A 2SCUA 3HWWA 4A8JC 3PEYA 3QKUA 2P68A 1Z29A 4BWFB 5HIAA 4YJGA 1LVUA 4OPMA 4EF4A 4EZEA 4YP5A 3E3MA 2LIVA 4FVTA 3AW8A 4WKCA 4BE4A 4RJTA 1YACA 2BKXA 5FADA 1JJ7A 1EQ2A 1QGZA 1IHPA 2PJUA 1RQNA 3ZX4A 2WUWE 3MLEA 3TJZA 3VTZA 7ADHA 4FTWA 5G0UA 2QL9A 1CFJA 1F2TB 4F60A 1NYLA 1DRJA 2NQ8A 4FONA 1PFVA 3S8EA 4GM1A 5C7LO 3AF5A 3DKKA 4QREA 1RKQA 3ZU5A 4X20B 5LYYA 2PRYA 2FN3A 3C15C 1D2CA 1SBCA 4NE7A 3RIYA 2NU9A 4DLNA 4ACAA 1ZVJA 1GKKA 3G9TA 3KXDA 1U94A 4IQ8A 5LP6C 1YRBA 4O4JB 5BW4A 2ZM5A 1UK9A 2RAVA 4BZQA 1M54A 3A1TA 3VJLA 3L7YA 2FPKA 3COPA 2ZETA 3KJHA 3O90A 4TMXA 2J45A 1VG8A 5BSVA 1ITZA 5HOEA 1GZ5A 1KEVA 3NX4A 2Q8NA 1GCIA 4R0VA 5BYBA 3ANYB 1CRQA 2HMTA 3OP1A 4LC1A 3KQKA 2VHYA 2XSZD 3RSCA 4MQLA 4BUJA 1O6GA 1Y5IA 1UP4A 4GPAA 4KVAA 2R6JA 2AEJA 2PS1A 4HVTA 3S1AA 3D54D 1LSOA 1TEZA 1XAHA 3GD7A 4LYHA 5EMHA 3ZOZA 3KT0A 1QGUB 3WV4A 2PQ6A 2PX2A 2C5FA 2E18A 2JPDA 2YV5A 2B1JA 4OB6A 4YC7A 3Q5EA 1VYVA 1YH3A 3KM0A 3SAJA 3WNVA 1LF0A 2VAMA 2W2PA 1E0SA 2W22A 3DLCA 4JJZA 3ZQKA 4BKRA 4D8XA 2M6SA 2QRLA 4IMRA 5BSKA 4RH0A 3MUFA 4N3BA 2F48A 1DSSG 3WHIA 4ZCMA 1RRVA 3U5TA 2ABWA 1QH1A 2XA1A 3VI3B 4HI0E 3WLMA 3ACCA 2M98A 1GAQA 1WV0A 3UICA 4ZAFA 2ZU6A 2B36A 3TR6A 3RV3A 2ZWMA 4IAOA 4DUGD 2J9XB 3CISA 4MV6A 4M0LA 2CL0X 3NBKA 2G0AA 1CR1A 3FZNA 3RVLA 1Z0AA 2WIGA 4KE6A 1U0RA 4MMYB 2OFFA 5FWXB 3OCZA 5A3RA 1GU0A 5ALEA 3VBCA 1F7VA 3TKYA 4B1FA 5DLEA 3M34A 4L6IA 4WUTA 1G8SA 1C3JA 3DKPA 2ZYGA 2CF5A 4WECA 1FQKA 4H3HB 4XE5A 2D0OB 3TCXB 3C1AA 1OA0A 4MP6A 1VKOA 1T0PA 1EJBA 3QBEA 1U11A 4PHTA 3U31A 1P1JA 5KNCA 4ZOLB 5HKLA 4RYDA 4W6QA 4Q00A 4RMIA 3KVYA 3ROFA 3ITKA 3Q1KA 2LTAA 2CMDA 5FP0A 4MEJA 1X0VA 1QF6A 4RORA 1SUBA 3LECA 1NPYA 3UMVA 1SXQA 3OLCX 3GGPA 1V8ZA 4KAAA 5FF9A 4F04A 3CLTD 1W9MA 1Z5VA 2UYGA 1RFLA 1SK9A 2ZJAA 3A9RA 3JALB 3CSDA 4JOCA 4NE2A 1DV1A 5H9VA 2YRFA 3SFTA 3ZVKA 1UBNA 2DPXA 4PBRA 4B7ZA 1NXQA 4R5MA 3HCBA 2G4LA 4F3NA 1YQGA 3OE5A 4U1RA 2ORWA 3KG2A 1Y7PA 3LLVA 3SXPA 3ZI7A 4W5RA 3RUAA 1P91A 2HNAA 2Q9BA 3N8GA 3ZBUA 1XTKA 1SVSA 4U3JB 1VGQA 4Z3DA 3AVXA 4QTXA 5GTDA 2ILTA 1HDRA 2PZKA 2W71A 1KI9A 3KDAA 3PICA 4O3FA 2PAFA 1IY2A 4G5GA 2I78A 5CJ2A 1U6IA 1UAAA 1W5BA 4B35A 1A1VA 4KDFA 1FTWA 4KPYA 1R50A 2ZQZA 5B12A 4P6VF 5A5GA 3AONB 1RJEA 3R8FA 1L4EA 4UARA 4R16A 2XUZA 3JSXA 2HD4A 3EEIA 4EKNB 2P41A 3SHFA 4MSUA 4DV4B 1OHHA 4KXXA 1NI5A 4WK0B 2O52A 3TAXA 2DETA 1SEVA 1TW3A 4OD0A 4OKNA 3STWA 5KDDA 2JAPA 2WD9A 5FWAA 1E2JA 1L1FA 1ACLA 4OHFA 4AIRA 3A9TA 4WASA 4OFBA 2XB8A 4ALIA 1BOFA 1ORTA 2ZB8A 1YB1A 5KYWB 4W63A 1DCFA 3LQQA 1QOQB 1HSOA 3N3AC 1E7SA 5I45A 1PJLA 1W88A 2B37A 1NMZA 4IDCA 5AJTA 1I33A 2WP8J 1D4AA 4LNUA 1GQYA 3O47A 2AI2A 4JT2A 3SQNA 1RBQA 2ZRIA 1F0YA 5FV4A 2F17A 2OCLA 2QW8A 1Y6FA 4PXYA 3FPBA 1T8TA 1WJGA 1K7EB 5K9ZA 3GLIE 4HRYA 2RGAA 1CU1A 2D0PB 1QYXA 2GEDA 4JUDX 2Q6KA 1TGYA 4M6WB 3DXYA 2PGLA 4CMGA 4E5PA 1P1KA 1F4LA 1Q6YA 1ZWLA 2R7NA 3HDJA 4C89A 5BWOA 1N2CE 4LWOA 4DFDA 3T5MA 1XZLA 1P9RA 3GC6A 3IAHA 3NTQA 2FWJA 2QUIA 4G09A 4AY2A 3EXHC 1PBTA 1LLQA 3F3SA 3TPFA 4EPTA 4JYPA 4DB4A 3SVZA 5J43A 4B6JA 1LFDB 5IN5A 3LPLA 4NQZA 3LBNA 4C0LA 2CC2A 1U28C 1RP7A 1A88A 4JODA 3DTYA 3RNLA 2JLQA 1ZS9A 3FYDA 2NXEA 4EHKA 2Q0HA 4G97A 2PKXA 3NBMA 1QG0A 4IF6A 5H83A 4F84A 1OWMA 4M60A 1N8SA 3QNUA 3HI4A 4F86A 3P0JA 1R15A 4MYCA 3VTKA 1SXJE 4JJ4A 5F51A 4MLPA 1RYHA 4PO3X 4YAUA 1XZGA 2J7PD 1E8MA 2QW1A 4FYWA 1N2GA 4RSRA 4YJGB 5K05A 4G0ZA 3S2UA 3KHUA 2G36A 4U5XA 4OHOA 2NVUB 3H9UA 2PZEA 4DLXA 3RSSA 2SBTA 3PD7A 1X80A 1VJRA 2BCGY 3C39A 3KUKA 5C5CA 1INLA 5KWEA 3BWBA 4F85A 4UHBA 3BHJA 3TLKA 1NOJA 4TQUS 2PO5A 3AL3A 4G67A 3V7NA 5KJFA 1HNNA 3RC7A 1YIAA 1CUCA 2OCDA 3GFPA 1XRLA 3L7DA 4U2BA 3EIEA 4XRGA 2H2WA 5KWSA 3ISVA 1UMBA 2X76A 3SU8A 3MJHA 1N4AA 3OMWA 1SHJA 1U4NA 3UKOA 1ZUNB 3EZ7A 1RMYA 4HXEB 2AJBA 2ATIA 2Q4EA 4DUZB 1GDHA 1EEHA 2XMCA 1J8YF 2IQ5A 3AZOA 4CM8B 1VGVA 3MWDB 5F77A 1FVFA 1L5QA 2EDAA 3ADCA 1LF5A 2OCBA 4KBGA 4B6FA 3EY4A 3MWEB 4E33A 1FMTA 3GBVA 2CBXA 1FUIA 1NSYA 3LAWA 2OZLA 2PBFA 1ULUA 3AILA 3IIKA 3LNTA 3PFFA 4NESA 3FFXA 3RB8A 4AY3A 2D59A 5BR7A 1XZQA 4KRYA 2VF5X 5K3EA 4MQUA 1PUJA 2QAJA 2RIRA 1IHYA 2XYGA 3WJAA 4QECA 3PC8A 3OY7A 1BNCA 2YX1A 3AF4A 2EFGA 3VAAA 3LA6A 3CG0A 1WLYA 2AL7A 1D03A 5JSUA 1RJ9A 4K6CA 4KH0A 2WZQA 4GKVA 1U2GA 3ZDDA 3WX0A 3K9QO 3ZD7A 4HJRA 4LJYA 2JDIA 4LRQA 4P98A 3ZCTA 2H1WA 1V4NA 3ZN2A 1SUWA 1UP7A 3VYTB 2RBEA 1FDSA 3BFKA 3CRMA 3SC6A 1L9XA 3UFBA 4IM7A 2FJUA 1SCNE 2VPPA 2CMKA 2FF7A 5FUVA 4DVJA 3GLGE 4FKBA 1P3DA 2A8YA 2DQYA 4ARCA 2BD0A 1GZ4A 3TM4A 1HDYA 3S2IA 4ZV9A 3DMNA 4P3KA 4PWZA 3NQ41 3T5DA 3LGXA 5JVDF 1U7PA 2QS9A 2RG1A 2ZI4A 2H4WA 5K3CA 3PKJA 5JO9A 3PWZA 4IDQA 3VO8A 1TT7A 2BAGA 2NZUG 4KAXA 1G7TA 1DV2A 2GA8A 2QV7A 4H31A 2YHAA 3GGCA 2Z9CA 1MJGA 3KCQA 3SM9A 4FW8A 4KFSA 4BGVA 1BE1A 1BXGA 3NHKA 3WYNA 1GZDA 1GPAA 3QEOA 5TF4A 4PYRA 1TYAE 3KKMA 3L18A 3IDZA 2BSXA 3AIMA 1AZTA 1VMKA 1PI3A 2P78A 4LY6A 4I99A 5B37A 2GOYA 2J6HA 2AJDA 2CK3D 4HEA6 3W90A 4B3JA 2FPMA 5B3LA 1H94A 1YR6A 4QM6A 4MWBA 4MRMB 2BY4A 4P3NA 5DTMA 3FOEC 1OX6A 3AVWA 2WM8A 1L4KA 3P32A 4AYXA 4EUFA 1AH2A 2IY8A 2R62A 5A4IS 3M6WA 1U5BB 3UMCA 4NU8X 3EFOA 4D4HA 1MA0A 4YX9A 2YS6A 1IMJA 1PJ3A 3CKKA 1GGNA 2TMYA 2HOQA 3OFVA 3VVCA 4EMSA 1XIVA 3DE0X 3MCUA 1V96A 1U0EA 2B8TA 2P7HA 3LT2A 5IAGA 4QUAA 3T3PB 4CMEA 1XGKA 2P4EA 3PYXA 2RJOA 2XE4A 3ZDQA 4JLNA 4CIDA 2VAPA 2HTFA 3MINA 5KKCA 1L4NA 4K0RA 3BIXA 4US0R 4S24A 3U7QA 1Y3IA 2V45A 3JASB 4JR0A 4LZJA 4CU2A 1N8KA 1MRSA 3Q8WA 1BD4A 2PJZA 4KPGA 3HCNA 3PRHA 4ND8B 5T6BA 3R7FA 4UDYX 4B2PA 1DC8A 2UAGA 5C53B 1EDEA 3L6RA 4G26A 1EI9A 2FRXA 3ADOA 3IR5A 1ZI8A 3IS3A 1E94E 4Q82A 2XCQA 5AKKA 5C3UA 5CX1B 3V2HA 3RC9A 1UFQA 4ZEWA 4G1EB 3K6SA 2B7BA 1FFCA 4OTZA 5FOWA 3GZNA 2V59A 5DISB 2O8DA 1LDMA 1S2IA 1OSNA 4B3TB 5IMBA 4J0IA 5K0CA 3GRYA 4JBHA 1MC8A 3L1HA 2G71A 4B80A 4FR2A 2OO5A 2HL6A 1V7PC 2C54A 1ZY2A 2M32A 3GZJA 4BZXA 4QNRA 3NYWA 1DFGA 1K0FA 3RS3A 1RAHA 3EIQA 4HWOA 3RREA 3L02A 1ODCA 3HZHA 4JCOA 1CJMA 3SZMA 4BX2A 1MV5A 4NBWA 3DZCA 4ZKDA 1NM5C 3IOYA 1CJCA 1JVSA 5EJIA 1S02A 2OGTA 3QOYA 4I1IA 1EE9A 2V6GA 3CXUA 5JFOA 3PD1A 5JFTA 4OM8A 5JYEA 4N5NA 3TIFA 5G4LA 2H85A 3PDUA 1PQ4A 2P2SA 3AQ4A 3H84A 4URYR 4OB8A 4M9RA 3KAPA 1NQOA 2JNWA 3N2KB 2IHVA 2Z0MA 1AMNA 1M73E 2I3AA 1UKBA 1LSJA 4G4JA 5CYFA 1TM2A 2Y1FA 3L77A 3MJSA 5HE9A 1KEKA 5J2TB 3FYUC 2E85A 2J3LA 2AQIA 1DG9A 4S35A 1UJBA 1NVGA 2OFPA 3LPDA 3UT0A 2QRQA 1I36A 1OGIA 1NP7A 1XN1A 2W2MA 1P31A 1RKVA 4AN4A 4DIEA 2QN1A 2O5EA 1O3YA 3DDUA 5HBGA 4LUCA 1U63A 4R1NA 4UBKA 2ZIAA 4RKRA 1RXSA 2GKGA 3OEWA 1FBNA 3NOOA 2BGUA 1QO9A 3FDFA 1UZUA 3NHMA 1BMQA 4P0TA 3HPQA 5AKZA 2PZGA 5DX8A 4DPLA 2NYAA 4PC6A 3FE2A 4RVOA 1GU7A 3HJRA 4MWOA 3GFGA 3M81A 4RK1A 2PV7A 1QO0A 1JXOA 2FG7C 2HO5A 2EARA 2XB9A 4OXXA 1MNQA 4MKFA 3OHMA 1JH8A 4C7XA 4EBBA 1RYNA 5K09A 1QIGA 1T13A 2KHZA 3AO0B 3BMOA 2BONA 4NFSA 4ZVTA 5AXCA 2VCHA 4HRAA 4QFBA 1G8PA 1JNXX 1GN9A 3WK4A 4MROA 3NEYA 1YQXA 4PCLA 4QT4A 2NXJA 2O1WA 4ZT5A 2WIJA 1D2GA 2VHXA 3KPUA 4B3SB 2GEJA 2P9YA 1HEUA 1C8VB 3JYNA 2R0QC 2ONZA 1X1AA 3L43A 1IC6A 2H92A 1TUGA 3A9VA 4IP0A 4Z1OA 1ECGA 2CXNA 2DFTA 2V6BA 4WDQA 4RTMA 1KYQA 1QPZA 3ECSA 3S27A 2IHJA 3LIPA 3ZU2A 1Y9EA 4ENUA 2I62A 4FB5A 3MWDA 1GPKA 2DBZA 2D1QA 1AE1A 3Q88A 4YT2A 4GLLA 4RD0A 5E8RA 3C6KA 5JNVA 5EKXA 1UBOS 4P35A 3OM0A 1MRNA 1WDTA 1E9RA 3ZLTA 2QB5A 4NCJA 1JGTA 4CM6A 5KVCA 4YREA 4JKYA 3W6UA 1G291 1HXHA 3JWGA 4E4RA 4TOIA 1DKQA 4LXIA 1KETA 3EJWA 1I7QB 4WL0A 2A94A 2NSJA 3OJOA 1Z3CA 2RAUA 3EUEA 2Q5QA 2O07A 2YMQA 4ZQFA 3X43A 1GG2A 1R9JA 4CDMA 1T9CA 1FA9A 4OUDA 4RABA 1HM5A 4C0KA 2F3TA 4JOBA 2FWAA 1KYXA 3NAGA 1YDEA 1E18A 3Q1LA 1W1UA 2CUKA 2GAAA 1N0UA 4HWPA 1LH0A 4KIFA 2EKDA 4D4LA 4UTRA 3EGXB 4MRMA 2W6QA 1Q14A 4NEGA 1YIDA 4J2HA 5ICCA 4RTKA 4TQ9A 4OH1A 3I05A 3KETA 3AUJB 1G2PA 3C4QA 1SAYA 4MR9B 2FX5A 1MW8X 5ENZA 2RGGA 1R27A 3IXLA 1UL1X 2B8WA 2BFCB 3R77A 2FPLA 2XDQB 3GLKA 4ZWNA 3WG9A 4IEEA 3F73A 2D7CA 4FYMA 1FU4A 2AG6A 2PMFA 2YWEA 4LE2A 5KAMA 2WWVD 3UOWA 3UOGA 3WL5A 2Q0SA 2BRUA 2DGDA 2OD2A 1M2HA 2YXNA 1T35A 2FZCA 3F6YA 5KOIA 3RYFA 1KZ6A 4JXZA 4NMWA 1AKWA 4P93A 3F47A 5DT9A 1U04A 5JAMA 3R7DA 5K3BA 1QX3A 2J33A 3P9SA 4QEDA 5TMDA 2JJ2D 3HCAA 4R9SA 1E62A 4BIIA 1KARA 1ISHA 2FRDC 1XU4A 1DJMA 4LFBB 2CNOA 3GXOA 1P3JA 2WYVA 3MJDA 5AVUA 3D8BA 3LBYA 1T5HX 4P31A 1LWNA 1NVEA 2C2YA 3PPYA 3EVAA 3PDIA 4GBMA 1E3QA 1G9TA 4K9NA 3EFOB 4WNIA 4EMTA 4FXOA 1RJDA 4R41A 2F7SA 5BSGA 1UOQA 1XTRA 2CZGA 4OGLA 5FH9A 3ZHYA 5FTLA 2O19A 4FHEA 4IG4A 1V3TA 4LOIA 2ANCA 2QUAA 2W6JD 1VBMA 3RABA 3EDYA 2Q5JA 1DPGA 3CKMA 3GVIA 1H2XA 2LVBA 2W00A 5E6RB 3RLFA 4EO9A 2X86A 4R84A 1AG9A 3FTDA 5ENVA 2EP8A 1K89A 1SUPA 2D2VA 5E6SA 1C7JA 3B6JA 4Z1MA 3JQEA 3DDHA 2NVUA 5EFOA 1GARA 3D7LA 3LRPA 2BZ1A 2DPHA 3NTUA 7AT1A 1CS0A 3N53A 2Y0PA 4EYEA 1WCXA 4DL9A 4Y0AA 1NHGA 1RWKA 1W85A 1OLSA 2ATXA 4FFRA 3K71B 3W1WA 1SCJA 4KXFB 5H70A 3RBXA 5TJ9A 5IJXA 4MI6A 1DC5A 4ND5A 1T3SA 4QKQA 3FM9A 3K0BA 4N6GA 2B5VA 3FRHA 3FYHA 1ZIPA 4OA8A 1G5HA 4X1IA 1ISJA 4ZCPA 3IXQA 4X0EA 3K4HA 1RLTA 1WS6A 2VJMA 4DBVO 4Y9RA 3UJNA 4M1QA 2Y0DA 2C5AA 1II0A 5J59A 4RTJA 4PSVA 5HZHA 1K6EA 5EKUA 3AKCA 5KAPA 1D1PA 4F8JA 4WZAB 3T7KA 1JUDA 2Y4NA 2IHBA 4IWYA 2RK3A 5M04A 1X86B 2IZ1A 3A6GA 4Q4HB 1QV6A 1W5SA 1ZH8A 4TS4A 4CV1A 3Q3GE 4RZHA 4V0RA 3ZQ6A 2AYYA 3LL7A 4ZVRA 4Y7CA 3DULA 1STOA 1ODJA 1P1HA 1DAKA 2JKZA 2EKLA 4MP3A 4MUKA 3I6IA 1QIEA 1WW3A 2HHCA 1J07A 4Q16A 5ELLA 3KYCB 2V8OA 1PQWA 3WQRA 1S3FA 4IKEA 2RGWA 5LJIA 1SOMA 1FUUA 4IOKA 121PA 4OM7A 4M4SA 4QU5A 5EVJA 3VHQA 3SNHA 4B4KA 2QWXA 4XW2A 3RAPR 3ZPXA 1JXAA 4KTVE 4Z8YA 2QAIA 5JAUA 3CTPA 3I0MA 1ZGCA 5JCXA 2JAHA 4RL4A 4AF8A 3ZVNA 3LP8A 3B5JA 4P9NA 5GJWC 5K45A 3CWQA 2PLAA 1LPAB 4QGSA 4HOYA 4I55A 4WX2B 2GCNA 5K3SA 4OY3A 5KREA 2QR3A 4TZKA 4MUFA 2JI6A 1V3VA 1X13A 3UMSA 2A0WA 2FUKA 5A2GA 2BFFA 4D9GA 2JZOA 3OZUA 4G5OA 1ECBA 2HHJA 1M6WA 2VDLB 4RTNA 1CYEA 3KZNA 4WQMA 1XDWA 3DFUA 2GNPA 1BH6A 2PKWA 1E3SA 3DMTA 2V9ZA 4HX5A 1ZH6A 4L8VA 4M7PA 4OJQA 1RC8A 3QUAA 2NU8A 5IHXA 3OLVA 2GD1O 1SHLA 3RTGA 4IJMA 4LZAA 4DLUA 5G1NA 2FSPA 4WCFB 4AMGA 5ESDA 2ZSKA 2Q1SA 2LDXA 2YVAA 2JAWA 3F9IA 2G9NA 1JL3A 4A6XA 4MKHA 3HEAA 4D9CA 3ETCA 1ST2A 3WA6A 2PE5A 2X15A 1ZJZA 1WY7A 1I9CA 4TXLA 4RFLA 1DQZA 1D1QA 3AUSA 3L0CA 3KKKA 5DHAA 1N9GA 1NXOA 1PT7A 3H0EA 5CVVA 4AY4A 5FOTA 1SVMA 4ECEA 1JAXA 3QEBZ 2DWPA 3ENQA 4HZUA 2FCAA 5DU2A 1KYIA 2CLSA 2A33A 2N42A 3KEQA 4FT4A 4WI1A 3KQQA 2YWGA 4U4AA 1CJBA 1N5KA 3NOQA 4E70A 2ZOSA 4ZQGA 1GR1A 4B8WA 3CSUA 3H4VA 3HUFA 1WBDA 1ENPA 1K66A 1LKZA 1SEPA 4NFHA 1EK5A 1OD6A 5GJVC 3AH8A 1JHAA 3AKEA 4KR7A 2OAP1 1U9YA 1F8UA 3EASA 2YMPA 2XT0A 1BX0A 2ON6A 3CH4B 5B7PA 4YBRA 3RWOA 3AYZB 3R3YA 1ZJWA 2B4QA 1VCMA 2CXTA 2WT9A 3I45A 2IK8A 4G0UA 3ZI4A 3UAGA 2CJPA 4RFSA 4PYIA 3DE5X 4Y2QA 4HTAA 5EWLA 1I5OA 3OQ1A 4DIDA 5KTKA 1WNTA 3HN2A 3I12A 4AD8A 3M4NA 2QSZA 1RQPA 3T4UA 3OQOA 4HY3A 1UJ2A 4E6PA 2CVHA 3QH4A 4F4CA 1ZVMA 1R4ZA 3TQTA 2POCA 2D1RA 1ZN8A 2ZROA 5FXMA 5M29A 4DB2A 3ZZ0A 4MI1A 1DTEA 2VJBA 3TMYA 2EW1A 1GNLA 7YASA 1IQRA 3BYZA 4BEVA 4JJFA 2GDZA 4KN8A 3ZWOA 3IIMA 4YMTA 2WWXA 1PWYE 2PGIA 3D8SA 2RHCA 3HCRA 4KU4A 5BY2A 4RESA 1X74A 2PUWA 2YFQA 4ZK6A 3O82A 4YECA 1XEAA 1U0LA 2P9JA 3DPUA 1J2EA 2YIDA 2FQYA 3G6WA 3JQAA 4IUCS 1JG3A 3GHYA 4OK5A 4UULA 2JVIA 1ENOA 3T61A 5M7EA 1BDHA 1DQYA 2PCJA 3E03A 3ELBA 3R09A 2JFXA 1RHQA 1J8MF 5DTRA 4E94A 5BR4A 1MOSA 4ZJUA 3FMIA 2B3DA 4W5HA 1EVQA 2FN7A 3O0DA 2X2PA 3BE8A 3HVHA 1ORVA 2GERA 1AQYA 3LUHA 3N8IA 1W25A 1O03A 4HFMA 5F4BA 1ZCZA 1J8VA 2PV0A 2QN3A 3OCYA 4F5EA 4QZVA 1UF9A 2NO1A 3IO5A 4DCPA 4ZQBA 1FFYA 4DCMA 2C7QA 2Y99A 5DASA 1N78A 2YIJA 2ZS8A 4AP9A 2A4KA 3HUDA 1FZQA 3Q3CA 1Q1ZA 2DB3A 4IH4A 3F5MA 1FU8A 4M1SA 4PFKA 3BXOA 1XHFA 2VZEA 2ZSUA 3IGFA 4GGMX 3W5UA 2IYOA 3IX7A 4WEQA 5TSDA 3KV1A 1NF9A 3JWEA 1WXHA 1F2UB 4YJ2B 1KDRA 4E1BA 4G5QA 4IIHA 1QCZA 2JGNA 2O2JA 3VX4A 1GT6A 4CL2A 3INYA 5G0TA 3UGKA 2O2IA 2CVOA 5THKA 1MHTA 4H3VA 2JHPA 2MSDB 3E0QA 4AM8A 4AKIA 3HI6A 3H1FA 4GSYA 3ZV5A 5B7QA 3F98A 3CVWA 2BM9A 4FSDA 3FUWA 5ALNA 3ZQ4A 4WHMA 1QU2A 4UUOA 4C7MA 1CUVA 3A11A 3CJTA 3C98A 3DCNA 4O4IB 4IFBA 1H9BA 1NBOA 5G3YA 3GF4A 3SJ7A 2CFSA 3HEBA 1DARA 2JLUA 3LT5A 2HCBA 2UZIR 3OEEA 1JDZA 1DDOA 4CT4B 2QDXA 1IWPB 1W85B 1M7BA 3DLIA 1JA1A 1Z5ZA 2ZT7A 3SLGA 1H1LB 1SBIA 2BTOA 1CUEA 1I4LD 1SQSA 3NAMA 4LXXA 4ND2A 4Q3DA 4RHEA 4WZ6A 1J2JA 4KR3A 3PFGA 3WDLA 4PPQA 1IATA 1FVOA 2I91A 3PXXA 3QVGA 1O5OA 2DBVO 2CFIA 4Q3OA 2ZVDA 3OCCA 3BE6A 4LJSA 2J08A 2PCLA 2B8EA 3MOIA 3F4KA 4TWBA 1QVVA 4XQGA 2AT1A 1D3AA 2ZR0A 2D54A 3ED5A 2Y9MB 3ZX5A 3NC0C 4GX1A 1ND5A 1H2EA 1NXVA 2WWFA 3GU3A 3L1KA 1AS2A 4EUNA 4I5GA 4IG9A 1TK3A 4IIFA 4YT4A 1WDLA 4BMOB 3VAZA 1H2FA 4MMZB 1RWWA 1FDUA 4JLSA 5B2FA 2R7MA 4WZAA 5F35A 4F96A 2P9TA 4K81B 1IOLA 1U02A 5F5NA 5C3MA 3A1UA 2ZXEA 1HT2E 2A5YB 2GXSA 2IIPA 3LXRA 2FMHA 1L5RA 2IYYA 4CYMA 5DDIP 3VU9B 2H7YA 1M5UA 2PKQP 3EIXA 4Q3CA 1JPJA 1LI5A 3BTOA 4CGZA 1VC2A 4PNPA 4KO3S 2FCRA 1NBWB 4EHBA 4YMVA 4BMZA 4GPTA 1AQ6A 1OFUA 1AKEA 3KXLA 2Q3LA 4ZJYA 3W9BA 1L7MA 2WTMA 5FR2A 3W5CA 2O7RA 3RYTC 1A9SA 1ZJYA 4LRWA 5GM2A 4B34A 3GYGA 4DYDA 2BBSA 1ULSA 1IBRA 3IPYA 3RJ9A 4C6TB 2YJTD 4XI9A 1O54A 4EMBA 2C9OA 3DE1X 3B2QA 3F5SA 5C81A 2VP4A 1L5SA 4BVBA 1RZ3A 2IV2X 2CFCA 4KQ6A 3MELA 1FBTA 2W70A 4MVJH 4CF4A 4IDGA 2BF7A 1UQTA 2C96A 4GM4A 4ER7A 3V9AA 4ZCIA 1BAPA 3AR7A 2YHUA 1KFKB 4ND6A 5AK4A 1M8FA 2AC4A 3TF5A 2H4JA 1QKKA 2ODPA 3GFSA 4ARBA 2HHHB 2JI9A 2VDVE 5ES4B 1VHWA 4ADSG 2DMRA 2IW3A 4F8YA 4YPOA 3OUTA 5CFQA 1SHZA 1VFPA 4GPD1 1UBSB 1HYHA 3ZNNA 1A97A 1YUBA 1KYYA 1YS6A 3G5AA 2JD2A 3KOMA 3LX8A 3ONFA 4NBRA 4JP3A 1MORA 1VCHA 2ZS7A 1GQRA 3B1VA 4KRFA 5EHIA 1S1CA 4UNPA 4OHRA 4B4WA 4JA2A 4JQCA 3Q2OA 2PSEA 2JGMA 1GGVA 2FDCA 1R74A 4LRTB 1Z6GA 2WNHA 1E20A 3WLLA 4M8KA 2X58A 1P2VA 1UMCB 3CLSD 3PWKA 4K9OA 4KG7A 4P80A 2Q1YA 4UM7A 3Q6IA 4QTUB 1QGYA 4F3YA 3KQLA 3BULA 1H85A 1U3DA 2GCOB 1LK5A 4XLZA 4WJZA 2QP3A 5C9ZA 3IEMA 2X9LA 4TTSA 2WEKA 3AW9A 1SMKA 2B7LA 1JLLA 1MQSA 2NZVG 1ULAA 4LYDA 3VJMA 1U2SA 4XDYA 4I6JA 2K5UA 4JNCA 4MWDA 4PCUA 1E1KA 4DJJA 2EL7A 4QYSA 1NSFA 2YCLA 4KVFA 1G2IA 4ZZIA 4O1IA 1JA0A 2OXTA 3PDHA 3WWDA 1F7UA 2ZRPA 1VE7A 4QATA 5E6RA 4OJYA 5A3JA 3U37A 4CL0A 4GMFA 3NHWA 3TH5A 4A2PA 1RHRA 5CXUA 4IIBA 3TSZA 1T4CA 3QLUC 3RSZA 3UYKA 2Z04A 3V4PB 1T5BA 1EQAA 3EGCA 1SKYB 3JARA 5LBUA 5LM3A 1HZZA 4MWSA 3AVTA 2ZRAA 4QTTB 3T41A 3AWDA 5HZGA 1HA3A 2C1XA 1ZDMA 3INNA 2Y68A 1Z0DA 4MZDA 5DM60 1QGED 4HNTA 3FCYA 3GR6A 3BB3A 3AR3A 4IHJA 2J7KA 5TVKA 4BFTA 4EB8A 5IW8A 3LZCA 4MS4B 3C6ZA 1QHNA 2XYRA 4L1KA 3CEJA 1GPJA 1DAIA 1NNI1 2NNLD 4J0GA 4RH1A 2CMFA 4JJIA 1XHLA 3U61B 5EIBD 1QDEA 3RUCA 1FYEA 4DYHA 4DYVA 2Y1CA 2G1AA 5AKHA 3U7HB 4HQKA 3HP1A 4UEWA 4WNYA 3LUDA 5FTJA 2HSWA 4XVHA 1P73A 4O4JA 1R9NA 4OU5A 4PPNA 3LY8A 1J1UA 2OBFA 4B73A 1F0NA 3ZHXA 3E4DA 4TRNA 5KYUA 3OH8A 4BO8A 4J1TC 3O9ZA 3P9XA 3QE3A 5FBLB 2HJSA 4MKZA 4OXQA 3NO4A 4FW9A 3NGLA 4OVKA 1UBLS 1LC0A 2IF2A 2O1EA 4D9BA 4AZVA 2VTBB 1JB9A 1FRZA 1N2OA 4E32A 4ZOCA 2R66A 2G6TA 4QBTA 4CMIB 1ARZA 1YQUA 4MJ7A 4JGBA 5G2OA 4HDCA 4EL5A 5K01A 1JQEA 1PNVA 4GLFA 5HRAA 4H18A 3AGQA 1Y33E 2PX0A 1EG7A 2OCXA 4IV0A 3WA7A 1E5XA 2AEFA 1ZNZA 3RGWS 3EEBA 3HSKA 5F5LA 1SUEA 3FTCA 3G2LA 1VLMA 2AC2A 2M1XA 2P1ZA 4RK4A 3A2KA 1EA7A 2GXUA 4HLNA 5BWNA 2N75A 3A6DA 1MGPA 2BL4A 2NO5A 5MN4A 3HJGA 2GXAA 3TUZC 1UXJA 3FHCB 3KAKA 3Q8MA 2BGGA 4E15A 1USUA 2R8EA 1ESCA 4MUBA 2JGDA 2TMKA 2VUSA 4FZ5A 1WUKS 3RLIA 4BO9A 4ZP1A 4LZPA 4PF1A 5TGDA 1CUXA 1YVEI 1DAHA 4JVLA 3OKAA 1ZO8A 3OI7A 2UZ1B 1X80B 2WF9A 4CIYA 5LKRA 1AB5A 1HE4A 3AXSA 4MAFA 2REXB 5EQDA 1JEAA 2BOVA 1O58A 3BGDA 3L4SO 4NFLA 2CLKB 4AXBA 4CEHB 2YFKA 2IEYA 2FEWB 2LNDA 3B6IA 3ZCRA 4NBVA 3TN7A 3NHBA 4CU5A 3SY8A 3WISA 1YFLA 4L8FA 5E2BA 4HQOA 1DG3A 1TMKA 2O6LA 3H5WA 2YINC 4Y9SA 4L2IA 3TM5A 1AOXA 3B3QA 3N7UA 2QQ5A 4UE2A 4AS1A 5HX7A 3TGWA 3GDHA 1EFPA 2QN6A 1C0PA 3BXPA 5DXAA 2LDBA 3G2IA 3M8KA 4KYIB 5IM4F 1JV2B 3C74A 4LF7B 2CMHA 3JALA 1XMVA 1V11B 2Z2ZA 3IO3A 2BM1A 3GDFA 4O2RA 1CY4A 1V7ZA 4BVFA 1DIBA 3MWEA 2F3PA 1KI7A 1JLKA 3LO8A 4DJFC 3AUFA 1T8WA 1QHYA 3TFWA 1KVRA 3EGDB 4EP1A 2QBYA 2PD6A 1O9BA 2X42A 3EMBA 2D2XA 1EGMB 3D7RA 3FBGA 3ROZA 3F96A 1U0SY 5EZ5A 1XG5A 5FI0B 1LBIA 1TYZA 1Y4DE 3GPCA 3O4FA 3KK0A 2J3EA 4WVLA 3SHVA 1I7LA 1K92A 4M1KA 3UV6A 2BE7A 5KPDA 3C7CB 3TSYA 2DX7A 2BUCA 2VAWA 2I80A 5CX4A 3T9FA 1DGQA 1RJ9B 1TIBA 1T0IA 3WIDA 5KCZA 1WM1A 3Q7EA 4RA9B 4O3MA 3I2IA 3L7JA 3OZVA 2V0NA 1S9DA 3IH5A 1G8YA 4X8HA 3E9DA 4XTCS 4ZI7B 3T1VA 4TMTA 5AWFC 3DT6A 2NLOA 2YJ3A 2Q7XA 2WJVA 5C4GB 3ZE0B 3TZLA 1DAMA 2AFHA 4HNGA 3SHQA 1W88B 1SU8A 1TXGA 3F6PA 1B3BA 3DZDA 4RFSB 1BMFD 1NIJA 1Q20A 3UATA 3QX7A 3G7NA 3JVDA 2H2GA 3ICCA 1F5SA 1NY6A 3OIWA 4TS9A 4X41A 4YS6A 5EWMA 1DG1G 1Z4NA 5EJ6A 2PA0A 4OB7A 3HY6A 3V1KA 1XK7A 1F3OA 4AZ3A 3V34A 3NHSA 1Z28A 3B1XA 2LKDA 2WRZA 4GRIA 5IC5A 1Z07A 1O0SA 4DNQA 3KVVA 5H4GA 5T3YA 4J0JA 1AUQA 1QHEA 1CR6A 5F9MA 5LP1A 1E6LA 3E5MA 3NFYA 3CM0A 4I4TB 3A32A 4CQNA 1T5DX 4NARA 4V2IA 4R4JA 1HTWA 2KWIA 1RAGA 1TJ4A 3MT7A 5LKAA 5TB5A 4MVJF 2CXXA 3DTTA 1ST3A 1O57A 5C5DA 2FEAA 1ESDA 1TZKA 2IXEA 1QK5A 1ML4A 2XUIA 3T0GA 3UMYA 2QUBA 4KIUA 3HZRA 4JEHA 5K6TA 1XXHE 1UODA 4ZO4A 2FEPA 4QC2A 3TS1A 2FPIB 5BRNA 1RQGA 4FS8A 3VH3A 2RCNA 4BGIA 1ES9A 1YZNA 1ZVKA 1Y8RB 1GRVA 3DYVA 3U3ZA 2PVSA 3GD5A 4R98A 4BZPA 2IYPA 3P2KA 3DZGA 4QYIA 1OPRA 4TROA 5LMCA 2G77B 1DKPA 3NTXA 4MVWA 3LJKA 4PTYA 1T4CB 1BIFA 2B3TA 2WG0A 2GM4A 2VHQA 1TZCA 2RONA 5GY7A 2PBLA 1A2BA 1A4RA 4JDPA 1UPFA 3A9WA 3HS3A 2D5LA 4D0GA 2I99A 4FQ5A 4X1KA 5K3FA 2O8DB 1YL5A 4LIPD 4J0CA 3FPJA 1MFZA 2CYCA 1FTQA 2WPDD 3KOUA 2ZCUA 3A7EA 1BVRA 1Y37A 1X8KA 3W2TA 4P58A 2O59A 3C3DA 4YAKA 3IRUA 5AVQA 5KPJA 2P1DA 2ZW9A 5EP2A 1X94A 3F49S 4Y2TA 1VA4A 3OA2A 1GTMA 1SZJG 1FDOA 1PT6A 2CDCA 2GK7A 2R6R1 3LHIA 4QDUA 4YQFA 2YXBA 1T91A 1ZD3A 4FHFA 3FMOB 1G98A 4UQLA 2QPTA 2QTLA 2PWPA 1DWQA 4IIJF 3WVNA 1SUFA 4ZAWA 2SKEA 2FP4A 1RXCA 4BQRA 3PWTA 4GL4A 3RU3A 4A2QA 2JVJA 4EA7A 4GPBA 3V2UA 1KERA 3OQIA 4RVFA 2I71A 1FFSA 3KSDO 4TL9A 2HWYA 3RRBA 1RZUA 2P9GA 3WKCA 1FLVA 3R7AA 4B4DA 4EAQA 2NO4A 1EXDA 4BO7A 1FTSA 1UXKA 3MJFA 3OQPA 5ALMA 4TL6A 4N5DA 4NCNA 4Y2PA 5AK5A 4BNHA 4BZZA 2JJYA 1B41A 4BMNA 1MHPA 2P77A 2QN9A 3EQ2A 1US8A 3KVRA 3PNSA 1SXJA 1X2EA 1M2GA 2FZ5A 4MGKR 4MQMA 3VR2A 4BKUA 2BM8A 4OI0A 5HSGA 3ADKA 2HXGA 1K2WA 4KPEC 1NONA 1GCUA 1JHZA 3BILA 1ZMXA 3L8CA 2QRVA 4G9EA 1IHDA 2R1TA 3KJQA 5H68A 2WHPB 3S6JA 1P81A 3AFIA 1B14A 4R7ZA 1C41A 4K6HA 2PKRA 1U8YA 2FXVA 3BH0A 3WRXC 2C3PA 1ORHA 5A7GA 3W5BA 2XUDA 4ZHSA 4BTLA 5CDTA 4U9IS 5LDHA 1JE1A 3U3RA 3WLFA 3ZD9A 4AX4A 3IAM1 2UZ0A 5CDSA 4P82A 5D3MB 1MD9A 1ZEMA 1CSEE 3WNBA 3L92A 3RK1A 1B76A 1NKVA 1QJCA 1WBBA 3E58A 4RPLA 4P81A 2AI3A 4W4TA 5DI3A 4PBTA 4KHZA 1U7ZA 3KRTA 5FO1A 5CBPB 4YB8A 5J3JA 1E6UA 4PG8A 3E7DA 3QWAA 1U2RA 4OREX 4DR6B 2QBYB 1CUJA 1VMAA 2H48A 2A88A 2COEA 2HCRA 2WIKA