1B8PA

Malate dehydrogenase from aquaspirillum arcticum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
KTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRNIKVLVVGNPANTNAYIAMKSAPSLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGASVKDMINDDAWNRDTFLPTVGKRGAAIIDARGVSSAASAANAAIDHIHDWVLGTAGKWTTMGIPSDGSYGIPEGVIFGFPVTTENGEYKIVQGLSIDAFSQERINVTLNELLEEQNGVQHLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cold adaptation. Sequence, biochemical properties, and crystal structure of malate dehydrogenase from a psychrophile Aquaspirillium arcticum.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (MALATE DEHYDROGENASE)
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b8pA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1b8pA02
3GUYA 2AEJA 4CQMD 4NR0A 4XGIA 5EJ2A 4AJ4A 3K96A 4JP2A 3TL2A 4AG3A 1E5LA 4YYZA 2R00A 1GUFA 5IZCC 1OI7A 5G2OA 4TMFA 3TOZA 3OQ6A 5L51A 3TNLA 1ZXBA 3BTSA 5EESA 2ZKLA 4BB5A 2GPTA 3DR3A 1TEHA 3ENNA 4JBGA 2BGMA 4IJWA 1E1NA 2VYVA 3NDJA 2PH3A 4R01A 3OJOA 4LVUA 1NAIA 4LCEA 3FNGA 1N9GB 1ID1A 1T4BA 3FF4A 5TNXA 1Y1PA 1BXGB 4NK4A 5JPIA 1EUDA 4D0SA 3GGPA 3ASVA 4R68A 3DBRB 3GVCA 1N92A 4BNLA 4XB1A 5DBFA 1HL3A 2OHXA 4FIZA 2O7SA 3LLSA 4IDCA 1SCUA 4CM5A 2HSDA 4FFRA 5AOVA 1BTOA 1A27A 1FDVA 2IXBA 3VAZA 4MJLA 1QXSA 1ZKMA 4XJTA 4E30A 3SC6A 2NWQA 3KETA 3KXDA 3N74A 5H83A 1DIHA 2D0IA 2VWHA 3V8BA 4YTEA 4XQCA 2BFPA 4XWYA 1IUKA 5JCJA 1N7GA 2RIRA 5GMOA 4I9UA 1GZ6A 3G1TA 3W4IA 1U4SA 4TRMA 2JFGA 1MLDA 2VTDA 4E32A 5JAIA 4OOEA 4ALLA 4F46A 1NTOA 2NACA 4O59O 1S7CA 4MVJI 3RKRA 1DIAA 1ISIA 1ONNA 2VZ8A 2O2YA 1ZMTA 4Z0TA 2OP1A 4OAQA 3B1FA 5JBIA 1KC3A 4BNJA 3VVCA 2QRJA 2CZCA 3VPSA 1YKFA 1PJ3A 2O3JA 4R9RA 1UP6A 3BTVA 1W8DA 1SO8A 4OSPA 3VPGA 5KJCA 1T2DA 1PJ4A 1M6HA 3PJFA 1VJ1A 1LUAA 3VPFA 5IJZA 4Q3AA 5CP8A 3ZNNA 4IPTA 4L73A 1T2CA 1R66A 3O4RA 3Q9UA 5JYDA 2PZLA 3WLEA 1KC1A 2VRCD 3EMKA 1SEVA 4OOFA 4WOJA 4TZTA 1HDGO 3WSVA 4PCVA 5A06A 4NBWA 3GGOA 1GEEA 2GZ1A 3DONA 4E5KA 3JYPA 2HQ1A 1PS8A 3NDIA 4IQ8A 1PL8A 3C8MA 3GNQA 3JQAB 4M54A 1LX6A 4E21A 4FFMA 1E1MA 4UVDA 3QY9A 5JE8A 4TQGA 1Y8RB 2VUUA 3RSHA 2QZ9A 4DQUA 3Q9NA 4MKZA 2X9VA 2IEBA 3QWIA 5FI5A 3NGXA 4N7RA 2X0JA 3L4BA 3OIFA 4YRAA 4J1TA 3FTNA 4XYGA 1ZJYA 1MA0A 2FR1A 1VL0A 3CEAA 2DFDA 1HETA 3BZUA 3TZ6A 3UCFA 4MIYA 4YXFA 4O6VA 4GKVA 1LXCA 3M1LA 1A5ZA 1JWBB 1V0JA 4BMNA 3OBBA 5DZSA 5JMWA 2FRDA 1YQXA 1I10A 2E49A 2O3RA 1D1SA 1R0KA 2HU2A 4NFHA 4CM3A 4RPJA 2ZB3A 4PG4A 4KMSA 3O38A 1U3WA 3AUTA 4BNNA 4ZICA 4TRRA 1HDRA 4GGPA 5I7VA 2FPPA 4B7CA 5A5EA 3F47A 1BXGA 1DRUA 4WUVA 5CHEA 1IHXA 2ZB7A 4ZA2A 1QV7A 3RC9A 3HFGA 1A4UA 4CODB 1GPDG 3SXPA 3UW3A 2Q45A 2I67A 3HN7A 2GZ2A 1HDCA 2VYNA 3JD3A 3RUHA 5KNLA 2HJSA 3U9LA 4WGGA 2OXIA 1B26A 4FOSA 4D0RA 3DOOA 3C7CB 3WNVA 2FR0A 3MZ0A 1LRJA 1G1AA 1R15A 1P9LA 3ROPA 1FDTA 1ENOA 3PDUA 4A10A 5TRTA 4A26A 4CMKA 1D1TA 1YE3A 7MDHA 1UH5A 3JQ9A 1E3SA 3KOUA 2I6TA 3ZU4A 4UUPA 4FR5A 3TF5A 1NWHA 4PIVA 3K31A 4WCFB 5DNAA 1A71A 1NVGA 3QVWA 1DAOA 4PRLA 1Y7TA 4WK6A 4Q39A 1PTJA 3CSDA 1CERA 2NM0A 3SLGA 5G0WA 4UREA 3ZWWA 1LSOA 3F4BA 4XGKA 2DTDA 1VSUA 4NZ9A 1PWXA 5TF4A 3JQBC 1KVTA 4RL6A 5ES3A 3DMTC 4NU5A 1ZXLA 2VNAA 3QHAA 5ICSA 4TRNA 3VOSA 2JHGA 4IDGA 1E1KA 3PYLA 1RKXA 4YCAA 3COSA 4N54A 1YB4A 4HP8A 1Z6ZA 2PGJA 3UVEA 5JCJD 4FOOA 1NNUA 2ZK7A 3OJ0A 3PHHA 4Y98A 2EG9A 3FI9A 1U5CA 2FZWA 3JQEA 2FN7A 3EUWA 2W4QA 1P1RA 5TT1A 3KM0A 3SC4A 1U2DA 1DC6A 5DN9A 1C0IA 4PLZA 4PVCA 3WNQA 2XPCA 1GQQA 2G17A 4Q3EA 4J49A 3AOEA 3ZV4A 4CUZA 4DLAA 1TT5B 2J5RA 3ZWMA 4B4WA 1HZZA 2Q4EA 4L76A 1U8XX 5GY7A 4E4YA 3HDYA 3IQDB 3OA2A 1Q2XA 3ZI0A 2X6TA 4ROSA 3I9KA 4CR7A 1JN0A 4II3A 4RF4A 3ZGYA 4MPDA 4S3MA 2BH9A 3CZRA 3R6DA 4L4SA 3ICPA 4TSKA 3D3EA 3ZNQA 1IULA 4J9VA 1P44A 1R4MA 2RAFA 1ZK0A 2RCYA 1M76A 1Y9AA 4J91A 4R16A 3JQFA 2HAEA 3RQSA 1LEHA 1EQUA 2B4TO 5L9AA 4XGNA 7ADHA 3U5TA 2BKAA 4XYEA 4ID9A 3W4JA 4PFJA 1JDJA 3B70A 3WIEA 1SC6A 3E6AA 1LLQA 1MFPA 3H8VA 4RDHA 2OFPA 4M1QA 2VYND 2AQKA 1Y8RA 2FSSA 2POQX 2QX7A 3JD2A 1ZMOA 4UVGA 4XA8A 1G0NA 5JC1A 3T4XA 5KVSA 4J0FA 1BSVA 3NGLA 2B4QA 1PS0A 2GLXA 3D3WA 3GC6A 5DP2A 3NT4A 4LVCA 2B0JA 4HFNA 1EE2A 3PPIA 4RPHA 4HXYA 2PR2A 2CMDA 3PWSA 1ZSVA 2J6IA 1LU9A 4BNKA 5G4KB 1BW9A 3M1AA 1B2LA 1XDWA 3R1IA 1RYEA 5CPFA 4P4LA 3PYMA 3BHJA 2JFFA 3NTRA 1NFFA 4EUHA 2PGDA 4B79A 1XKQA 1E3WB 5G0SA 3EW7A 3HE3A 3HG7A 1QYWA 2O50A 3DBLA 4IDBA 4NHEA 4FJ2A 4M8SA 4BO5A 5JFOA 3X2FA 4E2YA 2C20A 1PEDA 1IOLA 1ADFA 5C7IO 1Q7GA 3TQHA 3GPDG 4EBFA 3H5NA 1B8PA 3ON5A 5A02A 2Y1DA 3PIDA 4WNCA 2Z5LA 5ADHA 3AWDA 1D3AA 2Q3EA 1I3LA 3HQ4O 4R1SA 4PG5A 4DLBA 4HFRA 3GUCA 5TIIA 3NYWA 1X7HA 3H65A 3V1UA 1DHTA 5TX7A 1Y8QB 4R1UA 4CLOB 2NQTA 1TVEA 3HNPA 5G0TA 4FJ1A 1T2EA 3DZHA 1UZNA 5HS4A 1KVSA 4GMGA 2PD3A 1MXFA 4IGEA 4JNKA 4DA9A 3H6KA 3D5TA 4PG8A 3IKVA 5KKAA 1ZJZA 2PH5A 4OQZA 4DREA 5F5LA 2NU7A 5HWSA 2WMDA 3NKLA 4DWVA 2YQ5A 4Z3DA 1N1GA 4QUKA 2YHUA 4B7UA 5BNFA 1QYXA 3WBFA 1HXHA 3JYNA 2VHXA 4GH5A 4D3DA 1Q1NA 3QVXA 4A27A 1XELA 4NBTA 4BKPA 3WG9A 2Q2WA 1I3KA 4Q3NA 5DCYA 1SB9A 1ENYA 5JO0A 4Y67A 5I7SA 1S6YA 1SB8A 2OP0A 2PLAA 2CFCA 4NU6A 3HDJA 4I5DA 1GL3A 2Y68A 4I08A 1ISJA 5JNLA 1P3DA 4GSKA 4XR4A 3P2OA 4RVFA 5COAA 3AI1A 4KDFA 4W99A 4FDAA 5KJFA 1NQOA 1XU7A 1MV8A 3D64A 4KQXA 4JBIA 3L4BC 2VHYA 3ETGA 5FEUA 3E18A 3E9MA 2RH8A 4NJMA 3ONDA 1ZBQA 3IL2A 1KIFA 1XWFA 3GN2A 4M49A 5EL0A 1CRWG 5HA5A 3VC7A 4BV8A 4NBRA 3X2EA 1BMDA 1ZCJA 3AUAA 3WWZA 2W2LD 2XAAA 3ZU2A 5ITWA 2B35A 2DFVA 3DFUA 1OBFO 1ZK1A 4DQXA 4HNHA 1C0PA 2NADA 3BMQA 5TQVA 4LRSB 1EZ4A 1PSDA 1EUZA 2Y05A 3INTA 3N7UA 3WS7A 3WJAA 4CMBA 1R4NA 2JAHA 3U4IA 4YJDA 5FWNA 3ZWYA 5BR7A 2JFHA 4YJFA 3ICCA 4WLFA 3GLQA 4BNGA 4HBGA 1PJCA 3PQEA 1JTVA 3L9WA 3QIVA 4J43A 5IDYA 3ZV6A 1IZ0A 1DSSG 3RU7A 1IB6A 3WWYA 1XGKA 3ZHBA 1Z74A 2ZCVA 5G0UA 3WFIA 1U1IA 5A05A 2Q1WA 5T67A 1MFZA 4XDZA 1WDLA 3PJEA 5L4SA 1B3BA 1ISGA 3CMMA 3QWBA 1PL6A 5T6BA 1P45A 2Y0CA 5I7EA 5G0VA 1FJHA 1WMBA 4B3IA 1PWZA 5JO9A 5KOIA 3PLNA 5FYDA 5ER6A 1ENZA 1ML3A 3RBVA 2NQ8A 4DC1A 3PXXA 4CMAA 1DFHA 4UVEA 3ZWVA 1NVMB 2IODA 3SX2A 3JD1A 3QVSA 2Z1NA 2C7GA 4I9HA 4QECA 4JP3A 1TLTA 4AJ1A 4GMFA 4KZPA 1EVZA 2OZPA 2X5JO 5T8KC 1E92A 3FNEA 4XIJA 3H7AA 2GNAA 3OJFA 3STHA 1DC3A 1GYQA 4Z0HO 3AY7A 3O03A 4E13A 3F1KA 3I9NA 4PLYA 1RWBA 3B1KA 4NG5A 1IY8A 1UDAA 3JCZA 4UUMA 3TZHA 4CUJA 4IIUA 1HLPA 2J3KA 2C5EA 2GN4A 3PYXA 4DXHA 4J2HA 2C0CA 5F21A 3ULKA 3PIIA 2YHIA 3LQFA 3A06A 3LF1A 3ITDA 1ADBA 3IUPA 2EJWA 1H2HA 1E1LA 4QTZA 1JKIA 3HJAA 4GBJA 3PQDA 2E4AA 3ETDA 1MXHA 4OHUA 3HADA 2DKNA 2I3GA 2W8ZA 3I6QA 1H9BA 3PFWO 1LDGA 2PKQP 3W8DA 3HB4X 2CD9A 1JVSA 1YJ8A 1OC4A 4UAGA 1P33A 5IN4A 3B20A 2O3QA 4R5MA 1V9LA 4Z0PA 4AJ2A 3JYOA 4YBZA 3MEQA 4MDHA 2GR9A 3JD4A 4R4JA 2DPGA 2GRAA 2R00C 5HM8A 4AJLA 4PLFA 4KUEA 1HRDA 3FCOA 3K2BA 5COQA 4C4OA 2VOEA 1QMGA 2OMEA 3JQGA 3QW2A 1N9GA 3RJ9A 3DHNA 3S2IA 1VSVA 3DTTA 2H9IA 1YB1A 3L6EA 1EDOA 3UCXA 4L8VA 4U8GA 3RFVA 1CYDA 5IFLA 1PJLA 1ISMA 4G81A 4XRRA 4YEDA 3JQFC 4JX8A 2B5VA 2GDZA 2W98A 3BMNB 4ZQFA 1WMAA 4UVIA 5K6AA 2OOSA 4TWRA 3BTOA 2GN8A 1HYHA 3ZWPA 1HF3A 1RM3A 3NRCA 2BF7A 3NT5A 3GNSA 2C2XA 2Y93A 5BNTA 1A4IA 5KCZA 1JAYA 4URFA 1MGOA 2V65A 5JW6A 2B4RO 3SJUA 1OZAA 5THKA 1EK5A 4IDFA 2VNSA 4Z9FA 3BIOA 4B3JA 1V3TA 2NTJA 3ONFA 1JW9B 2QW8A 1NASA 2D59A 1WDMA 3SJ7A 3I83A 2O4CA 3VH3A 3P7MA 1AN9A 3R3SA 4IDEA 3FR8A 4OYRA 3LDHA 3ANMA 4ZGWA 1W4ZA 1V35A 3IMFA 4OJNA 3TN7A 3WQSB 1J0XO 2VWGA 4WPGA 4PN3A 3BMCA 1EEHA 3CKYA 3MWEB 2HRBA 3EZYA 1EQ2A 1O0SA 3HDHA 4CQLB 1XA0A 3LYLA 3VKUA 2OO5A 5LCXA 4ZQGA 5IAAA 1SZJG 2JCXA 3RI3A 3ZWBA 3LT4A 2AG8A 1BGVA 3A1NA 4AJIA 3DC2A 4GI2A 1BWSA 2PKRA 3E5RA 5EINA 4TKLA 3AM5A 2YFHA 1VKOA 3WFJA 1LI4A 3GGGA 4LSMA 2PTGA 4IQ0A 2VUSA 1DPGA 1CWUA 4L0QA 4PG6A 1ISFA 4O1MA 5JY6A 4PLPA 4E5YA 2GN6A 1CETA 4OH1A 1KYQA 3GZNB 4AJJA 2BHLA 4K1LA 1DLIA 2P2SA 3UHAA 3VKVA 1G0OA 1VPDA 1SOVA 1HE4A 1JWAB 3JYLA 3WTBA 3AJRA 1F14A 5K9ZA 1EDZA 1YXMA 1I0ZA 3E03A 4PZDA 3M6IA 3A14A 3ZW8A 4J90A 3DFZA 3W1VA 5IDQA 3E8XA 2O2SA 1SPXA 5IZ4A 1J49A 1LLCA 1R4NB 3MJ4A 4LMPA 1LNQA 4BB6A 2NU9A 3IIEA 5KIAA 4II2A 4NNJA 3F9IA 3VDQA 5F3RA 1T25A 1VRWA 3A4VA 5H82A 2E6UX 2VZ9A 4OXYA 1WNTA 2C2YA 1C1DA 2HMUA 4DMMA 3I4FA 4P4NA 4OO3A 3RUFA 1EE9A 1HSOA 1FDUA 2HMWA 4K6FA 1XSEA 3OP4A 4BKQA 4F6CA 1FMCA 2O3SA 4YT2A 3C85A 3WBBA 1GD1O 3UOGA 5C37A 2VRBA 5F5NA 2IZ1A 1M75A 1E6EA 3CINA 1V3UA 3DZKA 4GVLA 5ILOA 2ZJ0A 1JQBA 4JN6B 1PJSA 2DC1A 5F1KA 2I76A 2X22A 3A9WA 3K9QO 2BGKA 1DC4A 4IJVA 4J3FA 4OXNA 2PD6A 4BO7A 2JKVA 2H63A 2PD4A 4BVAA 4BO0A 3WXBA 4FB5A 4PZCA 5DCWA 1N2SA 3B6ZA 2YZ7A 4MVJD 4B4VA 1GQ2A 1B7GO 1F17A 5AXDA 3GG9A 3C3XA 4M55A 3ZWAA 1DRVA 3I9LA 5EPOA 1KOLA 5I8ZA 3WYBA 1NQ5A 5CFZA 1H6BA 4LMRA 1M2WA 2IEDA 4F3YA 1YBVA 2X4GA 3RBZA 3ZHXA 3W4KA 3BAZA 2XXBA 3KO8A 2BFMA 1KEWA 2UUOA 2B37A 3JQDA 2QHXA 1E7WA 2E37A 1NWCA 2GGSA 2P5UA 5HRUA 3EDMA 2NTVA 4MP6A 1Y6JA 1LTHR 1H93A 1BW9B 1MX3A 1QYDA 4MVJA 3V2HA 1CEQA 5EIOA 4DRYA 4WEQA 3D0OA 2YQ4A 3MOIA 1NR1A 2YV2A 4AJPA 3NTOA 3OEWA 3JV7A 4RZHA 2ZQZA 4CLOA 2Q2QA 2ILTA 2P4HX 4MOWA 4RORA 5C7OO 2DAPA 1GYRA 4YR9A 1H0KA 3TOXA 1PGNA 5HBRA 5GZ3A 2FY8A 1U28A 1K3TA 1DOHA 4W4TA 4LCJA 2VQ3A 4U5QA 3E9QA 3W8EA 4RVDA 3NDRA 1ULSA 2CVOA 1GAEO 4A73A 4XRGA 5L3ZA 1PJQA 4BNZA 3C1TA 2ET6A 5IXSA 4E3ZA 2FOIA 4HFMA 1BDBA 5CEJA 3FR7A 4YDRA 5GZ1A 3O26A 3DZFA 3L77A 1KEVA 5F1OA 1GR0A 2DBZA 1WXDA 2B83A 2X86A 4AVYA 3KVOA 2Y67A 3OIGA 5JDIC 2ZYAA 2J5KA 5JMPA 2Q4BA 1YGYA 4ALIA 1E6WA 4WECA 2IYPA 1PZFA 4EGFA 1LBEA 2GF2A 3CTMA 3IOYA 3OA0A 4Q9NA 1EVJA 4NIMA 2JCYA 4J7UA 3JD0A 4A03A 2AMFA 4D46A 3K73O 1JKJA 5DCUA 4CLHA 1MB4A 5L45A 5KJEA 1HYEA 2AA3A 4JXKA 4H16A 1Y5RA 4M87A 4YJGA 1WPQA 3WGTA 4CM8A 5T64A 1QYVA 3QQPA 5CG2A 1C0LA 1H6CA 4CMCA 3FN4A 3LC2O 3NJ4A 3QJ5A 4P4GA 1NFQA 3K30A 2VWPA 2ZTUA 3EHEA 3HHPA 2OORA 1IPFA 4WOKA 2OBNA 5CDUA 1RPNA 1WZIA 4A0SA 1H6DA 4YRDA 4LN1A 1PL7A 4ZQEA 3RU9A 3ZWNA 1TI7A 4P8RA 1VL8A 3S2EA 3D4OA 2BELA 2F1KA 5FFFA 3BMNA 3GRPA 4BO4A 5KKCA 1C14A 2ZJ1A 4BNTA 3BTUA 3PI7A 1PS9A 1EBFA 1GYPA 3OHSX 2FZEA 4UULA 2EXXA 3LVFO 3G0OA 3AU8A 3L0DA 4IJUA 1PZHA 1WDKA 3H2SA 4IMPA 3DO5A 3MJVA 3FNFA 4CL3A 3JSAA 2GERA 4L74A 2SCUA 3U09A 4OXKA 1YVEI 1PX0A 2O3UA 2D4AA 3ENKA 1QLJA 5TJ9A 3GK3A 2C54A 3GZNA 3K5PA 2IDZA 4FS3A 4E6PA 4F6LA 2Q1UA 4RVGA 4PLTA 5ICMA 1X15A 3EYWA 3NJ8A 4D79A 2F00A 1C3VA 2W2LA 4CMGA 4R3NA 3WQRA 5C3MA 2V6FA 4RGBA 3EC7A 4BMSA 3T7CA 3M2TA 3JQ8B 4RF2A 2C7VA 3ZHZA 3GH3A 2UYYA 2XXJA 2HK9A 3VH2A 4XYBA 3R3JA 3AOEC 1MC5A 1LDEA 3DAFA 3UICA 4CMIB 3PTZA 4CM8B 3IC5A 1ISHA 1ZSYA 1L7DA 3K6JA 2X7HA 2BI7A 1J4AA 2P9GA 3RFTA 4UEKA 5A1TA 2PFGA 1ONOA 1T2FA 1QV6A 4I5EA 1WZEA 3TRIA 1ULUA 3ADPA 3OJLA 3H9QA 4NJOA 1GDHA 2WD7B 1UR5A 2GYYA 3C7AA 3WB9A 2C82A 1E3JA 1VLLA 3IJPA 3S1LA 5A9RA 4QQRA 1QSGA 3I1JA 2UDPA 1WWKA 3D5QA 3KV3O 2OGUA 1A72A 2VUTA 4DUPA 3GN1A 3K8ZA 4PZEA 3ZW9A 1DIBA 4XDYA 3AU9A 4TKMA 4YWJA 4BGVA 3L9XA 2P9EA 5JDIA 1D7OA 1HDOA 1PR9A 3U3XA 9LDTA 2IZ0A 3ZZNA 2X1HA 2ZQYA 3D1LA 4IMRA 1ZIDA 4L4RA 5EERA 1M67A 2JJYA 1E7SA 1ZK2A 3B1JA 3NT2A 4Y8VA 1MC4A 3HWRA 5CDSA 3UH1A 1ZSNA 2V6MA 5TLSA 1C1XB 1UDCA 1CQJA 3C24A 3NX4A 1PGPA 3RJ5A 4DMLA 3F4LA 2D2IA 3HDQA 3GHHA 4QXMA 5AXBA 2NVWA 1P1JA 3VHRA 3BMQB 1UDBA 3GA0A 5JXWA 5KVCA 4XQ9A 2NU8A 4DIFA 5A9SB 3FSRA 3V1TC 4IBOA 1XQ1A 1GTMA 3S2GA 4ND5A 1M6WA 4LRTB 1T26A 4J16A 3EVNA 1F06A 1XCBA 3ADOA 4EDFA 4IM7A 4BGEA 2GUGA 1RJWA 2VHVA 4HADA 2DT5A 2V6GA 3T4EA 1CF2O 2C5AA 4PVDA 3G49A 3RFXA 2VT3A 5C5IA 3UCEA 3DEYX 3AM3A 3PHIA 3PHJA 4GAEA 4WLOA 5HS6A 3FPLA 4I1IA 3PGJA 4J4TA 2W2KA 3CE6A 5CEFA 4NI5A 3GF4A 4JJGA 3W6UA 4DPLA 1KY4A 1NAHA 1UZMA 2DM6A 4YVFA 4BMVA 1KETA 2C29D 3GFBA 1PQUA 1DFIA 2Y66A 3AY3A 3CUKA 4W82A 1LSSA 2QZZA 1E7RA 4P38A 2I9PA 3KEQA 4CM9A 1DXYA 4RVUA 1AXEA 3OFSA 2V6BA 3WGQA 1GQYA 3HSKA 1PJTA 4YAGA 4EITA 2EF1A 3LSYA 1O6ZA 1Z82A 3EAGA 4JLWA 1LQUA 2RH4A 4YJFB 3L6OO 5LDGA 4EI2A 4I5FA 1I32A 1F12A 2OUIA 3U62A 5T57A 4RPLA 1UXJA 3TZQA 2H1SA 3AY6A 3FBGA 1XHLA 5A04A 2NLOA 3EY4A 4R9SA 1CJCA 1ZZEA 2BI8A 3DAPA 1I3MA 4OMUA 3JQ9C 2HMTA 4IS2A 1ZVMA 3R0IA 5I8WA 1YOVB 3PWZA 1E7QA 4CL8A 2Y1CA 2AQ8A 1LQTA 3L4SO 3NTQA 4FBGA 4RPGA 5K0ZA 4KOAA 4GX1A 8ADHA 1O9BA 1OMOA 2Q1SA 3P19A 4H15A 5B12A 4GQAA 4JK3A 2UAGA 3LU1A 4Y6SA 3EZLA 4YB8A 4DYVA 1NPTO 4ZRNA 1ZH8A 3VH4A 2Y1EA 4D44A 4Q3BA 1K5HA 4IJKA 4BNWA 3TZKA 3KLPX 5ER9A 3HB5X 4KWIA 3LF2A 4Q3DA 4DYDA 3E82A 2I99A 2O3TA 3JTMA 2Y99A 1VM6A 2PWZA 3A28A 3I52A 1GUZA 3UAGA 4G65A 4XZ3A 1XYGA 3K92A 1YBMA 3FWZA 4CLRA 1U2GA 5THQA 3PFFA 1NVTA 4YPOA 3NEPX 2EW8A 4XEHA 2DBRA 1U5AA 3VZPA 1P31A 4D45A 1F8GA 3FHLA 3AI3A 1DO8A 1K6XA 4YA6A 2IRWA 1ZUD1 3SVTA 5FI3A 4BGIA 3PJGA 3PHLA 5KVQA 4E33A 2HK7A 1HKUA 2H5LA 2WEKA 2Q1TA 2IXAA 3RUDA 1I01A 2DU8A 4JROA 1EFKA 5CEEA 1JKFA 4YACA 3OMLA 3U4DA 1HTBA 1UUFA 4TROA 3H4VA 3AUSA 2P68A 1OOEA 4BNMA 4GX5A 1SMKA 4KDEA 1P1KA 2OBYA 4ALKA 1H5QA 1B3RA 2QRKA 3ZWCA 3FTPA 2B36A 4OKIA 5AVOA 4LSWA 1H6AA 4CQMA 3I9JA 1H9AA 3PK0A 3Q0EA 4JJFA 1QYCA 4J0EA 1EK6A 3DOCA 5KJ1A 2DTXA 5F1PA 1IL0A 3DAGA 1LDBA 3H9GA 3IKTA 2RBEA 1K6JA 1D4FA 1ZW1A 2AQIA 1YH3A 1KY5A 1GADO 4TRJA 1HE2A 2HDHA 3Q1LA 3L07A 2FPGA 1K2WA 2Z1MA 1GV0A 2CDAA 3AI2A 4WKGA 1GPJA 1LRLA 2FPIA 2EHDA 2X5KO 3I6IA 4NPCA 4MVJH 5G4LA 3LT2A 5B1YA 1NPDA 4HY3A 1UXGA 2WTBA 1FXSA 4OKNA 3Q11A 4QX6A 1U4OA 1XR3A 2VHWA 4PLCA 5IXYA 3JQ6A 4N5LA 1QKIA 3ANNA 3D4NA 3KBOA 4U0KA 4U0JA 3RC1A 4YJGB 2GSDA 3RIHA 4W9NA 4CM7A 5K6AC 3UGKA 4G5HA 3IJRA 3O9ZA 3RC7A 3Q2KA 4CM4A 1KVRA 2CVQA 1B8VA 1TA4A 2J5QA 4N5NA 3UUWA 2Y0EA 2J3IA 4RZIA 1DC5A 2R6JA 1U3TA 3W8FA 4CMJA 1QLHA 2WE7A 4HKTA 2X58A 5MDHA 1X14A 3OH8A 3JQ8A 5U4QA 1YWGO 4BQPA 1O94A 2EKLA 4Q3CA 2A9FA 1YQDA 1YBAA 2PZMA 3GEGA 3ZHYA 2QIOA 4E5MA 2VHZA 4JJIA 5CDGA 1G6KA 4ND2A 1E3WA 4CLXA 4BNIA 1X1EA 2YYYA 3WYEA 4FFNA 3QRWA 3ZU5A 3TZCA 2EV9A 1Y8QA 3S2FA 4DIBA 2W2KB 2XOXA 2BFAA 3T7EA 3PVZA 1JLLA 1OC2A 3G1UA 1A9YA 1LDYA 4KUHA 1IYZA 1W0CA 3AOGA 1BRMA 1P74A 1PGQA 1W6UA 3BHMA 3D3WB 4YAJA 2CSUA 5B37A 2EEZA 1DRWA 5TS3A 3PGXA 5JLAA 1BG6A 1Q7BA 1YOVA 4PGFA 4Z6KA 5DOZA 4DBVO 2UUPA 2HO5A 4K9DA 5ILGA 1BHSA 1EBUA 1JA9A 2DUWA 3HUDA 1NFRA 5L7WA 3Q2IA 3HN2A 4S1VA 4ZQHA 4B8ZA 5JC8A 1QORA 3JQ7B 3BMOA 1XQ6A 3RUCA 3QA9A 2X0NA 1R12A 1ZO8A 2VN8A 2Y1OA 4JCOA 3ZDFA 4INAA 2AEMA 4GGOA 4J1NA 3F5SA 2WM3A 4R51A 2EP7A 5T8KA 4BNFA 1BDMA 2YJZA 4XB2A 2WSBA 1XLTA 1DFGA 3VH1A 1H2BA 1EMDA 4WLUA 1WW8A 2AE2A 4RV9A 3WLFA 3TFOA 3LC7O 3GOHA 1GEGA 2HMSA 2P91A 3MTGA 1I3NA 3V5NA 4E2ZA 3ZNOA 1YS4A 3C1OA 1PU2A 2AEFA 4XQGA 3EGOA 4XCVA 3W6ZA 2LDXA 3WX0A 2VYVD 4LK3A 4CM6A 5JY1A 2PGLA 4BKUA 3KYDA 3U0BA 2P5YA 2C59A 4CM9D 3WGZA 2WYWA 4NDNE 1Y81A 4KQWA 2DLDA 1GFSA 4FGWA 5JDCC 5H81A 4AJKA 2A35A 2DUUA 3DHYA 1CDOA 3RBXA 3RKUA 3WYCA 3GNTA 3DZJA 2UVDA 1QR6A 1TT7A 1IPEA 2HJRA 3H5RA 2JL1A 4CJXA 1LA2A 2JD1A 4A7PA 5TJHA 4WLEA 1I30A 3E1KA 3DL2A 3K2EA 2PZKA 5LC1A 2EP5A 2DQ4A 2AE1A 1UZLA 2CDBA 4UUOA 3MJSA 2EERA 1CQIA 3WIDA 2JD2A 5L4NA 4PG7A 5A9SA 4P22A 3WICA 4CMIA 1E5QA 3E48A 3EVTA 1B15A 4OSOA 3GVIA 4IZIA 4R5HA 3VVBA 4EJ0A 3ONEA 2DBVO 5JAZA 3ZNPA 1PZEA 4MP3A 1ZNQO 3FBTA 3MJEA 1KS9A 4CPDA 2E82A 4IXTA 4XKJA 2A94A 3HZZA 3GFGA 3HFSA 4EYEA 1E7MA 4EJ6A 4OM8A 1B0AA 4I9NA 3WJ7A 3DMTA 2GZ3A 1E77A 4NK5A 1UAYA 1GUYA 4CMHA 2JCVA 2DBQA 3H5AA 1N5DA 3DDNA 5EQDA 5B4TA 1E0DA 1C0KA 4UEOA 4IDAA 4RQUA 5TSDA 1AGNA 3WGHA 4ALMA 3ETEA 4GWKA 4DL9A 3C7DB 3QP9A 1ADGA 4GX2A 3OSUA 5BT9A 3LT0A 3ZV3A 3OICA 3GVHA 1QRRA 3FPCA 2VRCA 4R3WA 2CF5A 3QWHA 1BVRA 2AXQA 3DQPA 1O89A 4Y9DA 1HEUA 3GR6A 3PDJA 4EUEA 4YRBA 4QSMA 5IG2A 4FC7A 2PA3A 3UKOA 4ONEA 3PLRA 3V2UA 3ZN2A 4CLEA 5DT9A 3WSWA 2RHRA 1FDWA 2GN9A 3MOGA 1YJQA 2FSVA 2FP4A 4MKRA 1GZ3A 2GASA 4IXWA 3AUUA 4PLGA 5U9CA 5HTOA 3LZ6A 4J1SA 3U4CA 4EJMA 4WE3A 1NXQA 4GLLA 4IUYA 2HKIA 2EGHA 1I2ZA 1FF9A 3GEMA 3M2PA 3LLVA 4RVSA 3WDSA 2QYSA 3D4PA 4C7KA 3VZRA 4J9UE 3MJCA 3H9JA 3C1AA 4J6FA 5ITVA 5ENVA 5KJ6A 1T4DA 1NM5A 1PGJA 4B4UA 2CF6A 2Q46A 4XYMA 1DJQA 1GCUA 4H7PA 3RUEA 3SLKA 4JGBA 4PLWA 4KP7A 4KTVE 3QV1A 1HDXA 1PGOA 4L4XA 1DIGA 3CPSA 4CM4B 4B8WA 3DZBA 3ANLA 4ZVVA 1C1DB 3OM9A 1R0SA 4O0LA 4ND1A 1LSUA 4XR9A 4BNVA 4E0BA 4CQLA 1NQAO 1E6UA 2HLPA 3P2YA 2AHRA 1KVQA 4MVJM 4PLVA 3KB6A 1FK8A 4HNGA 1HZJA 4DLLA 4FN4A 5JCXA 1H94A 4R69A 3RUIA 1R16A 1UXKA 5IZCA 4H3VA 3RD5A 2YV3A 3GMSA 1MP0A 1I24A 5IDWA 3DBHA 3KYCA 1U9JA 3VZSA 4QFDA 2BGLA 3IS3A 3G79A 1Q7CA 4B4OA 3KSDO 4JQCA 5L40A 5KTKA 4NJMB 4XIYA 4RLHA 3WMXA 3F6YA 3VTFA 2VTEA 3GZ4A 2CUKA 2DVMA 2O23A 2PY6A 2YDXA 3WGOA 4CV2A 3O8QB 2J3HA 4BL5A 3ROQA 1YL7A 4ILKA 4ND4A 3CH6A 4MVJF 4C7JA 4TVOA 4CUKA 5B4UA 5ENDA 4UEJA 9LDBA 2Q50A 4XQEA 2YUTA 5TC4A 4D43A 3FNHA 2JHFA 4FD3A 2Y1FA 4FJ0A 1HDYA 1MUUA 2WYUA 2ZB8A 1WVGA 4WLNA 2PKQO 2UV8A 1E3IA 3U4HA 2X9GA 4R54A 1SBYA 2O4UX 4W7IA 1PIWA 2EWMA 1PQWA 3VDRA 5IN5A 4AICA 2HK8A 4BO1A 4CLRB 4AFNA 4D41A 5L7TA 1KERA 1ZFNA 4MIOA 4OQYA 2PNFA 1XIVA 3NV9A 1M66A 1IZ9A 3PWKA 3O8QA 4GVXA 2BFOA 3GMDA 4DQVA 4XYLA 2J3JA 1ORRA 2YHIB 2CY0A 1P0FA 4KWHA 4YQYA 3GY0A 3WGIA 1PJ2A 3L6DA 4E2WA 1X0XA 2ZCUA 4FSHA 4BNXA 2FHSA 3QVOA 4R1TA 4BO9A 1PR3A 2CDCA 3BYZA 1GU7A 1ARZA 4ALNA 1NP3A 1Q0QA 3MCVA 3QE3A 1EFLA 4IIVA 4AJNA 1YQGA 3AK4A 5AYVA 3BHIA 1OFGA 1V3VA 4K6CA 1BXKA 1R0LA 3QWAA 4NQZA 3CIFA 3I9OA 3JQAD 5TT0A 1HE5A 1SEPA 2X8LA 2DPHA 1P0CA 4I8XA 1IE3A 4JBHA 4ZHSA 5G4KA 2VCYA 3OIDA 3VTZA 4M89A 2ZTLA 3GDGA 4QO7A 4GSLA 3TFQA 4RJTA 5DBGA 4L9RA 5JDCA 3BA1A 4M86A 1AHHA 4PLHA 4B3HA 1P1FA 1GV1A 4D3FA 1N8KA 1WP4A 4J4BA 1VL6A 2YDYA 4IDDA 1T24A 3ORFA 5JAQA 2BD0A 1W73A 2D5CA 1NQTA 1DJNA 1DBVO 1X7GA 3DZIA 5GZ6A 4CQMB 4E5NA 1I2BA 4KTTE 3TL3A 3ZU3A 2B5WA 1E3EA 1B16A 2GO1A 2X0RA 1NYTA 3ZH2A 4XJSA 4YJHA 2FWMX 2YY7A 4IS3A 2D8AA 4DIOA 3MTJA 5A4DA 4CMEA 3OQ1A 1JAXA 1AHIA 3GG2A 2NTNA 5L95A 5DF1A 1J5PA 4K26A 1KVUA 4PRKA 2XF8A 1YL5A 3KYBA 1VI2A 3WR5A 4J2OA 2YFQA 3H3JA 4ZU3A 3KHUA 3D7LA 2NSDA 5B4VA 4YT5A 2BMAA 3TPCA 2AG5A 1AXGA 5A03A 4BNYA 4NMHA 2A4KA 4TZKA 3JQAA 4DPKA 1HSZA 1RM4A 1RM5A 3IP1A 1SOWA 2D3TA 5BNIA 3GRKA 5DDIP 5L4LA 2O48X 3GDFA 3I9MA 3ASUA 3KSUA 1YONA 2AW5A 3ZWXA 1U7HA 5I9NA 3UFXA 5I9LA 4CLDA 4BNUA 1ZK4A 4BKRA 6LDHA 4ZN6A 5AXAA 3I23A 4DC0A 4HV4A 3MJTA 6ADHA 1TXGA 1O8CA 3I5MA 3KYDB 4RQTA 4GPD1 2NVUA 4RDIA 5JYEA 5DOVA 2CVZA 3KRTA 4CV1A 4EZBA 3GEDA 2EKPA 4J1QA 1VJ0A 3RWBA 4O63O 3GT0A 1NHGA 1UP4A 1DHRA 1ZK3A 4E31A 1DEHA 2RHCA 1U3VA 3INRA 1YDWA 1LRKA 1O5IA 3BMOB 1EVYA 3TWOA 1KBZA 5BSEA 3KEOA 1L7EA 3H9EO 5I7FA 3RCBA 1P1IA 3DBLB 4J7CA 2I66A 4BOYA 2VOJA 4FFPA 3TJRA 4B7XA 2PV7A 5T5QA 4D42A 3PEFA 1K6IA 4X54A 4MINA 1HYGA 5EMHA 4TVBA 2WD8A 4MO2A 4GX0A 4RPKA 3F1LA 5TGDA 4DPMA 2ZYGA 1LDNA 1PJBA 1T1SA 2D1YA 4OIMA 2WD7A 4QT0A 1VJTA 2NVBA 1V8BA 3FRJA 4J4HA 4BO8A 4Z3KA 2BLLA 4QEDA 4N18A 1GY8A 5AQ1A 3LK7A 2ZTVA 2I65A 4AJEA 4AJOA 5CAEA 5A5FA 4RVHA 2G82A 1WAMA 4BKOA 2PK3A 3V2GA 2FR8A 4YQZA 1LC0A 4CV0A 4FC6A 2G1UA 1LC3A 3PRJA 4MVJG 3DOJA 1BXZA 1ENPA 1GZ4A 2X9NA 4D3SA 5A3JA 1GCOA 1D8AA 3H2ZA 4MKXA 4NBUA 4MP8A 2QYTA 2Q99A 4IZHA 5COBA 4FFOA 2IYOA 2CNBA 3H9UA 3KZVA 5EQFA 2HRZA 2EJVA 1JU9A 1MG5A 4GKBA 3RASA 2B69A 1K89A 5CG1A 3ZCXA 2WYVA 3F46A 3DXFA 3KLMX 1T2AA 4W7HA 3KTDA 5A9TA 2WWRA 2NUAA 3DBHB 3KYCB 3N58A 4AJHA 1Y9EA 5L53A 4ZJUA 3E5MA 1NR7A 1P77A 1X7DA 2VZ0A 4YAEA 1I2CA 3Q6IA 4NFYA 2Q2VA 2GCGA 1ADCA 3GQVA 2W90A 3GPIA 3OETA 2ZB4A 2QG4A 1U3UA 4HFJA 1I8TA 5EN4A 5KVVA 4IY1A 4BO2A 3CZMA 5IF3A 4WEOA 1YB5A 3RC2A 3ZV5A 4N5MA 2DTEA 4OL9A 4BV9A 3JQCA 1SNYA 3KUXA 1DIRA 2OL4A 3IDSA 4IINA 1I5RA 4XX0A 5DULA 4E5PA 5LDHA 4U6QA 4WJZA 3E9NA 1HT0A 4QO8A 4Z9XA 4YAKA 1LDMA 4ITUA 3OJEA 5KWEA 3AFMA 4FGSA 2WJPA 1VKNA 5BQFA 5JS6A 4Y6PA 2R2GA 5BSHA 2JAPA 4O5OA 2G0TA 3WTCA 4EEXA 4EEZA 3DB2A 5JAMA 2ZATA 4E12A 4UUNA 4Y6RA 4WNIA 4BO6A 2Z95A 3QWFA 4F45A 4RLSA 3UF0A 5DP1A 2ZTMA 1DAPA 1HE3A 4EW6A 3KSZO 1YL6A 3I4CA 1R4MB 3DWFA 3TSCA 3NAQA 4IGFA 4U7WA 1YDEA 1LJ8A 1VE9A 3CXRA 4GWGA 2PZJA 3PJDA 1NHWA 3WQQA 4G2NA 5FF9A 1IHYA 2HCTA 1E7YA 4CV3A 5DBIA 3LC1O 4L75A 1UJMA 3OQBA 4LW8A 3DBVO 1ZEMA 1TT5A 1O95A 1X1TA 1X0VA 3JYQA 4BO3A 5JSFA 4HWKA 1UXIA 4YJHB 3S8MA 4WLVA 3JQGB 4ESOA 1Z73A 3PP8A 1CIVA 1XU9A 2JD0A 3QLJA 4ZD6A 2Y1GA 1MG0A 4A2CA 1Z75A 1NX6A 4RCVA 1C1XA 2Y0DA 3SBOA 4NBVA 3WGYA 1B8UA 4K28A 2YV1A 3CMCO 5I9MA 5C7LO 1WLYA 1QP8A 2P4QA 4FPXA 3JQBA 2YW9A 1OAAA 2A92A 4WASA 3ZWOA 1F8FA 3P5SA 4RF3A 2ZIZA 1Y5MA 2X5OA 2X23A 1V6AA 5U1PA 1A7KA 1B14A 3ROMA 4MVJP 3PZBA 4GL4A 4DGSA 2NU6A 1N7HA 3PQFA 4WCFC 5BSFA 1JVBA 3PZRA 4Z9YA 3G3EA 4A5OA 2QQ5A 1EUCA 3DTYA 3DMYA 4R1NA 3SEFA 4NH4A 2P9CA 1YRLA 1PZGA 3OEYA 1DLJA 2HMVA 3BMCB 2GD1O 3BXXA 4XD2A 5AXCA 4CR6A 1K0UA 4ALJA 3GHYA 5MGBA 3GVPA 2NV6A 3NUGA 1F0YA 1I33A 4D7AA 1PQPA 4YT8A 4ZRMA 3WMWA 1RYDA 1U8FO 4J7XA 4JIGA 5CDTA 3DZGA 3OECA 2HUNA 4YAIA 1A7AA 1RM0A 4BS9A 4WCDA 3QVTA 1R6DA 3RVDA 1TB4A 1EVIA 4E2XA 4FFLA 4UVHA 3F3SA 2ZYDA 2J8ZA 1ZEJA 1UP7A 2VT2A 3FD8A 1P1HA 4LGVA 1HDZA 5BSGA 4BUCA 8LDHA 2EW2A 1FDSA 3UXYA 4FCCA 2C07A 4NFSA 1QG6A 4WCFA 1DDOA 1LLDA 3IUSA 2EKQA 3UN1A 1Q0LA 4DTIA 1Z7EA 2G5CA 3AW9A 3OF2A 3QSGA 3U49A 1AUPA 1XEAA 1X13A 4FW8A 1KEUA 2QRLA 3ST7A 4EUFA 3RUAA 4IQGA 1UAGA 1Z7BA 2WDZA 4ND3A 2G76A 4LISA 2TMGA 4YT4A 1LSJA 4DBZA 2V7PA 4DVJA 1J6UA 2I5PO 3I3OA 2X0IA 1I36A 2BRUA 2IE0A 4BGUA 2Q49A 3DHEA 3IP3A 3ITKA 2NVUB 4BQRA 2WE8A 2NNLD 1HWYA 3H3FA 4BHTA 5L7YA 1NPYA 3ROKA 3TDKA 3WGGA 3VPHA 4ZQBA 4HUJA 2AQHA 2EGGA 3V1YA 1HLDA 3GAZA 4GLOA 2H6EA 3G17A 3WOHA 2I3AA 3RROA 2EIHA 4BNHA 1A9ZA 1U7TA 3INGA 4HX5A 3FWNA 4OGWA 5CPBA 4BIIA 1ONPA 5A3VA 1N1EA 3VPXA 3F5QA 4QFCA 4R41A 1XG5A 2LDBA 3AFNA 4CM1A 2TMDA 4FQ8A 3PHGA 2D5AA 1KEPA 1UXHA 2FMUA 3Q3CA 2IZZA 4I5GA 1Z45A 4RF5A 1E3LA 2O7QA 3RAJA 2VWQA 5IDXA 4AL4A 3IAHA 3GDOA 4U6SA 4CMEC 3GAFA 3VZQA 4CR8A 5J23A 4MIEA 4RO0A 3AM4A 1DB3A 2E48A 1BVUA 1NBOA 1R37A 1T1RA 4W6ZA 4W9NC 1L1FA 1LLUA 1YO6A 3MWDB 3DBRA 3GVXA 5CDYA 4MVJE 3LT1A 3S55A 1AE1A 3JQ7A 1VC2A 1Q0HA 1SAYA 3ABIA 3EK2A 4KUGA
chains in the Genus database with same CATH superfamily
3GUYA 4CQMD 4NR0A 4BXOA 2A1IA 4F60A 3MGKA 4AG3A 4YYZA 2AX3A 2O8NA 4EGJA 2CUNA 1N5MA 2HPAA 1PX2A 1OI7A 3NWBA 5C8YA 4TMFA 3TOZA 4DWJA 5IANA 2OFWA 2CKDA 2RK3A 1XCLA 3BTSA 1LJUA 2PIDA 4LFCB 4A8TA 2F64A 5CW1A 3VO2A 4L0DA 3PGLA 3RS0A 4UATA 3W05A 1N78A 2GWRA 1KYYA 1KQOA 1VCNA 3N5CA 4DOMA 2GZAA 1ZCFA 2ZBFA 3WWEA 2GKGA 4BBAA 5SICE 3VOAA 1AKWA 2VYVA 3FUUA 2GBPA 3L0YA 4WFKA 3VI4B 3EXEB 1E9VA 3OT1B 5KWIA 2OBLA 1U2DC 5M7EA 3IPXA 3LW7A 2BEVB 3NBKA 5EIBD 2PKCA 1ID1A 3EMBA 3ZTYA 3FF4A 2FHPA 4BX2A 3H2KA 4NK4A 4W5WA 4DQ0A 3GGPA 3FYUC 1IEQA 4IIGA 4R68A 4Q3LA 4TN5A 3V00A 5FFMA 1TOAA 2VP9A 4WZAE 3QVLA 4H7KA 2KW5A 3MLAA 3PX2A 1YHNA 4M6WB 4ZT3A 3WRYA 4ZTZB 5ELMA 1MAAA 3PXEA 1T6XA 3D8TA 1SCUA 5TR9A 3SCZA 5DIFA 3MS2A 4CM5A 1NN1A 2EATA 1ZR4A 1CDZA 2P2ZA 1A27A 1ZOPA 2SKCA 1J00A 1YDHA 2QD4A 3AT1A 4NWIA 1BXRA 5F2OA 2GJSA 3KALA 4CKEA 1QXSA 1B0UA 5FUXA 2J9ZB 3BCHA 1H5UA 1XAJA 2KB0A 2IIQA 2Q5OA 2Q5LA 2ZZKA 3EQZA 2DUMA 3AP2A 4WFIA 3G02A 3LQYA 2R9VA 3SFVA 1TC2A 3KXDA 3GP3A 1RHJA 4O2AB 3A05A 3MCWA 3WRVA 1WCXA 2D0IA 1J1UA 1UEIA 4YTEA 2ISSD 4INPA 1MRNA 4OLAA 1HURA 4FFDA 4XWYA 2I2CA 4GLJA 2WNHA 2RIRA 2QX9A 2XUJA 4OI1A 1AXRA 1FP4B 1IATA 1Q3HA 2GLUA 1O96B 2QPAA 2ZJ6A 4I9UA 4EMSA 5C5CA 5REQB 4JVOA 1U4SA 4D74A 1MLDA 1TQ8A 3BK1A 4UM7A 1NIPA 4CL2A 1Z0AA 2PMBA 4Y0AA 1QE0A 4KFSA 5TMBA 3ZDZB 4MPTA 2AEEA 4O59O 3AHJA 1TYAE 3FFTA 3LNTA 5DSTA 4B0OA 2V54A 1WXWA 2OLEA 4IFBA 5KOJB 2DOKA 3CURA 3P96A 4IUDS 5EG5A 3VBCA 5EJ4A 3SG0A 1BD4A 1T35A 3OPMA 2VZ8A 2X7XA 1M2FA 3F49S 2HHAA 3L7CA 3SBDA 5AI6A 5FYQA 2OP1A 1KO1A 1E2HA 3ZCUA 5J3JA 1C5KA 1KC3A 3DC7A 3EW9A 4BNJA 4JYZA 2N46A 2PU5A 4F93B 1J9GA 3R6LA 3U37A 1ID8A 1CQPA 1Z8FA 2QRJA 3ILSA 4UD6A 1TTHA 3P2MA 2QLBA 5F73A 3VPSA 1YKFA 1PJ3A 2VNJA 1YI1A 4F56A 1UP6A 1SVNA 1W8DA 2V7VA 4HDNB 5KJCA 1T2DA 2FLWA 2PU7A 1M6HA 1X7WB 1JEJA 1VJ1A 1YB2A 1GTL1 3K16A 2WIGA 4IPTA 1GM5A 4HLUC 2Q6TA 1R50A 1CLUA 2WPNA 1HT2E 2B3DA 3WLHA 5CU7A 1W75A 4G6ZA 5EJ9A 4ZI7A 2XUPA 1KC1A 3I01A 5JV5A 2D8MA 3EMKA 1WLSA 2G25A 1CJMA 2ZXFA 3A8TA 1B0ZA 5F98A 1ZLXA 4LRXA 3T1YB 5A06A 5CA1F 1V5EA 5C8DA 2FB9A 3NDIA 5HKBA 1QTRA 4Q03A 1PFQA 3RT9A 1IQRA 1JLHA 1JH8A 5CB4A 4HNSA 1CHNA 1JYEA 5LB4A 1B6SA 1L7BA 1QGOA 4NU8X 4TM7A 1XN1A 1TX4B 5DU2A 1GL9B 1KFJB 2G4VA 4FCTA 1S9DA 2ZJOA 2P5SA 4XUDA 3Q9NA 3VJRA 4QGAA 2QRPA 3G2JA 4GOKA 4KIJA 2IEBA 3D2AA 2FWRA 3JQQA 1DCKA 1UMBB 2QSYA 4L95C 3IBCA 5JZ9A 3O2SB 4MRMA 4N7RA 4I1RA 4IHAA 1Z35A 4J1TA 1NQUA 2FW8A 3DMNA 5JUWA 3FTNA 1C9NA 4XYGA 3NFYA 4CG3A 1LPOA 3CEAA 5CD1A 3AEUA 3BZUA 2R1VA 2WM8A 2JFWA 3VU9B 4YXFA 1W85B 3C70A 3EXHA 1NJ1A 3U7RA 2F17A 2GO7A 1LXCA 3MUEA 4PHTA 4DIUA 1V0JA 4BMNA 4N76A 2JIBA 5B6IA 3QW4B 3NVKI 3PUZA 1Q44A 1TA0A 4HJRA 2IYFA 4MQFB 5LWQA 2E49A 3ECSA 1ULBA 1ZRMA 1CKEA 4NOKA 4X5OA 4ZVQA 4BQIA 1CB0A 2C8KA 1N5OX 3KJEA 4DR4B 2EW1A 3VU8A 4EATA 3RTEA 4RVOA 3MWGA 1RPZA 4GEKA 4BN0A 1RZVA 2H0QA 3KZXA 5JH7B 1GRRA 3E27A 4HT3B 1KP2A 1LBIA 1SR8A 3N2GB 4TM8A 1Y6FA 1K66A 3GP5A 4M1EA 3SE0A 3A70A 3BD8A 3RC9A 4EKIA 1EDEA 1Q2UA 3NDBB 4YFVA 2P9ZA 4ZT6A 5I9IA 1BGWA 3CPJB 3AX6A 5H0IA 3LY5A 1B76A 4JOBA 1X38A 4OHMA 5EI5A 1U8CB 2AFHA 3IV7A 3HN7A 5LXTA 1UXOA 3JD3A 5K0EA 3RUHA 2HJSA 1NI4A 4EIWA 3V8NA 4OGGA 1M5RA 4AMYA 1B26A 3QKWA 4FOSA 4D0RA 3DOOA 3C7CB 1IBKB 4FYWA 1TM1E 3MLBA 2BGUA 1ECFA 1G1AA 3PDUA 4JP5A 2GDJA 4DV4B 3CO0S 1OKKA 1DPFA 2G9RA 4O0MA 4N9QA 3W6OA 5KYYB 1ODKA 3ONNA 4NYMR 2LNDA 4QFMA 3JQ9A 4IIJA 4QQKA 4BVFA 1DKNA 5EP3A 1JLLB 1EJ2A 2HPVA 4FR5A 5IWCA 1CUBA 1D4OA 1NWHA 4PIVA 5TQ2A 2HY7A 1JQDA 5DNAA 3TF5A 1A71A 4IVPA 2YWHA 1DAOA 2H3HA 3PC3A 1Y7TA 4JENA 2R48A 3ABRB 3WXMA 4RKYA 1N1MA 4RGQA 4DCVA 2ZWAA 1CERA 4LPKA 5DRTA 5G0WA 3G5LA 3ZWWA 2I6XA 5L3SB 3F4BA 4KK4A 3D3JA 3GQBA 3UJBA 4F97A 4H0FA 3D1VA 3KOZA 3DLBA 2QRHA 2YNMC 3KXPA 2O8BA 3ZGNA 1KVTA 3M9LA 1NMSA 5ES3A 3E23A 4NU5A 3QHAA 3C3DA 2PO7A 5ICSA 1L4UA 2XYRA 2QJFA 3I2FA 2II6A 3P0HA 2W6NA 3AO0B 2ATCA 1RKXA 3PYLA 1EVKA 4QLBA 1A9XA 4U7JA 4IG9A 2FDCA 1YB4A 4HP8A 4JLUA 2J6BA 4A8PA 1N2XA 1S2MA 2PGJA 2WT9A 4OQFA 5JCJD 2ZVJA 3EIFA 4IVQA 1I1HA 4Y98A 2REQA 1XJWA 3EIQA 2FQXA 3FI9A 1D9XA 3JQEA 1U63A 2FN7A 4NEQA 2AWNA 1P1RA 4OQEA 3NTXA 5CR9A 5FPQA 1OB5A 3KM0A 3C7KA 1MTZA 1YR3A 2GWHA 2P9YA 4B6OA 5EE1A 3OLCX 1T9GR 2YY5A 5DN9A 2PWAA 1D0SA 4I81A 2XPCA 4DV1B 1GQQA 4JLOA 4Q3EA 3ZV4A 3CZPA 4CDGA 4EKDA 1DZ3A 1GPMA 1HZZA 2WZBA 3BFJA 3DMFA 4U2BA 1IJBA 1U8XX 3OCYA 4CTKA 1Q2XA 3NOQA 1Y1TA 5EPUA 3IO5A 1HTWA 5I4KA 5JJBA 1KGDA 1O6FA 5FFNA 2X6TA 4XJXA 4W5RA 2WF9A 4IMIB 4II3A 3MILA 3ZGYA 5KTRA 2BH9A 2I1LA 2K2QB 3Q2OA 3NHMA 1E66A 4L4SA 3ICPA 3T7AA 4RU1A 3D3EA 3ZXSA 1KYVA 2A5JA 4MKGA 3DE1X 4QOFA 2RAFA 5ELXA 2BP7A 2BEUB 1M10A 1DXHA 2A0XA 2XGGA 2B0CA 3JQFA 2KPOA 4R16A 5EE0A 5EUCA 4LF9B 4XGNA 1L4BA 1PI3A 1MOZA 1Y82A 2IFTA 1SCDA 3KDPA 1KO5A 1Y9DA 3CLSD 1BCRB 1UBTS 6CHYA 4O4HA 1V8DA 6PFKA 2HHJA 1A0OA 1YRHA 3H8VA 4RDHA 4KFCA 4OLJA 1T6YA 4QXQA 2POQX 4ZYUA 2ZUWA 4C05A 1WIWA 2QTBA 1QYRA 4JHXA 3RS7A 3VHLB 3I5YA 4L6CA 4UVGA 2C88A 3TCXB 2QZSA 2FVYA 5KVSA 1WU8A 2UKDA 1E3DA 2GTHA 2WSSD 3HVUA 3K6RA 3U81A 3FCCA 3HNRA 2P6PA 2B4QA 2QJRA 5EZYA 4AF6A 3IAM6 3LY9A 4PCUA 2B0JA 1X7XB 4ARBA 3PPIA 2J9FB 4RPHA 4TTRA 3RS2A 2J6IA 1LU9A 4NV0A 5C80A 4WH0A 2RARA 1LV8A 4B2YA 3RDPA 1EHCA 1L4FA 2FMXA 3QFSA 4RTOA 1X7ZA 1UWVA 1NRXA 1PLJA 3HXOA 2IUTA 3NTRA 4EUHA 3FWYA 5AESA 5LMZA 3NYRA 2HO4A 3A4TA 4EWLA 3GLUA 2PSDA 2XQKA 4RIHA 3FYTA 2VRWA 4NHEA 3NAMA 4RHCA 4M8SA 1RYNA 3REFA 3R5FA 1KI3A 3S7TA 1JV2B 2NSYA 1E2LA 3K6KA 1Q92A 5C7IO 4UHDA 3DMRA 1KXZA 1B8PA 3ON5A 4BFLA 1KI6B 4WNCA 3WNDA 5ADHA 5JQGB 2PIAA 3SQLA 3BGSA 2DHDA 1N57A 2Q3EA 3HO1A 1UBNA 1UT6A 4KAAA 2BGGA 2UZ1A 3HQ4O 2GCOA 4PG5A 3BBPA 2W11A 3OZEA 2FYTA 5JARA 5TIIA 3HV2A 3DFFA 3JWEA 1X7HA 3QBEA 3V1UA 5TX7A 3DO8A 1G7SA 4ENTA 2WVAA 4IICA 4KFUA 2QJOA 2R4TA 3AF1A 1BE6A 1NBAA 1N9KA 4FWTA 3PUXA 2WD9A 3WC4A 1JIVA 5K8TA 2AOXA 1KVSA 3CS3A 4D3ZA 2FFRA 2PD3A 1MXFA 1T6NA 2BJWA 2ORVA 4GZ5A 4IGEA 5CW2A 4B85A 2FSIA 1XD2B 3D5TA 4Y18A 4PG8A 3WGLA 4AECA 4HI0E 4I3GA 2AFRA 5ALVA 3MBOA 4I19A 1UJ2A 4DSZA 1QPGA 4I2NA 3QOWA 3X3HA 4CU5A 1O4VA 4QBTA 3SBEA 2NZWA 4NMXB 4AF8A 4J6EA 1JS1X 1N1GA 1Z88A 4N0EA 5DCLA 4QUKA 2Q4RA 1B00A 1QYXA 3WBFA 4I4IA 1SBQA 4D3DA 2FZKA 2ZYSA 1DJPA 4A27A 3EA4A 3N6XA 2Z8YM 4NBTA 4GVPA 4BKPA 1PUIA 1IWOA 4HQ0A 1ZIPA 4J0QA 1BDJA 2AMJA 4U2EA 3OG9A 5DCYA 3ZKWB 2NXEA 3IB6A 4ACAA 2PT6A 2XTZA 2OP0A 1SB8A 3OU7A 2Z83A 5TQ0A 4GKJB 3HDJA 4HWPA 4E7PA 3MTBA 4JJZA 1OTHA 2GJ9A 3UK7A 3PNMA 1XVTA 5COAA 3CZ5A 1C3JA 3B5JA 4YP9A 2WTEA 2X8JA 1Z2CA 4I5IA 5CLJA 4KIUA 3D64A 1U9IC 1W47A 3E18A 3QE4A 3E9MA 4X6UA 5JCOC 2RH8A 5AH0A 5FP0A 3SXUA 2IYAA 3OPXA 2A5LA 4G9GA 3U1TA 1KIFA 1CE8B 5EL0A 1K7XB 2ECOA 3G82C 4IOJA 1KJIA 1ZUWA 4J0KA 4JASB 4QL3A 5HA5A 3B8EA 3VC7A 1NJGA 3VVMA 5JPCA 4NBRA 4B3TB 5BN3A 3L84A 1BMDA 3FF1A 2HLDD 3RGGA 5A2QA 5H70A 4Z51A 1ZCJA 1MQAA 4KI7A 4BMPB 1BJKA 4M36A 2GBGA 4CYMA 4R9UC 3OZXA 2CHVA 2ONYA 2DFVA 1KDYA 1OBFO 1ZK1A 3OT4A 1UT5A 1UDXA 4HNHA 4R0VA 1EBBA 2APJA 2WV7A 4AM8A 4EB6A 3I2YX 4LS3A 2JFYA 3BKXA 1EUZA 4O33A 4UDNA 5LQDA 1J70A 2R6ZA 5HG0A 3INTA 1ES9A 4U39A 2IY9A 3GL9A 3G2NA 1J07A 1JHQA 3ONWA 1GNRA 2ZYRA 4INJA 3SSNA 1RMQA 3MMPA 3WJAA 2IIVA 4EHDA 3NW9A 2PUHA 3AHIA 1XMOB 2D1QA 2EZ9A 4B46A 3N2GA 4AN1A 1GRCA 4CIVA 3Q6MA 3W5JA 2YUIA 4EF4A 1HMYA 3GJ0A 2AXPA 1T4CB 4BLVA 2GAIA 1IB6A 2ATIA 1NQXA 3MJRA 3W9BA 2ZCVA 4NXMB 5IVDA 4G4GA 1U1IA 5T67A 1CZKA 2NO0A 2OVBA 1MFZA 2QQEA 2NUTA 5L4SA 1K75A 1QRAA 1M34A 1ISGA 2QG9A 3GRAA 4IGIA 4S1TA 3UPDA 1PL6A 1VSBA 3QVVA 2ZUBA 1TZCA 3VISA 1VOTA 2Y0CA 1MHPA 2H57A 3BWDD 3G1WA 5G0VA 4YX9A 3UC9A 1FJHA 2BAGA 4WXRA 5JO9A 4DQKA 5FOXA 4KRYA 1ML3A 3FX2A 3BVPA 4DC1A 3STYA 1RBYA 3PXXA 1ORWA 4Z54A 2ZZMA 1DFHA 2CJWA 4ZAFA 4I2VA 3D6MA 3PS9A 4MV5A 2GLTA 2K87A 4PSAA 3SX2A 2Q3HA 2WKRA 4L6IA 3QVSA 2HW8A 2C7GA 1KK0A 4JP3A 3ROGA 2ZBVA 4K9MA 5TB5A 5IBCA 5A5GA 1GZSA 2CBZA 4GI5A 2XKBA 5LD2B 1TPYA 4KZPA 5CDHA 1OILA 5HIJA 3EGXB 2FWAA 1E79D 3VC3A 1ZISA 2GCEA 2GNAA 2IP1A 3H7AA 3HCCA 1DC3A 4LCBA 1TKCA 4GZ6A 4A6DA 1GU1A 3ILHA 3ABQB 1VHDA 2H9YA 4FHGA 3F1KA 1G8KA 3I9NA 4Q6WA 4M88A 2VSXA 3MJHA 3RT1A 3RYCB 3QU4A 3RU3A 4RTQA 3JCZA 2R8YA 1C3OA 4C0QC 4D45A 3R9KA 1QZXA 1HLPA 4CUJA 4LF4B 1DUSA 1Z28A 3MRXA 3SZ3A 4YRLA 1ZUNB 1JEYA 2VP3A 5KOHB 3D81A 3PIIA 1KSFX 2YHIA 3UYLA 4D0GA 5BMVB 4B8YA 5B1EA 1LTQA 3OPYB 1DTWB 5AVUA 1E1LA 1JIIA 4J29A 3VC1A 4QTZA 1JKIA 2GK6A 4P5PA 5J2UB 4WXHA 1E6KA 2VA8A 1NM5C 1QUEA 3ETDA 3N8DA 2HF2A 2VJOA 3SBXA 5C4MA 3SC2A 5MN5A 1MAVA 1ZM4A 2QAJA 2HC9A 2IHYA 3JZMA 4RD2A 4N39A 3R8CA 4HZIA 1FPMA 5H3LA 2GVDC 4EGCB 3TX6A 1FZQA 2ZJAA 2W6PA 2XHEA 2BOVA 4HG2A 4LJ4A 3B20A 2EOAA 2RH9B 3GLHB 2O3QA 4TTQA 1GAWA 3UAXA 4KXFB 5CFRA 3DCJA 5K03A 1CJTC 2VHUA 3JYOA 3W0LB 2QRVB 4GFDA 5DWQA 3TQTA 2OILA 5AUPB 4KAFA 3JWHA 1FLAA 3DXYA 4OK5A 1NLYA 5COQA 3FCOA 2VBIA 3QYAA 4KH0A 2OMEA 3L7BA 3ZEIA 2RHTA 4JUFA 3MMSA 1MD9A 3ZS9A 3NALA 3Q41A 2NU9B 3DHNA 5EJ7A 2ISCA 1OGIA 3LLMA 1VSVA 2O8EA 4F2PA 1T0HB 4D97A 4LJAA 3GCGA 1YB1A 1EDOA 4EPYA 2NMVA 4BAZA 1SVWA 1N2CB 4YEDA 4XRRA 5DH9A 1EM6A 3JQFC 1ILEA 3B3JA 3H8JA 4BLTA 3DEIA 2GD2A 1V1JA 1NN5A 2OFXA 2R8PA 1E3TA 3KPYA 4ZQFA 3VR3D 1VSQA 3NTVA 1WCYA 1MVOA 4M53A 1E20A 2GN8A 3JS5A 3RNOA 3VHQA 1EFCA 2YYZA 2J09A 8MHTA 2O8BB 3A6KA 1JIJA 4H1TA 3WGNA 4K9OA 4BAGA 2C2XA 2MINB 1PR6A 4GUAA 4M99A 5LFAA 2SKDA 1F2DA 3G7UA 1MGOA 2O2IA 2ORWA 4URFA 5AVKA 3SJUA 4RFVA 5THKA 3MCZA 1N3YA 3VYTB 2VNSA 4LJYA 4Z9FA 4O2BB 3BIOA 5E9AA 4EY7A 5KKNB 4PZUA 3IVCA 1FPQA 3TQRA 4C2TA 3PNYA 2GETA 1JW9B 2J3QA 2ZAIA 5EEHA 4P0QB 1KU0A 2QW8A 3DL4A 4LBVA 2D59A 3SJ7A 3ZJ5A 5IAKA 2WVGA 4TLLB 3VH3A 1W59A 3TLCA 1SOUA 4MQEA 3U3MA 4XASA 3LL4A 1JJAA 4FNGA 1XMPA 2J33A 5LOVF 4YUXA 5K6RA 3G2LA 1UBKS 4BWYA 2FLVA 3W7BA 1DEOA 3ANMA 3JR3A 4GOJA 4L8LA 4M2LA 1W4ZA 1V35A 1R1DA 2VSQA 4OJNA 1E2JA 3WQSB 1G17A 1EUQA 2PSEA 1S3GA 3RVNA 1T8WA 1UOEA 3M1YA 1YS9A 1EEHA 2CXOA 2RBGA 3ABOB 3B48A 3AETB 3BMCA 3L5OA 5CVUA 5CT5A 3HDHA 3ROXA 2HV8A 3LYLA 5LCXA 2QD1A 1SZJG 2WIFA 5EYPB 2RGBA 1PYGA 2AG8A 2NO4A 3IR6A 2YXDA 4OQXA 2RAUA 3WO0A 3C7TA 3FHCB 4GI2A 1BWSA 4UFOA 5BR1A 1USWA 2WF8A 3PD0A 1KKLA 4RK4A 1OQAA 1W46A 1GKYA 3M81A 3T3PB 3HYTA 5JS1A 5CM8B 1VKOA 1LI4A 1F3LA 3GGGA 3SP1A 5IVPA 3WAGA 4B2LA 4IQ0A 3U3KA 4L0QA 2QN8A 1T9DA 1JR3A 5K2MA 2MSWA 2AG1A 4O1MA 5JY6A 1RRMA 1HFJA 2GN6A 2HA6A 2JATA 2WTXA 1G21A 4WXPA 1EESA 5SYMA 2B4YA 3RREA 3UHAA 3VKVA 1IQUA 2MMGA 1T6BY 3KZNA 1OZHA 2HEIA 3AVVA 4HF7A 1FSSA 1LW7A 2ZYUX 3GRVA 1V5WA 4ARCA 4X85A 2QLTA 5CVEA 4EG7A 3T1TA 3W1VA 1O58A 3ND6A 2BFFB 2O2SA 4P34A 5IZ4A 4Q7QA 2UXCB 2VR1A 1M54A 2JCGA 2DERA 3IIEA 4II2A 4NNJA 3D1JA 5TQ0B 5F3RA 4DKXA 5CK4A 5C2JB 2VZ9A 3TVYA 4OXYA 3O8LA 1WNTA 2C2YA 4I50F 4KKXB 5KHOC 3SM3A 3R3UA 4UBKA 5J47A 3STVA 3QPAA 4OO3A 4F8JA 1HSOA 3WBKA 4LRQA 1FDUA 4RMNA 3PFNA 4G4SO 3HVKA 4J2TA 1LH0A 1MR3F 5CT6A 1D2NA 3GJ5A 4F6CA 4NMWA 1NW5A 2Q8PA 1UBGA 1GNLA 3DKPA 1O6CA 1V43A 4PGMA 2A78A 3BJMA 1CK4A 1NC1A 4YT2A 2HYDA 4MWGA 2FZGA 2HA3A 5FCDA 1KI6A 2IZ1A 5F5NA 1U2TA 3M6WA 3CINA 1E6EA 3REOA 3ESYA 1RQXA 1AQ6A 1UMKA 1JSZA 2HIMA 2ZJ0A 1PJSA 2DC1A 5ILOA 5F1KA 2G0AA 3OLWA 2ADFA 2DY0A 2QS9A 1N5LA 2QUZA 3A9WA 4C1BA 2BGKA 2FPPB 4WESB 4Q19A 5EXPA 3ENWA 4IGAA 1ZM9A 4WA7A 4WBXC 3RYIB 3TBKA 2MWMA 3TUIC 2IHNA 1JI0A 2H63A 2JFNA 4OG2A 4D1YA 8AT1A 3E0QA 4JJEA 3UWSA 4PZCA 2AD1A 4U4AA 4CM9D 1WCWA 3I5UA 4ZO6A 4FHFA 3ENQA 3VR2D 3QUAA 4D99A 3G5TA 3NU1A 5AXDA 1A9OA 4INOA 4E5DA 2ZRAA 3GG9A 3FIJA 4RENA 2IPLA 3C3XA 4DFDA 4JLPA 3ZWAA 5HDQA 4HUQB 1OT5A 2BBWA 1G20A 2C84A 1H4SA 3VXKA 1H6BA 1M2WA 3D8RA 4Y6OA 1YBVA 2DECA 2BFMA 3SKXA 1U7WA 1SZPA 3GNLA 1SKAA 3DP7A 5JI3E 5JADA 4GYKA 3BE8A 4G2TA 4IOMA 5EYPA 4GMKA 2Z5VA 2PRJA 4GS5A 1D9ZA 2GGSA 2GBFA 2XAUA 4Q1BA 4BNDB 1TZKA 3EDMA 1ESEA 2DCUA 3GJYA 4HDQB 1X3SA 5E4FA 3FE2A 4UHEA 1P2BA 1QYDA 4K6KA 3P2EA 1CEQA 2UUCB 1JJVA 4WOBA 2OCKA 2PMFA 4PU0A 2CUTA 3G5AA 3MOIA 4PAGA 3AESB 4UCXA 4MPPA 3KLNA 1GT91 1M6EX 4AJPA 4G5XA 1A4XA 4HDRA 4RZHA 2ZQZA 4QUIA 4MOWA 3KWJA 4ZJPA 2YWBA 2XDYA 1PGNA 2GI4A 3CSUA 5JALA 4P6VF 5EMKA 5KNBD 3BT7A 5BO5A 4UTRA 1YIDA 2VQ3A 5FPTA 3E9QA 3V9PA 3QBDA 4MR7B 4ZXPA 2F1OA 3ZY5A 1M2OB 4Q1AA 4NZMA 2FJUA 4OHWA 1XL1A 3LIIA 1JG1A 4KK3A 3H2JA 1JE1A 1U2EA 1EJBA 4XCQA 2GCPA 2QF7A 1XZEA 4O4LF 1GSAA 2GBLC 5CX1A 5BQPA 2ET6A 5AJWA 2ZIGA 2AN4A 3TQFA 4BNZA 4TL8A 5IXSA 3T5AA 2BGIA 2H4YA 4KDCA 1QDEA 2EU8A 3FR7A 4R40A 2ZSBA 4YDRA 4PO8A 3LBNA 1QIKA 3DUWA 3DZFA 1ZUNA 1UM9A 1XZNA 2H59A 3KCNA 1QH8B 2MSEB 3O26A 5DYTA 5F1OA 1LI5A 1GR0A 4R1OA 2DBZA 4MS1A 4WJKB 4RV4A 4Z49A 1AK1A 2QN2A 3OIGA 4MWCA 5JDIC 2Q3JA 4O3MA 3KSAC 1J99A 2EZ8A 3TIXB 4ABTA 1YGYA 1NVKA 3PL5A 2REBA 3Q7IA 4ECEA 4L7VA 4CIWA 3H42B 3FFAA 3PDCA 1EQAA 3Q15C 4EGFA 4Q9NA 3Q3GE 4ICIA 4XUCA 2JCYA 1MB9A 2C4VA 2AMFA 5CYGA 3O7MA 2HFJA 1EDBA 3K73O 5JU6A 3ORHA 3TG8A 2V8OA 1GNSA 2AA3A 4OSEA 4BTEA 2BFFA 2ODNA 4IIXA 5AK5A 5E2BA 4CM8A 3NIDB 1QYVA 1Z25A 1G9XA 4P82A 3ZZUA 1RYBA 1J2TA 3KU4A 3QJ5A 1RRKA 3BGVA 1F0KA 2W8BB 2YN4A 2J0UA 4IEFB 3VU1A 1NFQA 2DT8A 3N3AC 4OHRA 4XWOA 4OHZA 2ZTUA 3TQOA 3QMVA 3AVOA 4JMPA 4KV7A 1IPFA 2BT4A 3HU5A 5C8XA 4MWOA 5AKXA 3B1YA 1HLGA 1KO4A 3TVTA 3BF8A 1SKUA 4RE5A 2XZLA 4L8FA 3ZGOA 4A0SA 1HL7A 1N2BA 1P0PA 3ZWNA 2AJCA 5IEJA 4P8RA 1VL8A 3BJRA 2ETVA 1EVLA 4HLQB 1J22A 3HS3A 2PS3A 3IE0A 4BO4A 2QTRA 5KKCA 5IVKA 2Y2VA 4X94A 3KFVA 3MELA 5BSVA 3FWPA 3TJMA 2GM9A 3CUYA 4XSVA 1SBCA 2XB9A 1IZ7A 1GYPA 1WSDA 2P0YA 2IX9A 2FAXA 3PF8A 1OROA 1MOPA 3LSTA 1PYOA 3EXG2 4PAQA 4Q9AA 1U8YA 3BJIC 4Z2YA 3AL3A 3G0OA 2QVZX 4JVMA 3EGDA 5E6RB 3OAAA 3DO5A 3ZNPA 3ZXYA 1GOTA 3LCUA 3HGQA 2YYAA 3QPDA 3PQ6A 2PH1A 4M1MA 4WT7A 5CVJA 1YNSA 3AVQA 5AM3A 4L74A 2SCUA 4IX9A 3U09A 4MYTA 4AYXA 3LO5A 2IOFK 2EWWA 1FQOA 2FI1A 1E58A 2Q07A 2Q7XA 1G20B 4RETA 2OBFA 3GZNA 4FS3A 4DJDC 1KH1A 3GLIE 2EARA 2Q1UA 4K81B 2GNPA 2FOXA 1GA4A 3BFPA 5AWFC 4R3NA 1G6OA 2R7KA 2GF9A 2V6FA 1IOZA 2RKOA 4RGBA 2C0QA 3MRSA 3Q8XB 4JYCA 5B1DA 3T7CA 3KQQA 3ZLVA 1AMOA 1BU5A 1EE1A 1EFPA 1PNVA 2RH5A 4HAZA 5AW1A 3E8SA 4WZAB 3LUHA 4PCAA 1FW6A 2ICAA 2UYYA 5GGXA 3BWYA 4QYXA 1I0LA 4PGGA 4MEJA 3VH2A 4H7EA 4UOQA 3R3JA 1MC5A 3UICA 4CMIB 1IZZA 5ALOA 1ISHA 1RABA 1O6GA 3M49A 1PT5A 4GLFA 1Y4AE 1P91A 1XVVA 2F59A 2R8EA 4CHTA 1JFSA 3KVYA 1MVLA 2XE4A 3QOXA 3QFTA 1J4AA 3OTGA 3P0FA 3PXBA 3RFCA 4MYHA 1QG2A 5H4HA 5GIOE 1WCIA 4HEA1 2XMCA 4HDMA 3OJLA 3AEUB 2ZIVB 1GDHA 1UR5A 4Q7JB 3C7AA 1Z26A 4MI3A 1E3JA 2K6GA 4HDCA 3ABSB 3IJPA 4KVZA 5C35A 1Y5IA 4W9MC 1CY4A 4IRUB 3AHCA 2FW7A 2ZS7A 3RTCA 4E4RA 1M83A 5I7OA 4P4UA 3RF7A 2R7LA 2A1TR 1A72A 5HE8A 3TW4A 4LWZA 3S7ZA 1XKTA 4GRDA 1X1QA 3VPCA 5C81A 2AYYA 2IPAB 1QJ4A 5K6AC 3TXAA 4BGVA 2QYHA 2QTZA 4PC6A 3H18A 4EA9A 3ZZNA 2JI4A 1CZNA 2P41A 4A1OA 2AWOA 3OMXA 4YMVA 5JHGB 3EA0A 3GAMA 2VH2A 2FF5A 1EX9A 1U3FA 1ZK2A 3NT2A 3MM4A 4Y8VA 5AK4A 4ZPXA 1OXKB 2XVXA 2ZJ5A 3BSSA 1LWOA 1Z37A 3C24A 1C1YA 4C0LA 1EFAA 4TQUS 3Q4GA 4LBZA 2CC2A 3RVLA 3AF4A 4UTOA 3FOCA 1TJNA 1DV2A 3CB2A 1V7PC 3LPAA 1FUYB 4JB3A 4C7MA 4QEKA 2GNOA 2C3MA 2PRIA 2NU8A 4ARSA 5A9SB 3V1TC 5SZJA 1YK0A 2DQSA 2I3BA 4B43A 1PUJA 1TCAA 4DR6B 2G0NA 1Y3IA 2XD9A 3BX1A 2H4ZA 4ND5A 4OI4A 1M6WA 1UPCA 2CNWA 1T26A 4EFDA 1SGWA 4J16A 1N2CE 1SHJA 3P97A 3HFJA 1XCBA 4V2UA 4DIDA 1XQ9A 1PW7A 2O5RA 4EDFA 4YAOA 2A9KA 4MV1A 1G98A 1L6RA 4IM7A 4QPJC 4D6PA 1WVMA 3W2IA 1YV9A 2IEAA 3I1IA 4R6WA 5C8YB 4EHBA 4HADA 2DT5A 4MR9A 4Q93A 1CF2O 1YBHA 3FM9A 3I58A 3QPBA 2QTLA 4QOHA 2H2GA 4JEUA 4MHTA 4MI6A 1E5XA 3O94A 1YCGA 2R6DA 1BS2A 1EEXB 4ZO9A 4MW9A 4RHFA 4GMXA 3SU8A 3TTYA 3UJ7A 4WLOA 5HS6A 3FPLA 2WJ6A 1X1BA 1A1SA 4I1IA 4J4TA 4EG4A 3VNVA 4ZVRA 4P4SB 5I51A 3D6FA 2PS0A 3KR2A 5ALDA 2PBZA 1UZMA 5AP9A 3V97A 3CF6R 1K1EA 2MINA 2VDPB 3B1VA 3CUKA 1SVLA 4OFXA 1LSSA 4AI6A 3DVRX 1CUWA 5KBYA 2FF7A 2NVOA 2W2VA 2SBTA 3C3PA 3RYTC 4ZK6A 2UVQA 5LZ2A 1HY3A 2XMZA 3BC1A 3DULA 4RVUA 2HCJB 2PX4A 1QCZA 5DO9A 1JJ7A 3I34X 1FFDA 1HOTA 4YLYA 4NOMA 4YP1A 1FTYA 4RD3A 4EITA 4ZCPA 1E6CA 4NULA 2R6HA 3H5VA 3UJNA 4AC9A 1MAUA 4M6WA 4EI2A 4LVNA 4IILA 1F12A 5EAIA 1FS6A 2OUIA 1MO2A 2WMOB 3GI1A 2WW8A 5T57A 4J0GA 4NU0A 5B4VA 4XUEA 5C46F 2PUFA 3U60B 1FUEA 1OHHD 3HGTA 2GRUA 3MCAA 3AVTA 1EFDN 5KYVA 3MBIA 3EY4A 4OCZA 4LMBA 2Z98A 1CUUA 2BI8A 3FPBA 4J0JA 2QB5A 3LHDA 3M6MD 3R3HA 4LQDA 4ON9A 4QC2A 4M9RA 5TV2A 1Z62A 3KIPA 5I8WA 1A7UA 1YOVB 4Q4AB 2DFNA 3WV5A 4AKTA 1E7QA 4HEQA 2XYGA 2AQ8A 4KYUA 1SUFA 4PFQA 5A7FA 3L4SO 1I5EA 3ORRA 5KQLA 1N8SA 1X8KA 3Q8WA 5EXDA 2NN3C 2XTMA 5K20A 4KOAA 3ZIAA 2ZDHA 4GOND 4IH9A 4WBSA 1C3EA 1OMOA 3VPDA 4H15A 4LHXA 5E3HA 2YRFA 5B12A 3PFHA 4E5SA 4Y6SA 1I4TD 1BEUB 1UOOA 3EZLA 1A8PA 4YB8A 2B8NA 3RTDA 3C5VA 1GPAA 4GZLA 3GFSA 1YQEA 3CRMA 1U7ZA 4Q3BA 1K5HA 3AFOA 4IJKA 5BV7A 2EP8A 4UNPA 5EPEA 4ZMBA 4QUBA 2N0SA 3E82A 1CLEA 1L1RA 2LRHA 1Z3IX 4QUDA 3KYJB 1L6IA 2D00A 1DBRA 4JS0A 5BY2A 1XLTC 2VK8A 5FBVB 1V6SA 1H5NA 3B13B 5F5XA 3X1DA 1KEEA 1C7FA 3K92A 2PJDA 1YBMA 1ZP6A 5THQA 3U44A 1NVAA 5EMLA 4X60A 3MINA 4N8DA 1DTEA 4RELA 5ALWA 3S40A 3SEQA 5JR3A 2X2OA 3KDSE 1WQ3A 4KCGA 5I6DA 4XEHA 3Q8LA 1Z8NA 2QK4A 3ED1A 2CB0A 4FGZA 1NZDA 4JQZA 3OZFA 4TV9A 3VZPA 3H75A 2WP8J 3IMKA 4ZYWA 1Z16A 1AQJA 4TWJA 4YA6A 3ZHCA 3KUUA 3KQYA 2AK3A 3PDIB 1AK9A 4TLDA 2QE7A 4OUDA 4ZVNA 2IUFA 3CNHA 3DFKA 1SC1A 4F3RA 3NHRA 4KI0A 3P0EA 1T3LA 1G9TA 1HKUA 2Y4OA 1HE1C 2WEKA 3RUDA 2IXAA 1HFWA 2BHRA 3FSGD 1X9HA 3PTLA 2VJQA 1JKFA 2Z2ZA 1L4KA 3LOUA 1HA3A 2BUCA 4TSFA 3OX1A 3PRHA 2DBYA 1A5BB 4MRNA 3EFOB 1IRIA 1HLFA 4CCWA 3OZTA 5B3JA 5REQA 1OOEA 3CZQA 1RBQA 2O7VA 4YLEA 1Y6RA 2PM8A 4KDEA 2OBYA 1KH2A 2IYUA 3P9XA 3MAAC 4DE5A 4CF7A 3M3DA 3STWA 3G8BA 2B36A 2A9RA 2A9PA 4LSWA 2WWVD 4LJRA 4PYRA 5GJWC 4J0EA 3SDZA 5GAJA 3ASYA 3WI7A 1IC6A 2DTXA 5M5BA 1KI2A 2HH9A 2QEQA 1LS6A 5HF6A 1LDBA 3H9GA 2HQRA 4UXJA 5TPWB 4F71A 3CUTA 1ZW1A 2DEUA 4LX0A 4YCLA 3EBLA 4GBED 4YGXB 1HE2A 3U7IA 2FPGA 2W2TA 2X0KA 3NG1A 3AI2A 4WKGA 4DMFA 4CW7A 3COWA 1NG9A 1R8JA 3I6IA 1G6Q1 4A2QA 1KE1A 1XDDA 2DWOA 4ZMSA 4GRAA 2P9BA 1W87A 4AY2A 2C5LA 2WWFA 1FXSA 2AB0A 3AUXA 3K71B 4IH4A 5K3OA 4PLCA 1ND6A 2PRKA 1IM5A 1P3Y1 3D4NA 3IKMB 1Z5NA 4DQDA 3NIWA 3G0HA 3RIHA 4UTPA 1P7WA 1RWMA 4W9NA 3EOZA 3PEVA 3FUWA 3L7NA 3Q2KA 4FFBB 3RC7A 2CV0A 2ZRKA 1B8VA 3ZGXA 1TA4A 2C8JA 2E55A 3HYCA 2Y0EA 4LF8B 2J3IA 4FGLA 2IW3A 3S8EA 4ZGBA 3U2QA 1SURA 2BMFA 2R6JA 1U3TA 1OFTA 1WZUA 3W8FA 2JG3A 5DI3B 3CVVA 2VSNA 1ZM3A 3V6LA 3HZRA 4V0KA 1X14A 4C7BA 5IXJA 3RIMA 3OH8A 3JQ8A 4TMKA 3LVRE 3QPWA 4I4TF 4QU9A 1T8RA 2XA2A 3CPHA 3VR4H 3WNBA 3JU3A 1T5TA 2HRRA 2A9QA 2QIOA 3I30X 4Q1VA 5ALUA 3YASA 3I05A 4JJIA 1G6KA 4G0ZA 1E3WA 1M0SA 4HYYA 3PI6A 1X1EA 4J1TC 4P98A 4BNIA 3NATA 2W2PA 4KJZA 1U6KA 5FA5A 1B23P 1EJ6A 5E8RA 1FP7A 1LBTA 2XOXA 4UNQA 3WGKA 4AO6A 3IOMA 4G85A 1JLLA 2Z5FA 3FPGA 3UG6A 5K7SA 3PX7A 4LOJA 5PGMA 3UMVA 3GLFA 4FFBA 3TD9A 1IYZA 3G23A 1LKZA 4JSRA 1P74A 3N2KA 4YAJA 2EEZA 1DRWA 4ZCIA 3PGXA 2IYTA 4OX9Y 1BG6A 1T9AA 1XZJA 3FWKA 3T38A 2ZWMA 4OA8A 1MO3A 1YDGA 2DMRA 3FYHA 4GWLA 4Z6KA 3WRXA 5LQAA 3KK0A 4G4IA 1M0WA 1C9YA 1S1CA 2JI6A 5CURA 2ZTSA 2PGAA 1BHSA 4ND8B 4BP8A 1B41A 3CUUA 1TZ2A 4Y2SA 3HUDA 3K35A 5DXJA 5FD8A 3HN2A 4S1VA 4DM3A 1EHIA 4OVKA 4B8ZA 5JC8A 1CIPA 1QORA 1NW7A 5A4KA 1BJRE 1P6QA 3Q7RA 4M0PA 1YTUA 1B8NA 3RAPR 2FDRA 2XCIA 3DP9A 2VN8A 4INAA 1Z4LA 3RS9A 1Q17A 2AEMA 1WU7A 2I03A 3F90A 4P36A 1JG4A 4WJLA 1X42A 4K5QA 2GK7A 2YJZA 3BDAA 2WSBA 1CS0A 1B4DA 3TGWA 5GONB 1H2BA 1O97D 3JRWA 1ZH6A 3HCAA 4JLKA 5EJFA 2YJTD 4E30A 3TFOA 2I6FA 1OHHA 3GOHA 3LC7O 2AFIE