1B8PA

Malate dehydrogenase from aquaspirillum arcticum
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
327
structure length
327
Chain Sequence
KTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRNIKVLVVGNPANTNAYIAMKSAPSLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGASVKDMINDDAWNRDTFLPTVGKRGAAIIDARGVSSAASAANAAIDHIHDWVLGTAGKWTTMGIPSDGSYGIPEGVIFGFPVTTENGEYKIVQGLSIDAFSQERINVTLNELLEEQNGVQHLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cold adaptation. Sequence, biochemical properties, and crystal structure of malate dehydrogenase from a psychrophile Aquaspirillium arcticum.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (MALATE DEHYDROGENASE)
total genus 113
structure length 327
sequence length 327
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b8pA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1b8pA02
2GGSA 1HDCA 4IJVA 1B3BA 2PKQO 3VKUA 3WNQA 1JAYA 1KYQA 4QEDA 4KUEA 3Q3CA 1NTOA 2P9CA 3ROKA 3IC5A 4CLXA 2YJZA 1GPDG 4RDIA 3VZRA 3WWZA 4RJTA 4M86A 4TVBA 2C7VA 3NT4A 5BR7A 5EPOA 4LSMA 3VTZA 1Q0HA 1DPGA 2O2SA 2WMDA 3M6IA 4IDGA 2I9PA 3CSDA 4E6PA 3O8QB 3QV1A 4DYVA 2O48X 1K89A 4WOJA 5F5NA 4GQAA 1E7YA 3PVZA 3DQPA 1OMOA 1LNQA 4LVUA 3ZV6A 4ALMA 1GTMA 1SPXA 4LMRA 4JK3A 4I9NA 5EIOA 2I6TA 1TT5B 2WDZA 3AFMA 2H9IA 3JCZA 3NUGA 1ZK1A 3CH6A 5JDIC 4UVIA 2NU7A 1P3DA 3GR6A 1H5QA 4R3WA 4DPMA 4B4VA 3DL2A 2GCGA 1OAAA 3C1AA 2FSSA 4XA8A 3ZNNA 5DNAA 4IY1A 4CV1A 3H65A 4W6ZA 1MFPA 1Z73A 3VPSA 2P9GA 1VKNA 3KXDA 4RQUA 1D1SA 3U09A 4MVJH 4J90A 3TOZA 2DUWA 4YAIA 1U5AA 5CDTA 2PFGA 3W1VA 1YB4A 5ADHA 5AXAA 4D3FA 1GYPA 3LK7A 3F6YA 5GZ3A 1SCUA 1QG6A 1MB4A 2AMFA 2EW2A 4IDFA 4WASA 4J3FA 4RZHA 4WCDA 1DXYA 1GCOA 3WLEA 5ICSA 1YBVA 1DC3A 4A0SA 5KIAA 2E48A 3EHEA 1HF3A 4HNHA 4EI2A 1ONPA 3RCBA 3V2GA 3RWBA 1E7MA 2JCXA 1B0AA 2HO5A 4PLVA 4AJKA 4KTTE 2D4AA 2DFDA 5ILOA 2RCYA 4BV9A 1PS9A 2JJYA 1ZUD1 2P4HX 4NFHA 4Q3CA 1CF2O 3DWFA 4GAEA 3ROQA 2D8AA 4PLTA 3TZKA 7MDHA 1QLHA 1H6CA 1H9BA 4XYLA 2ZYAA 4JJFA 2ILTA 4PLWA 1YGYA 1LLDA 3LVFO 1EZ4A 1I32A 4FJ2A 4ND4A 1ZJZA 2J3IA 1JA9A 1EK6A 4YA6A 1BHSA 5L51A 3FWZA 2IYOA 2OHXA 4XWYA 1B26A 3UOGA 3GVHA 1B16A 5JLAA 2IE0A 3GMSA 3QLJA 1EE9A 1R4NA 3Q1LA 4Z0TA 2UUOA 1MA0A 3A1NA 2I99A 4D0SA 2EEZA 3AU8A 4FOSA 2HMWA 1A5ZA 3ASUA 3ONFA 4Q3NA 1N2SA 2GSDA 2AA3A 4U6QA 4EJ0A 5CG2A 6ADHA 2ZCVA 5FI5A 1MLDA 2ZKLA 3F4LA 5DOZA 4BNGA 2Y1EA 3P7MA 3HUDA 5B1YA 5JO0A 5FEUA 2X7HA 3F1LA 1J4AA 4IDCA 4F46A 1HEUA 4CM6A 2I5PO 4YQYA 4AVYA 4ID9A 2UVDA 5F21A 1EDOA 1GQ2A 3V2UA 1GV1A 4GX0A 4JNKA 4MVJE 1Q7GA 2J5KA 4XGIA 3TZCA 3GAZA 5B37A 2BGMA 4PIVA 5IDWA 4I9UA 3VH1A 1YL5A 1D8AA 3L0DA 2PWZA 3WG9A 3I52A 1B8PA 2GERA 3OM9A 4J1QA 4AICA 4UEOA 2X4GA 2NU9A 3VKVA 1Z7BA 4NK4A 3PQFA 4J7XA 1J49A 4BGUA 3RJ5A 2R2GA 5DF1A 3BTOA 2Q4EA 1U28A 2ZJ1A 3G0OA 3UN1A 2GZ3A 4HFJA 2PKQP 5JC1A 1KERA 3I3OA 2OXIA 3D3EA 3PZRA 1IHXA 1MGOA 2X5KO 4CM5A 2DBQA 3UICA 1SNYA 1Y8RA 3ZZNA 1Y6JA 4J49A 5CEFA 2EERA 4Y6PA 2JD0A 1A72A 2GLXA 3NEPX 1QV7A 2V7PA 1N7HA 4J4HA 3MJ4A 1D7OA 2JD1A 4D7AA 1PX0A 4QUKA 3C3XA 3GQVA 1ZJYA 1E3WA 1X1TA 3IUSA 4WLVA 1DO8A 4DRYA 3OF2A 2YQ5A 1M66A 3KOUA 5DZSA 3AK4A 3QW2A 5I9MA 1P1IA 2CDBA 2ZB8A 2NV6A 1X14A 4XDYA 4Y98A 3A28A 3VTFA 1FXSA 3U62A 1KBZA 4MJLA 2B4TO 5CG1A 2G0TA 4PZEA 1C0IA 3DZKA 2RHCA 1W73A 3RKRA 1HDXA 4YRDA 5HA5A 1ISJA 1E77A 3PHIA 4XRRA 4WK6A 2Q1UA 3AFNA 2I76A 4OHUA 1I2BA 1LRLA 5T5QA 4Z0HO 1XDWA 4RLSA 5T67A 5BNFA 4CMBA 2EGHA 3TDKA 4GSKA 2G17A 3DMTA 3RU9A 4FQ8A 3ZV4A 1ARZA 4BNZA 4ZRNA 4YRBA 2CUKA 4E5YA 4A73A 2ZTMA 3OIDA 4IM7A 1UZNA 3DZJA 1I3NA 1VSVA 2AW5A 3S2IA 3UGKA 3ASVA 1NBOA 1I33A 1TLTA 1TT5A 4YB8A 1OC4A 1UDCA 5GZ1A 2HQ1A 1YXMA 4L8VA 4UUOA 1VJ1A 5DT9A 1NQTA 3I9MA 4BNVA 4O1MA 4M1QA 1E6WA 2C07A 1RKXA 4BO7A 4FPXA 2W4QA 1J5PA 5JDIA 1N8KA 4I5EA 4DQVA 5DOVA 1UXIA 3H3FA 4JN6B 4BKQA 1D1TA 2DTXA 3H2ZA 4ALNA 3K96A 5HTOA 1PWXA 4D43A 4NFYA 3TFQA 3OJOA 3Q0EA 2JCYA 1N5DA 1EVZA 1WDMA 3KBOA 2VHZA 1WDLA 4AJLA 3MCVA 4ZGWA 2RAFA 4EITA 3BHIA 4CLHA 1HETA 5IDQA 2J6IA 2QZZA 3MJTA 1LLUA 3CINA 2ZQZA 3DTTA 4CLOA 1SO8A 3S8MA 4IZHA 4AJPA 1WP4A 4HNGA 1LLCA 3HWRA 4NQZA 4ALJA 1BXZA 1G1AA 1KEWA 5A9RA 5JW6A 4QO7A 4BQPA 1GQYA 2QYSA 1I8TA 1SBYA 1DEHA 3D4PA 1PQUA 4BGIA 1QKIA 4II3A 4ALKA 1JU9A 3DONA 1BW9B 2Q2QA 1IE3A 1HE2A 1P0CA 3EMKA 3NTQA 1T4BA 2FOIA 1BDMA 1CQJA 3NJ8A 4BOYA 4QECA 1R16A 5A1TA 4QO8A 5BNTA 3ROMA 4XR9A 4DQUA 2ZYDA 4N7RA 2GYYA 4LSWA 4NMHA 4CODB 1N7GA 1LQUA 4YTEA 1QYDA 4BMNA 4BO2A 3WR5A 5B4UA 1A27A 1YDWA 3INGA 3SVTA 3PEFA 2Y67A 1ADBA 3LSYA 2C54A 3OJFA 1DRUA 3IDSA 5I7SA 3MWDB 3PFFA 3GEGA 3BA1A 3H9GA 4J7CA 3DBRA 5K0ZA 2B0JA 1PIWA 3JQFA 4MDHA 3LT2A 5I8ZA 4F6CA 3JTMA 4RPJA 1LDNA 5ITVA 4OL9A 3D0OA 3F46A 4CV3A 3ZW8A 2CF6A 4OXYA 3GDOA 2VHVA 3ADOA 4NBTA 4YJFA 3AY7A 4CM7A 4AJOA 3S2GA 5I7VA 2V65A 3PHJA 4PLHA 3DOCA 3JQ8B 3QWAA 4RVHA 8LDHA 2VN8A 1CRWG 3H9QA 1LDGA 2FZWA 2BI8A 4D42A 3Q9NA 1LX6A 1A7AA 1X0XA 2A35A 4Z9XA 4D45A 5ENDA 3INTA 4MVJA 4CQMA 3HHPA 2WSBA 3NT2A 1ZMOA 3SEFA 4XGNA 4TRNA 4XDZA 1Y8QA 3FTPA 1F06A 2A9FA 3Q11A 1HE3A 4R69A 4BO4A 3OIFA 3WJ7A 1E7RA 1U1IA 1EFKA 3LC7O 1U4OA 2JHFA 3RIHA 1V35A 4LK3A 5G4KB 2VZ8A 5EINA 1KOLA 1X7DA 1DOHA 1H2BA 1ULUA 2NUAA 4NZ9A 4AJ4A 5JBIA 3ZWBA 1ISHA 2HMUA 1PGOA 2O4UX 3CTMA 2FPIA 3JSAA 4RVSA 4D3DA 4A27A 1G0NA 4EJMA 4OXKA 4FOOA 4YDRA 1NYTA 3CEAA 4OIMA 1GQQA 2FWMX 3GOHA 2D5CA 3JD3A 1EQ2A 3RD5A 3S55A 3G17A 3FPCA 2HK9A 3WSWA 2X5JO 2AG5A 3E82A 3ANLA 4KUHA 4R1SA 4CM8B 4YR9A 3VAZA 1PSDA 1TVEA 1PJLA 3I6IA 1HSOA 2ZIZA 4G65A 3H9UA 1MG5A 1T2CA 3U4CA 4TRMA 4DPLA 3M1AA 4HFMA 4PLZA 1TA4A 1JW9B 3DMYA 2XF8A 1LUAA 5DN9A 1YB5A 5ITWA 4EUEA 4J4TA 5L4NA 1OZAA 2FHSA 1E6UA 2WTBA 4DLAA 5KJ1A 4C4OA 1BMDA 3QY9A 4QQRA 3AY3A 1NQOA 3JQFC 4CUKA 3WYEA 4MINA 4J1NA 2BH9A 1MG0A 1VL6A 1EUZA 2W2KA 4QXMA 3PZBA 4HBGA 3M2TA 3PFWO 1LRKA 2D59A 2VZ9A 4R41A 1QYXA 1B3RA 1E3WB 3LQFA 3QWBA 3FSRA 3NTRA 1ZEMA 3RAJA 1H9AA 5TJHA 2RHRA 4TRRA 3NAQA 3FN4A 4O59O 3LC2O 3RC1A 1ISMA 5K6AA 3HDQA 1P45A 4H3VA 4ND3A 3X2FA 4OYRA 3RC2A 2X9VA 3NT5A 4L76A 1I5RA 4GLLA 4GL4A 3QWIA 3L6OO 1CERA 1CDOA 2EHDA 2BFOA 5A9TA 4L4XA 5H82A 1ZXLA 1YBAA 3ZCXA 4CMJA 2NTNA 4RVUA 2ZTUA 3KV3O 1M76A 3GN2A 3PGXA 3GRKA 4I08A 2AEFA 3EVTA 3FWNA 1LDYA 5JMPA 4GKVA 1XGKA 4HFRA 1BXGB 3TSCA 4DUPA 2EP7A 1V9LA 5GMOA 1MV8A 4ZVVA 2DPHA 4KUGA 4OQZA 1F12A 4RF5A 3WGTA 1UP7A 3ULKA 4MP6A 2E49A 4A03A 4XJSA 1IPFA 4CM3A 2ZTLA 3QVSA 1V3UA 2GZ2A 4RQTA 5TNXA 4YWJA 4CL3A 3W8FA 4XYBA 1GZ3A 1E7SA 4M55A 5JPIA 2IRWA 1XHLA 1IULA 3ZHYA 3HE3A 1UAGA 5A9SB 4OGWA 5A03A 5EMHA 3RC7A 2CZCA 4GWGA 1ZK4A 3BHJA 4B7XA 3QJ5A 4I9HA 1MUUA 5A05A 2YHIB 4H16A 4WLNA 3BMNA 2FRDA 4I5DA 2D5AA 2B5VA 1C1XA 1X15A 5TT0A 3UF0A 4KQWA 5H83A 4RORA 5IFLA 4QT0A 3ENKA 3PHLA 4B4OA 1XWFA 3EC7A 1L7EA 2EGGA 1QMGA 1Z82A 2YY7A 1PU2A 1JKJA 3UXYA 1NP3A 3KYDB 4P38A 3GY0A 1PEDA 4PLFA 3PHHA 1H94A 5CPFA 5CEJA 3LYLA 4N5LA 1NWHA 4BNTA 1DRWA 1VC2A 4CQLB 1XQ6A 2WD7A 4JP2A 4AJ2A 1U7TA 1K6XA 3ZU5A 5JMWA 1JLLA 4YXFA 1DIRA 1GYRA 3I9LA 4OAQA 4Z3DA 3DEYX 4ALLA 5CAEA 1QYCA 1Q0LA 3FR7A 3RUEA 5KWEA 1ZSYA 3FNHA 2Z1MA 3ITDA 2AXQA 3FF4A 4R16A 2UUPA 1ADGA 5ENVA 2YV3A 3F5QA 2PD3A 2W8ZA 1FDTA 2PZLA 4WGGA 2HSDA 4FJ1A 4I5FA 4GLOA 3ICCA 4PZCA 5IXYA 3F3SA 1CYDA 3E9NA 2NQTA 2Z95A 2B35A 1Y7TA 3TFOA 2HMSA 3VPGA 1GZ6A 2YV2A 5B4VA 1ZNQO 3L07A 1EFLA 3PQEA 2RH4A 2OFPA 3R1IA 3UW3A 4FFMA 5A5FA 4EJ6A 3RFXA 5EERA 3NGLA 3WDSA 2FY8A 3GVXA 3RUFA 4CMIB 2IYPA 1M75A 3OJLA 3K31A 3GH3A 2PA3A 4FFRA 3PK0A 1JTVA 3ETDA 2O7SA 3ZW9A 1LSSA 4YT8A 1LSJA 3HZZA 3KYCA 3HFSA 2Z1NA 2HMTA 3DZBA 3WQQA 3JD0A 2YYYA 2PNFA 3COSA 4BKPA 3OQBA 1R4NB 3TWOA 2POQX 3R3SA 2D3TA 1DHTA 1E3JA 1HDGO 2Q49A 3OFSA 3E9QA 2GUGA 2B83A 1E92A 1B2LA 1WW8A 5C37A 1D3AA 1F8GA 3GGPA 3TPCA 1Q0QA 2EG9A 4KTVE 1EE2A 5CP8A 1HXHA 3W4JA 5IDXA 4BNLA 4GWKA 4GX5A 3ORFA 3K30A 4TMFA 5ES3A 3ZWVA 5TX7A 3NV9A 3ZH2A 1OBFO 4MVJM 1LTHR 1KY5A 2JD2A 3M2PA 5TS3A 4DPKA 1TB4A 2V6MA 4PLCA 5CFZA 3D7LA 4WJZA 4PZDA 4QFDA 3PHGA 4L74A 5I9NA 3CE6A 3TOXA 1UP6A 4Y6SA 3CUKA 3AWDA 4YAGA 1PR9A 4P22A 2H63A 2DBRA 3BTUA 3GPDG 1RWBA 3EUWA 3HADA 3KRTA 5TSDA 4BO6A 3H7AA 4YT4A 1IOLA 3SC4A 2C7GA 3JQBA 1FDUA 3JD1A 4IDBA 1DDOA 1K0UA 4R68A 3DOOA 1V0JA 3BMOA 3G1UA 3IP3A 4CUJA 4CL8A 5I8WA 4MO2A 3E48A 4LVCA 4NIMA 3VHRA 1IYZA 1GYQA 4BO5A 2O3QA 1GU7A 1PGNA 2I3GA 4DIOA 4RVGA 3FRJA 1JN0A 4IIUA 2X0RA 4YJHB 4XRGA 1F0YA 3GLQA 3GEMA 5DCUA 5IXSA 2V6FA 1DB3A 4BB5A 2OZPA 2UYYA 1UH5A 2ZJ0A 3WTBA 4MOWA 3KB6A 4IS2A 1NHGA 3LT1A 1ULSA 4TZKA 1C14A 4XD2A 3CZMA 3LU1A 4ZICA 1KVUA 4XX0A 2NQ8A 1WMAA 1ADCA 3WGGA 3B1FA 3F47A 1BRMA 4XB1A 4K9DA 1EEHA 1U3UA 4WLFA 4E5NA 3WBBA 4FBGA 1IUKA 3UUWA 1KVRA 2HU2A 1UUFA 2IXBA 3U4IA 1O8CA 2PD6A 1TT7A 2NTVA 1U8XX 1Q2XA 3NDJA 4IXTA 3GMDA 4MVJI 4E13A 1YDEA 3OBBA 1Q7CA 4KP7A 2FN7A 2Q1SA 3RKUA 2GN8A 3FD8A 2Y99A 3HQ4O 3V8BA 4FW8A 4BIIA 2CVZA 3DC2A 3GDGA 5LDHA 1PGJA 2VUTA 5FFFA 5TC4A 3PLNA 4I8XA 2EJVA 1XG5A 4G2NA 1PS8A 3ZHBA 1LQTA 1V3VA 1E7QA 1TEHA 1RPNA 4OJNA 4I1IA 4Q3AA 4F6LA 3RFVA 1O6ZA 1RM5A 4PRLA 3GUYA 1RM4A 3IMFA 2YFHA 1U5CA 2Y1FA 3O9ZA 5DULA 4DBZA 2IZ1A 2VYVD 1O0SA 1H2HA 1VRWA 1NAHA 1C1XB 3ZNPA 4XQGA 5JCXA 1KVSA 3ANNA 4HP8A 4WCFC 2B36A 2I3AA 3BTSA 1VPDA 1YQGA 1U3TA 3PYMA 4HXYA 4FS3A 1LLQA 2Y1DA 3DDNA 4JCOA 3H3JA 4CM4B 4D44A 3ZDFA 4II2A 1VKOA 3DBLB 1U3VA 4FDAA 4YAEA 2GO1A 1RYDA 3T7EA 5L7WA 5MDHA 2JAPA 4EEXA 5A04A 3PTZA 3ZWYA 4YYZA 1BXKA 2EV9A 1Y9AA 3C1OA 3ONEA 2YZ7A 4BNIA 1UDAA 4JX8A 4B3HA 4C7JA 3ZWXA 3BZUA 3GG9A 4MIYA 3PJFA 3VH4A 2AQ8A 3GRPA 2O3SA 1SB8A 2ZB3A 3IKTA 2V6BA 3JYPA 3OECA 5L3ZA 4OH1A 4ZN6A 3C85A 1O89A 1YJQA 2X9GA 4DLLA 3NX4A 4EGFA 1LU9A 3DBVO 4Z9YA 1SMKA 3BMQB 4ZQBA 4AL4A 3GA0A 4E5MA 4LCEA 3VPXA 3MEQA 4DWVA 5CPBA 2HDHA 3DHNA 1QLJA 1U4SA 4BV8A 3BIOA 3O8QA 2J8ZA 4WPGA 2QRJA 1DAOA 1R0KA 2EIHA 1WXDA 2PZJA 4J1TA 4TRJA 3HB5X 1K2WA 3KHUA 3KSZO 4B7UA 2P68A 5C3MA 4RF3A 2JKVA 1E1MA 1HYHA 3E9MA 1PJQA 4Q3BA 3DZFA 1BW9A 2GD1O 1NASA 5JYEA 3ABIA 1SEPA 2G76A 1PL6A 4PG7A 1K3TA 4XYEA 2AE2A 1B8UA 2OO5A 1WAMA 4XIJA 5TF4A 3WGYA 3ZWNA 4EW6A 4D41A 5LCXA 2CFCA 3O03A 4GGPA 4N5NA 4U0KA 3KTDA 3IIEA 4B8WA 4I5GA 1GUFA 3H9JA 4CR7A 4OXNA 5L9AA 4A10A 5AXDA 2AQIA 1NQ5A 1CJCA 3H9EO 3ZHZA 4P4GA 3WIEA 1ZXBA 4PLYA 5DBIA 3WGZA 4DVJA 1HDZA 2BLLA 4R1TA 5KCZA 2OBNA 3VC7A 4IDAA 3R3JA 5EQDA 1DFHA 3W6ZA 3EK2A 1ZFNA 3KM0A 1M6HA 3H5NA 1UXKA 4RVFA 5JDCC 1NHWA 3R0IA 1AGNA 3AOGA 3U3XA 4CQMD 3OH8A 2IODA 4J2HA 1SC6A 4XYMA 1EK5A 3DTYA 1XA0A 4ZU3A 3WJAA 1JKFA 5EJ2A 1IPEA 1H0KA 1W8DA 4BO1A 1U2GA 2YFQA 3JQCA 3FNGA 5DCWA 1ID1A 2HK8A 5G0SA 1G0OA 2PK3A 4IQGA 1QP8A 1N9GA 4GMFA 2NADA 2G5CA 4KDEA 4RLHA 2BFMA 3GGGA 4AJ1A 4FGSA 3L6EA 4MVJF 1Z75A 2Q50A 1GR0A 4YBZA 2H6EA 2PR2A 4Z6KA 2HRBA 4NJMA 2DQ4A 4BB6A 3ZU4A 3BMOB 3IAHA 4K1LA 3GG2A 2O3JA 1ENYA 3JYNA 1HL3A 2WE7A 1E3LA 2WJPA 4R4JA 1BDBA 3BTVA 1L1FA 2BELA 3QVOA 1DC4A 4J1SA 4ZHSA 3A9WA 3OSUA 3E8XA 5KNLA 3I9KA 2JL1A 4CR6A 4KOAA 3HNPA 3JQ8A 4ND5A 3MWEB 3GFGA 3K73O 2CY0A 1I24A 3QIVA 4OQYA 1H6DA 2PZMA 4A2CA 3M1LA 2VYVA 4M89A 1UXGA 4E5KA 4EUFA 3KETA 3PI7A 1NVGA 3WS7A 4DBVO 3SJ7A 1ML3A 3KSUA 5CDSA 1YH3A 2VWQA 4B7CA 4CMKA 4FD3A 2Q46A 1E7WA 4BGVA 3G79A 3INRA 1LDMA 3G1TA 5DCYA 1PQWA 2VHWA 2FPPA 1W0CA 2C82A 5COAA 1S6YA 4PFJA 3N74A 4RDHA 2P9EA 5G4KA 4ESOA 4ZD6A 4R9SA 2NTJA 1DIGA 1Y8QB 3RUHA 1VI2A 1KC3A 2FZEA 3K92A 2AG8A 3WBFA 5IF3A 4EZBA 4B8ZA 1JKIA 1ZSNA 5HBRA 4CM9A 3VH2A 4XR4A 3G49A 1F8FA 4RPHA 3DAPA 3EW7A 1UAYA 5BNIA 4Z9FA 3O38A 1LBEA 2BFAA 3E6AA 3ZNQA 2YHIA 1DRVA 5HS4A 2OP1A 4LRSB 4E33A 3FPLA 3DR3A 5C7LO 4BO8A 2OMEA 4WE3A 4CLRA 4CLRB 3D3WA 3F1KA 3ZWMA 2RIRA 2GN6A 3WGHA 3G3EA 1HYGA 3HG7A 1J0XO 2R00C 4FC6A 5FI3A 3SJUA 1A7KA 5U9CA 1AHHA 5KOIA 2OUIA 1NFQA 4PLPA 1ISGA 1BVUA 1XSEA 3MJVA 3UCFA 3N7UA 4E2YA 3STHA 4ZQFA 1GAEO 2ZB4A 5JY1A 3QA9A 3IQDB 3F5SA 2BGKA 4BNKA 3AY6A 4D3SA 1ZW1A 1DSSG 1E3EA 3CPSA 4FGWA 2NM0A 2UDPA 2EJWA 3V1TC 3WGQA 3RASA 4AJIA 4BNFA 3EZLA 3MJEA 3Q9UA 3OEWA 4NU6A 2YV1A 1F14A 2X22A 3D64A 4J91A 2BF7A 1WZIA 4JXKA 5CHEA 3ZU3A 5B12A 2VT3A 2Y0EA 4RO0A 3D4NA 3PDUA 1GPJA 1LSUA 4RCVA 4YAKA 4PGFA 1Y81A 4ZRMA 5L7TA 2VWPA 1SOVA 4A7PA 5JNLA 4C7KA 2EWMA 3E1KA 4MKXA 3GEDA 4NDNE 3SXPA 1UJMA 3JQ9A 4W99A 2VYND 3GT0A 1UXHA 3KEQA 3KVOA 3D4OA 5BSFA 1T2EA 2EW8A 3VPFA 3KEOA 2AHRA 3AOEA 4EBFA 3JQDA 5T8KC 1GUYA 2F1KA 3ZGYA 1C0PA 2OORA 4N54A 4MVJD 2E4AA 4IMRA 4NU5A 4NR0A 3JYOA 3OP4A 1ONNA 1PZFA 4B4UA 3PQDA 2NACA 1NFRA 1YOVA 4DYDA 1I3MA 3ZWAA 1DJNA 3NGXA 2FPGA 4NI5A 3VDQA 1NM5A 2H5LA 4N18A 3ADPA 3JQEA 5G0VA 1DC5A 4IGEA 3WMXA 1XIVA 1DIBA 1P1KA 2R00A 4J0EA 1YE3A 5F1KA 1HDYA 1R0LA 4MP8A 4PG5A 1ZEJA 3DBRB 4NNJA 3WTCA 4OOFA 4YVFA 3FBTA 4HKTA 1YWGO 2CDCA 1YB1A 2ZK7A 3JQAA 1ZBQA 4UUNA 5KKAA 4BS9A 1ORRA 4AJEA 3ZN2A 1AXEA 1P33A 4OSOA 1VL8A 2Y68A 3QWHA 3OHSX 4FFOA 1EDZA 1ISIA 2FP4A 4TQGA 3WSVA 4Q3DA 4R5MA 2DKNA 2DT5A 4UVDA 3C7DB 1D4FA 4TVOA 2IDZA 3P5SA 4WKGA 4IZIA 1LRJA 2DUUA 4UEKA 4HV4A 2RH8A 2ZQYA 1E3SA 5DP1A 4DIBA 3MOGA 1K6IA 3CKYA 3ZU2A 3KLPX 3U5TA 1ADFA 3DZHA 4L75A 1QSGA 4MKZA 3SC6A 1WMBA 3OICA 3LF1A 4R51A 2J5RA 1U8FO 2WEKA 2W98A 3DB2A 2CVQA 2UV8A 3FTNA 3IUPA 4NFSA 5TJ9A 3IP1A 1KEVA 1X13A 1ZKMA 5AXCA 3WFJA 3GK3A 4J6FA 4CMGA 2VRCA 1LA2A 1Y8RB 4OM8A 4CR8A 5DDIP 3I23A 4LRTB 2VRCD 4U7WA 4BQRA 5J23A 2NWQA 3DFZA 3IJPA 3Q2KA 3U4DA 5A3JA 4LGVA 1A9ZA 2VCYA 4DGSA 1GDHA 1EUCA 3WQSB 4RVDA 4UVHA 1MC5A 4FFNA 2BMAA 3QRWA 1T2FA 3SBOA 3TNLA 3PIDA 4XKJA 2BGLA 3LDHA 2EF1A 2JHGA 3DHYA 3FHLA 4M54A 1HRDA 4S1VA 3A06A 4JBIA 2LDBA 3W8EA 2AEMA 4YJHA 1SAYA 5GZ6A 2D1YA 1I0ZA 3DZGA 4KDFA 2B4RO 4XIYA 4R9RA 3LLSA 2FR0A 4IGFA 4IUYA 3NDRA 1N1GA 3EVNA 3ZV5A 3UCXA 3H4VA 4UREA 4INAA 2DBZA 2BRUA 3WICA 1GUZA 3WGOA 1W6UA 5G0TA 5G4LA 4CQMB 4J43A 4NBRA 1GV0A 3VZQA 1B8VA 1GL3A 1PJTA 2WYWA 2Y0DA 4IDDA 3OEYA 1E3IA 2JFHA 3RSHA 1HKUA 5U4QA 4AJNA 1DFIA 5MGBA 3WIDA 1SOWA 5KVQA 1ZO8A 3DAGA 4U0JA 2GNAA 2P5YA 3P2YA 4RGBA 3QHAA 4YRAA 1GEGA 2SCUA 1JQBA 5EQFA 3JV7A 1NR7A 2E37A 5ER9A 3NTOA 2XXJA 5L40A 2FR1A 4BKRA 1RJWA 4IBOA 3U4HA 2X1HA 3ETEA 5TT1A 4FSHA 4BKUA 1X0VA 4FR5A 5JAIA 3H8VA 4L4RA 3RBXA 4S3MA 1XQ1A 2Q3EA 1G6KA 4Z0PA 4NBVA 5T57A 5DP2A 1SZJG 3WFIA 4IQ0A 4ZQGA 5F5LA 5JAQA 1FJHA 4D0RA 5IZCA 4DMLA 2QYTA 1AN9A 1CQIA 2Z5LA 4WNCA 4OOEA 1HSZA 3OMLA 3I4CA 5U1PA 3B20A 3SLKA 1QR6A 1HZZA 3O26A 5TQVA 1ZCJA 3V5NA 1ZK3A 1NAIA 1BSVA 2NVBA 3E5RA 4NBUA 1PS0A 1PZGA 4WLOA 5JO9A 4BNYA 4DL9A 5HWSA 1E1NA 1QRRA 3BMNB 2YUTA 2O4CA 4XEHA 5FYDA 1FMCA 1P1HA 5AOVA 1Z45A 2PH3A 2HRZA 3L9WA 4TZTA 1I01A 2A94A 5TGDA 1MP0A 2W2KB 3DO5A 1MFZA 5THQA 3HJAA 4UVEA 2Y1GA 5CDYA 4DLBA 3WOHA 4Q3EA 3JQAD 3LZ6A 1GY8A 2X23A 4PG4A 4PVCA 4WEQA 1TI7A 3I9OA 3I9NA 1YVEI 4QTZA 1A71A 1U3WA 4W7IA 1ENOA 3SX2A 2OOSA 1PWZA 2CSUA 2X5OA 4CMHA 1V6AA 4FFPA 2EXXA 1IB6A 2O3TA 4CMEC 4RPGA 4RL6A 1JWBB 5IN5A 1GD1O 1XCBA 1T1SA 5COQA 4CLDA 1R6DA 1WPQA 1UZMA 1BWSA 1O94A 3CMCO 1H93A 1SB9A 4GSLA 1BXGA 2AQHA 3O4RA 1EVYA 4K6CA 2OP0A 1MXFA 1Q1NA 1R4MA 1R4MB 3PP8A 4HWKA 4GPD1 3VOSA 3WB9A 1HTBA 1NVMB 2XPCA 2QHXA 3IOYA 4Q39A 4YJGB 3PRJA 2PLAA 3PDJA 4J9VA 3GAFA 2DVMA 1ENPA 4GMGA 4EYEA 1RYEA 3KYDA 4FFLA 1MC4A 5G2OA 3P19A 1C0LA 5A06A 1IL0A 3HN2A 2IEDA 4GI2A 1LI4A 3TZ6A 3GPIA 4URFA 3PWZA 3NYWA 1JAXA 1MX3A 1KY4A 4ITUA 4HFNA 3UCEA 3DAFA 1OI7A 3AW9A 4U8GA 5BQFA 5IZCC 5ICMA 3WYBA 1YBMA 1OFGA 4XZ3A 4L4SA 3GVCA 2EKQA 2NU6A 4E4YA 4OO3A 5IAAA 1DHRA 2VOJA 3WWYA 4OSPA 2O3UA 2PZKA 1YONA 4PG6A 3KYBA 4JROA 5KJEA 3TZHA 4JQCA 3IS3A 5KJCA 2Q45A 3ETGA 5C5IA 3W4IA 1PTJA 1UXJA 4M87A 3PYXA 1LSOA 1PL7A 3ROPA 5C7IO 3NKLA 3W6UA 1R15A 1AXGA 1C0KA 2EKPA 4F3YA 2TMGA 1RM3A 3GHYA 4D46A 1K5HA 1XR3A 1KEUA 4WLUA 1PJ4A 1XKQA 2UAGA 4R3NA 1ONOA 3TZQA 4NG5A 2QQ5A 4XB2A 3IL2A 2NVWA 2P5UA 4TKMA 5IG2A 5BSEA 3RJ9A 1M67A 1DIHA 1WLYA 4L9RA 1ZVMA 4XGKA 1IZ0A 1TXGA 2FMUA 3PJEA 5I7FA 1HLDA 1E1KA 5A3VA 2NSDA 5HM8A 1T26A 2RBEA 2NU8A 4Z3KA 3JQGA 3VPHA 4W7HA 4YJGA 3UKOA 2VRBA 3OETA 2QRKA 4G81A 1NWCA 2C59A 3PXXA 1QYVA 5COBA 4CQLA 2VYNA 3L6DA 3JQ7B 4Y8VA 2B4QA 4RPKA 3UH1A 3FCOA 1P31A 4NPCA 1KVTA 3JQ9C 1HLPA 5B4TA 1PJ2A 3OJEA 1EMDA 4RZIA 5I9LA 3GC6A 4IS3A 3RUDA 2IXAA 1EVJA 5JCJD 4L0QA 4MVJP 4W9NA 3R6DA 1VLLA 2O3RA 5JS6A 1NPTO 4IJKA 4KZPA 3GN1A 2QG4A 2VHXA 3K9QO 3H6KA 3VVCA 5IN4A 5L7YA 1E0DA 3AM3A 2VWHA 4RF2A 5F1PA 4TWRA 2VZ0A 1E5QA 1XU9A 4BO9A 1Y5RA 4LMPA 1YRLA 1XYGA 2HK7A 3BHMA 3L4BC 3RQSA 4JGBA 2V6GA 1CWUA 1P1RA 2P91A 3QP9A 4R1UA 1BTOA 2JFFA 3HSKA 3GGOA 2CD9A 2PTGA 4E2XA 2JCVA 3OQ6A 1PGPA 4FN4A 5KKCA 4CM9D 1LC3A 2A92A 3P2OA 2C29D 4UULA 1QORA 4GVXA 2A4KA 3A14A 3E18A 3KUXA 3MJSA 4WUVA 1YO6A 1E1LA 4WEOA 1JVBA 2NLOA 1W4ZA 2GPTA 4BMVA 3S1LA 1A4IA 3CXRA 3VH3A 3D1LA 4YACA 1Y1PA 5EN4A 5KJ6A 4KWHA 3UHAA 2VTEA 4BNXA 1S7CA 4DC1A 3PIIA 3BMQA 4B4WA 1T25A 3JQGB 1I2CA 3PJGA 3RU7A 2R6JA 5KVCA 1P74A 3ENNA 2W2LD 1V8BA 2YHUA 4DA9A 1PR3A 2O7QA 4HADA 2PGDA 4K26A 2Y1CA 1DJQA 3RI3A 4NK5A 4MIOA 4FJ0A 4WOKA 4G5HA 3ZWWA 3NRCA 2PGLA 4E32A 4M8SA 3S2EA 4JP3A 1NQAO 1L7DA 1QXSA 4P4LA 2Q2VA 3KLMX 3KO8A 4D79A 1Z7EA 3RROA 2WYUA 3ZWCA 3ZHXA 1U7HA 4FCCA 3GZ4A 3QVTA 2O50A 4YAJA 2BI7A 3GVIA 3S2FA 5JDCA 4WCFB 4J4BA 2DPGA 3OQ1A 1P0FA 1KC1A 3CMMA 1UR5A 1LJ8A 4YJFB 3GVPA 5ILGA 3PLRA 4ZQEA 4BO3A 4W9NC 4Y6RA 2HCTA 2BHLA 4UUMA 3FNFA 4GX1A 4EDFA 3WGIA 1CETA 3ONDA 4CJXA 5I7EA 1T24A 4AJHA 1M2WA 2C5EA 4RPLA 3ZNOA 4PCVA 1YS4A 4HX5A 1NPYA 3E5MA 2QRLA 3WQRA 1XELA 3JD2A 1MXHA 3K8ZA 1FK8A 2CNBA 1R12A 1Z74A 4BL5A 2PGJA 4IINA 4JIGA 5JYDA 4TSKA 1IY8A 1M6WA 2X58A 3L4SO 2VNSA 4DC0A 1Q7BA 2VOEA 3GNSA 1KETA 4CM1A 4XQCA 3RUAA 5K9ZA 5LDGA 3HN7A 2Q4BA 3TJRA 1DIAA 1H6BA 4O0LA 1KEPA 5JE8A 1VJ0A 3T4EA 5GY7A 4A5OA 3GHHA 5L53A 2ZB7A 2X0NA 3WMWA 3CZRA 1FDSA 3DFUA 5DBFA 4E12A 4BMSA 3EY4A 2HMVA 1AHIA 3PYLA 5T64A 3PWKA 3HB4X 1E6EA 2PH5A 4CMIA 5JAZA 1A9YA 2Y93A 4GBJA 4RV9A 3DXFA 5JSFA 4DMMA 1WZEA 3BMCB 3H5AA 4CV0A 4ZQHA 4UEJA 2HKIA 1PJCA 3QQPA 3AUTA 3CIFA 4Y9DA 1I3KA 1BVRA 4TKLA 2CMDA 4OMUA 3X2EA 2J3KA 4NJMB 1N9GB 2GR9A 1I36A 3K6JA 1P1JA 4CLEA 4FIZA 5CDUA 3RC9A 4E5PA 4NJOA 3K2EA 1HT0A 1XEAA 3N58A 1B7GO 2O23A 1FDWA 2X0JA 2WD8A 4CUZA 3GFBA 1T4DA 4W82A 4BNWA 1CIVA 3QSGA 4PG8A 4NBWA 2YDYA 4KMSA 2W90A 3OJ0A 2I65A 3OA2A 4H7PA 2VUSA 4OKIA 4YCAA 3T7CA 3GUCA 3JQAB 1Z6ZA 2GZ1A 4NHEA 1B14A 2IEBA 4BNMA 3DBHB 2B37A 1GZ4A 3RVDA 5KJFA 4ZJUA 3A4VA 2C2YA 4K6FA 4AJJA 2C5AA 4GGOA 4KWIA 4MPDA 4YJDA 1GADO 5G0UA 3VDRA 1DLIA 4E0BA 9LDTA 3ZV3A 3V1YA 5BSGA 3JYQA 1DAPA 4ROSA 4X54A 3RFTA 3MZ0A 3ICPA 2X0IA 4J0FA 5AXBA 2G1UA 2VHYA 4QFCA 2AEJA 2F00A 3LF2A 2X6TA 9LDBA 1P9LA 4E3ZA 3AI3A 4AG3A 2VQ3A 2XXBA 1BGVA 3MJCA 3F9IA 2D2IA 1VSUA 3GZNA 3GZNB 4GKBA 3WYCA 1F17A 4ONEA 3C24A 3AM5A 4BKOA 1ZSVA 5TIIA 1O5IA 5BSHA 4MVJG 4ALIA 5H81A 4A26A 4WECA 2NVUA 3KZVA 1PZHA 4NH4A 1PJBA 5FWNA 3L77A 4Q9NA 4R01A 3D5QA 2HJSA 1IZ9A 2OBYA 3QVWA 3TN7A 3U49A 5HRUA 4BUCA 1I10A 1AUPA 4J2OA 3H5RA 3C1TA 1P77A 4YEDA 1NX6A 1PJSA 2Q99A 2WYVA 3LLVA 4CM8A 1HE4A 3WNVA 4B3JA 3I83A 5CEEA 4IJWA 4BHTA 3F4BA 1IHYA 4CPDA 2GDZA 1P44A 3ANMA 2OGUA 5IZ4A 3PGJA 1R66A 3C7AA 3FBGA 2YDXA 1OOEA 1PZEA 3AUUA 3E03A 2YW9A 4W4TA 4B3IA 1VL0A 2DTEA 1C1DB 1EBFA 1EUDA 1NPDA 2AE1A 4MKRA 1YQXA 3HDHA 3LC1O 5JAMA 3VZPA 3K2BA 4R5HA 4FB5A 2VTDA 3B1KA 2WE8A 2XAAA 2WD7B 4JBHA 5L4LA 1LC0A 2JFGA 4QX6A 3QE3A 2HJRA 3VVBA 3DBLA 1JVSA 3V2HA 4PVDA 3W8DA 1B15A 3U0BA 3FNEA 2CVOA 2VWGA 3BYZA 4QSMA 5JCJA 1YOVB 2NVUB 2VNAA 1ZMTA 1KVQA 4BO0A 4KQXA 1DLJA 4DIFA 3DOJA 1ZZEA 1NXQA 2ZCUA 3WXBA 4LCJA 2Y1OA 4JJGA 1JDJA 4IDEA 3PWSA 5THKA 4ZA2A 3AUSA 5T8KA 3TL3A 2G82A 2GN4A 2PD4A 2ZTVA 3SLGA 1T2AA 1OC2A 2O2YA 4YT5A 1K6JA 3MTGA 4CLOB 2X86A 4J9UE 1O9BA 2VUUA 4XYGA 2J3JA 3PPIA 4J7UA 1UDBA 1DBVO 5EESA 4E2ZA 1EBUA 3FR8A 2TMDA 1ISFA 1H6AA 3I9JA 2DBVO 5K6AC 4ILKA 5AVOA 3TQHA 4PN3A 5JY6A 1U2DA 1DC6A 5BT9A 5C7OO 1O95A 3LT0A 4XQEA 3FI9A 3MTJA 3NDIA 4E21A 2PY6A 4IQ8A 3B1JA 4M49A 4HY3A 2Q1WA 2DTDA 1A4UA 4B79A 4O5OA 2NNLD 5JFOA 1HYEA 1YQDA 2W2LA 8ADHA 4U5QA 3TF5A 2Y0CA 4CMCA 5TLSA 3EAGA 2FSVA 1RM0A 1X7HA 4N5MA 3RUCA 4DTIA 2C2XA 1HWYA 2J5QA 4JLWA 5LC1A 3HDJA 1NFFA 1FF9A 1NNUA 3EYWA 4P4NA 1QV6A 3DHEA 2DFVA 5A02A 4R1NA 4BNUA 4XCVA 5JXWA 1DFGA 4RF4A 1T1RA 2ZYGA 1KIFA 4LISA 5AYVA 1UP4A 3RBZA 2B69A 1I2ZA 1ZK0A 2DAPA 3H2SA 3IJRA 4XJTA 3GNTA 3EDMA 2LDXA 3JYLA 2Y05A 3RBVA 2E82A 1QYWA 3GF4A 4IIVA 2YQ4A 3TL2A 3WX0A 2FR8A 3QWFA 1C3VA 3V1UA 1YJ8A 5A9SA 2E6UX 3JD4A 3LT4A 2ZATA 5AQ1A 2C20A 1I3LA 1EQUA 2WWRA 3ST7A 1XU7A 1U9JA 3I5MA 3JQ6A 4K28A 3KSDO 3ON5A 3C8MA 4JBGA 3I6QA 1X1EA 1X7GA 2HAEA 4LW8A 2HLPA 3HFGA 3BMCA 3PJDA 3B6ZA 4Y67A 3BXXA 4ND1A 3UVEA 4MP3A 3HDYA 4MIEA 3DMTC 2B5WA 3TRIA 4PLGA 4HUJA 3EGOA 1ZIDA 4F45A 2EKLA 4FC7A 4WLEA 4CV2A 1I30A 2DLDA 4U6SA 1NVTA 5L4SA 3AJRA 4IPTA 4DXHA 2CDAA 1YKFA 1GFSA 3DBHA 5L45A 5T6BA 2I66A 1HZJA 4H15A 4BNJA 2PKRA 4GX2A 1N1EA 1PGQA 3U9LA 2GASA 3L9XA 2OL4A 5KTKA 4PRKA 2BD0A 4YPOA 3AM4A 4J16A 3W4KA 4AFNA 1PQPA 4GH5A 5G0WA 2BKAA 4UAGA 4IMPA 3UFXA 4CMEA 4DQXA 1Y5MA 1CEQA 5ER6A 4UVGA 1VE9A 3ZI0A 2BFPA 2GRAA 4BNNA 3Q2IA 3D5TA 4ND2A 3QVXA 3OIGA 1VJTA 3AOEC 2Q2WA 4O63O 2H1SA 3I4FA 1PL8A 5F3RA 1ZK2A 3EZYA 3D3WB 1VM6A 1YL7A 4O6VA 3ITKA 1GCUA 3RUIA 2HUNA 1J6UA 1ZH8A 4CM4A 2EP5A 5TRTA 1KS9A 3C7CB 1FDVA 1HDOA 2DC1A 1EVIA 2C0CA 4TROA 1JWAB 4WCFA 3UAGA 5IJZA 1GEEA 1LXCA 5IDYA 1R0SA 4P8RA 5A5EA 7ADHA 2QX7A 4IXWA 3GNQA 4LN1A 4EEZA 1WNTA 2QZ9A 3Q6IA 4WNIA 4YT2A 1LDEA 2WM3A 4UUPA 3OA0A 1N92A 1R37A 2J3HA 2P4QA 2VT2A 4GVLA 5JC8A 3MOIA 3JQ7A 5KVVA 1NR1A 1C1DA 2Y66A 3DZIA 3ZWPA 1Y9EA 2QIOA 4E2WA 5EL0A 1HE5A 2IZZA 1LDBA 2Q1TA 2X9NA 3WLFA 2XOXA 4E30A 1XLTA 3B70A 2PV7A 3AI1A 2X8LA 3K5PA 1AE1A 1V3TA 3GDFA 1WDKA 3AI2A 4BNHA 2D0IA 2GN9A 1PJ3A 1ENZA 4JJIA 4BVAA 5DBGA 1YL6A 3AUAA 2GF2A 6LDHA 3JQBC 1SEVA 2DU8A 2P2SA 5HS6A 1WWKA 4R54A 1WVGA 1BG6A 5FF9A 1HDRA 3VZSA 4CMAA 2JAHA 2QW8A 3IKVA 2CF5A 4YQZA 2AQKA 1T2DA 3BAZA 3ZWOA 1E5LA 3NJ4A 3I1JA 4OKNA 3KYCB 4XQ9A 4DREA 5CDGA 4EUHA 5F1OA 4BGEA 2DM6A 5A4DA 5L95A 1P1FA 3L4BA 4L73A 3T4XA 5KVSA 3AU9A 4IJUA 4E31A 2IZ0A 1LEHA 1UZLA 2ET6A 2I67A
chains in the Genus database with same CATH superfamily
1HDCA 3ILYA 1JEEA 2PKQO 1SA0A 3MTBA 4P7GA 4QEDA 3OZSA 1UKAA 1WCXA 1SCUB 3FPEA 3MIZA 5SYNA 2I2WA 2P9CA 4UNIA 3IC5A 2HXSA 2IOFA 2OQ2A 4FNOA 1XLWA 3ROKA 4JZKA 2ZSFA 3E0XA 4JUFA 3OQOA 5CM9C 3L40A 2XBUA 2C2GA 4U2EA 4RJTA 2BGNA 1YZFA 3AJ8A 3G0IA 1IDN1 2OM2A 1ZOSA 1N32B 3OOSA 5BR7A 5EPOA 4PXAA 3DPIA 3ROEA 1JH9A 1SC9A 1G8FA 1W5AA 2PWPA 3OX2A 3PNVA 3BB3A 3O8QB 5KYNA 1E1QD 3T7SA 8MHTA 1K89A 1Y5LA 3MCWA 4XEUA 3DLCA 1AKUA 4CCYB 1N5KA 3PUZA 3P9IA 4OQLA 2EDCA 4LMRA 1BD4A 4EENA 5TVGA 1M6VB 1LY1A 2A1UA 2P3SA 4A5SA 4D4JA 2WSSA 3LCUA 5E95A 3CUUA 3NUGA 4H7FA 3QU9A 3KKQA 1ZK1A 1JIJA 2O8FB 2ZUBA 3GUVA 1PYGA 4ITRC 1YKSA 1VMIA 5E6RB 3TQRA 4FT2A 3P96A 4ER0A 2GCGA 3C1AA 2FSSA 4XA8A 5JROA 5EKXA 2NT3A 5AKXA 2E5LB 3IT0A 3H65A 3OQPA 3P5BA 1Z73A 2CJPA 1DDIA 1VKNA 1MB9A 4YAWA 3WV5A 1ZNWA 4GKAA 2B7BA 5ESXA 4MRMB 4ZVSA 2Z98A 2B78A 1BC5A 2CYAA 3DDUA 4A2PA 1QCZA 4AMVA 5KTNA 2AFHA 4WXYB 3K70B 2QN7A 3IQXA 2DUWA 1U5AA 1ZGHA 1CHDA 2A3NA 2YXLA 3PFGA 3QQ5A 1PW7A 1T6BY 1YB4A 3KPYA 2OCXA 4DN6A 5ADHA 4NG4A 4D74A 2QGNA 2EZ4A 1QG6A 3ZLJA 1UJ4A 3LAWA 4U9IS 3CLUD 3ZD7A 2O8VA 5I3ZA 1J8VA 1QS0B 2EW2A 2DFKB 1V41E 3GJSA 2VJCA 4TL7A 5MF6A 2QW0X 4J3FA 2FPKA 4RZHA 4WCDA 3L49A 1GJRA 1YBVA 1J8YF 4NP6A 5DWDA 1PL0A 5HBGA 1KI6B 3PC8C 3SSOA 2Q3HA 3EHEA 3VYRB 5KYVA 4AKGA 3RCBA 4HDNB 3J7AC 4OQPA 4NNOA 3QBTA 2JCXA 1B0AA 1XVVA 2DX7A 4PLVA 4QOHA 4KTTE 4Y7CA 1WP9A 2D4AA 5FB3A 3ETJA 5REQA 2G9NA 6AT1A 2EFEB 2RCYA 4RV4A 2JJYA 4KQMA 1P1CA 1ZUD1 4PX9A 1ZN7A 3HCAA 4J07A 3D02A 1W36D 3OF5A 7MDHA 1HO3A 3OSZA 3PA8A 4B6JA 4JJFA 4YFYA 3MB5A 3MW8A 3K6SB 2ILTA 2PGIA 3CG4A 3PKJA 4PLWA 4NCBA 4RHCA 7REQB 2YVUA 4FJ2A 2A7QA 2VPYA 1J22A 2GFIA 2J3IA 2NV2B 2YMLA 1BROA 2BKVA 4RMIA 4BP1A 4XWYA 4W9MC 1FFHA 1WU8A 4IR7A 3DE2X 1TYAE 1B16A 1MB3A 3PGMA 2B4YA 1KKUA 4NZZA 5EJ7A 2JLUA 1ZONA 2QP4A 4I55F 4JBYA 5DO9A 4YNBA 3IAS1 4ZC8A 1SCIA 5EE1A 2I99A 3WB1A 4D0SA 1UK8A 3WKAA 3JWJA 1L7OA 1AGRA 1A5ZA 3FNBA 2C2MA 1RRPA 1Z13A 3F6CA 3HLYA 4YROA 5JQWA 6ADHA 1A1SA 1N2ZA 1L5HA 221PA 4M21A 1IZYA 2OUKA 3QTBA 1Y7LA 2X19A 2ZLBA 1ZUNB 1T3HA 1FFGA 1ORWA 3NKVA 4JJEA 4BAUA 1P2SA 4LVNA 3GLFB 3WE7A 4RZQA 1Z34A 2Y1EA 4LBYA 3HUDA 1E0JA 4MQUA 1AY0A 3SIPA 3F96A 4G5XA 2X0KA 2QXYA 5GM2A 4ENWA 4UNSA 4LZOA 1BQEA 5FFMA 3UUEA 4A82A 3T5PA 1VG9B 5D3KA 2PRSA 3M34A 2UVDA 4G5QA 5F21A 1VGRA 2VDQB 1GQ2A 1CR6A 3V2UA 3FPFA 1GV1A 4QYWA 4RELA 5A4MS 5AHWA 1C8LA 1PFYA 4R05A 1W4CA 4DUPA 1MQAA 4FDUA 1M0SA 2BGMA 3GFOA 4KW7A 5DEOA 3LD9A 1IHPA 3CF4A 3A1WA 2QMYA 3WG9A 4Q4HB 2GERA 2P62A 5FJJA 5MN4A 1SC1A 4JXJA 3FKSA 4TUYB 4UHJA 1B0ZA 1R9JA 3C3WA 5B1EA 2ZR0A 1Z7BA 4IGIA 1DWOA 4NK4A 4J7XA 5AUOB 3T5GA 4I81A 1CVIA 4BGUA 3P9CA 3RJ5A 2QX8A 5LXTB 2R2GA 2BGWA 2IHUA 4V1CA 3KKZA 3HZOA 3KKNA 3L2OB 4MV6A 4WINA 4EPVA 2PJZA 3EA0A 3VU8A 1WA5A 3LW7A 1IBLB 5JC1A 4Q93A 1KERA 3KZ1E 4HDCA 4DLPA 3J80A 2XMZA 2OXIA 1JKXA 4M8IA 4EHDA 3ZGZA 3I58A 2F48A 3B51X 4CM5A 4XFJA 2DBQA 1JG7A 2FMKA 3DEZA 5D85A 1P2UA 1USWA 3ZZNA 4MV1A 1IN7A 2AYYA 3SPXA 3HFJA 3WA7A 1X80B 1A72A 5IBQA 2GLXA 2ZSEA 3K0AB 1QV7A 1TM4E 2VYQA 1RQ2A 3T7KA 3IDZA 5DYNA 3MJ4A 1VDMA 2CCJA 4BPBA 2ZWIA 3AB8A 3T35A 1FCJA 2Q7OE 4OP2A 2FUG1 1Y1TA 1AUXA 2VYFA 3H86A 2EBFX 5FWAA 4BBJA 5K8IA 1ZJYA 4DV0B 3IUSA 1CUXA 1X1TA 5J4HA 3OF2A 2YQ5A 3OPYB 1LFDB 4IIXA 1U0JA 4GPBA 4C05A 1GRCA 2C9OA 5I9MA 1P1IA 2ZB8A 2ZRQA 2NV6A 3D2CA 1X14A 3QEMA 4TMXA 3H1GA 3S2UA 3A28A 4CIVA 1GCGA 3OT1A 1TZJA 4C4AA 1GTJ1 2B4TO 2VEDA 5CG1A 2P9QA 3PSHA 5A5GA 2IH5A 4PZEA 5SZHB 2UXBB 4KR3A 2RHCA 4G1CA 1TIKA 5FP0A 1EUYA 3RT9A 2WYIA 3RKRA 1GA4A 5K0EA 1ISJA 4IRUB 1RHKA 1E77A 2OWDA 3KALA 4WK6A 2FQYA 3AFNA 4OHUA 3UOAB 1M8PA 5B5SA 4TZ6A 2CLIB 2GSWA 2MSLA 3QVUA 2YS6A 1L4UA 3OUTA 5LMNB 1IMJA 1Q20A 2HD4A 4JT4A 1Q91A 4RLSA 5C1PA 1DG9A 3LYAA 4FQ8A 2AX3A 3IAM6 3HKDB 1QIMA 4E5YA 3H83A 2IYXA 1VP3A 3OIDA 2G1KA 2IZ5A 3HCFA 3WLLA 2X4IA 3WYDA 2JLQA 1NBOA 2GNPA 3F90A 1I33A 2ODNA 2BUBA 1OC4A 1T3TA 3NOVA 3NWPA 4P83A 2H06A 4UUOA 1VJ1A 4GZ6A 1NQTA 4CYMA 5LQDA 3OQVA 4HB2A 4O33A 4QIHA 1IIRA 4LRQA 2PYIA 3D2BA 3TNJA 4FPXA 3CC8A 2A9RA 1H3NA 1N8KA 4OB7A 1TAHA 3H3FA 4JN6B 4P93A 1Z5UA 1OFVA 4RM2A 2CFOA 5HTOA 3EVDA 2CBXA 2MYNA 4HGZA 4DUGA 1X7XB 1NOIA 2H5EA 1FY2A 3TBFA 3QNMA 1N5DA 3K94A 1WDMA 3Q7SA 5HEKA 1C7FA 1EM8A 4LE2A 1ETHA 1WDLA 1W4RA 3R44A 1W85B 3HKBA 1LGYA 4Q4JA 3VBCA 4Q15A 4D80A 2J5XA 4DZTA 4EY3A 4RIIA 4HNSA 1PUJA 2WSYB 3I1IA 1A8QA 2QZZA 3WL7A 1NE7A 2QNBA 1LLUA 1MX1A 3UAOA 3LUBA 1W49A 1BDHA 3SSAA 2V4MA 4OYYA 1SUFA 4UTNA 5IT9A 1T5SA 2OGZA 4W5QA 4N7BA 2DP4E 3AP2A 2WQZA 4OB6A 1E2BA 1F60A 4HNAB 1GOTA 3T7IA 2GBLC 3C6MA 1BXZA 3ZDXB 5A9RA 5LZ9A 2XCSB 2IU0A 5JW6A 2IF2A 2A9JA 1XL1A 3MTIA 4BQPA 1V9SA 1GQYA 4KRXA 3ZBPA 2QYSA 2VG8A 1D4ZA 1FUYB 3FYHA 3SK0A 5FA8A 1JU9A 4W8OA 2PKCA 3GP8A 5FA5A 1IHUA 5ALUA 3QYAA 1HE2A 3AHGA 1Z8NA 4M9RA 3F8SA 3EMKA 4FZ5A 4MICA 2FRVA 1CQJA 3U37A 5JD5A 3ANSA 4QECA 5IW8A 1USKA 4EX6A 1UIMA 4XR9A 3REGA 4U7GA 5EZYB 1YCGA 1NN1A 4PSCA 2D0PB 3ABOB 4CODB 4HF7A 2A0UA 4EFDA 1QO0A 1KH2A 3QXHA 2IKQA 1QYDA 1VKZA 1UJ6A 3Q3VA 2AVDA 4O4HF 4YTEA 5A0FA 5K1ZA 1KHHA 4BMNA 4BO2A 5B4UA 3O8RA 1A27A 1ZI6A 4MXDA 1COWD 2XIQA 4QGBA 3X1WA 4ZP1A 3C6ZA 2QTCA 3H2IA 4KNWA 3VV3A 2C54A 1XCGB 4EOGA 5K3FB 4FYYA 1Y48E 2WSSD 5I7SA 1QKJA 1Z6GA 2OCLA 4YRFA 2P65A 4DAEA 5DBOA 4HQRA 5E6UB 4GR4A 1YU6A 3OU2A 2BONA 2GPBA 4DA6A 1QWSA 3I6BA 3DBRA 1PIWA 4RHYA 4U9HS 1Z0JA 3T3EA 1U0NA 3O2SB 3AZOA 1XD2B 4M83A 3DAYA 4CV3A 4E5VA 2ERCA 3TL6A 3ZW8A 4OXYA 4ZCRA 3ADOA 1G38A 4ARIA 1W75A 4H7DA 3S2GA 4NZMA 4PLHA 3UJ8A 2H1IA 3UIEA 1ILEA 2Y76A 8LDHA 1CRWG 1HFEL 3TB6A 4D42A 2BI8A 2FZWA 4Z9XA 3VMFA 5ENDA 3INTA 4QUDA 1EB9A 1EHYA 3L7AA 5C81A 3A27A 1EG7A 3NWEA 4OA5A 2J9XB 2PZFA 2WSBA 4G8JA 4CGYA 5LVAA 1RHQA 2O8EB 3IVRA 1T0IA 1ZMOA 1SJ9A 3AF3A 4P7BA 4W1RA 2CXPA 4XGNA 1CKEA 3TLKA 2R6ZA 4TRNA 1Y8QA 1W85A 3HKBB 3AFHA 3AYXB 1WKCA 3QKSB 4R69A 3IOEA 3X43A 2QIPA 4C6RA 3OIFA 4Q3LA 1CBUA 3SBXA 4ZK6A 1E7RA 2WIKA 3RIHA 3ER8A 1EFVA 2Q8NA 1JSRA 1ORIA 2BE9A 3OPXA 3WHKA 1H2BA 1ZIXA 1GILA 2GS9A 4CF4A 4ESEA 4HQ6A 4AJ4A 4C0JA 1RIFA 2JGMA 3ZWBA 2HMUA 3CTMA 2FPIA 5FOXA 1BE1A 4AZVA 4D3DA 2GI4A 2A0XA 4UD6A 2FR8C 2HU7A 1G0NA 4OXKA 5F9FA 2F4NA 2O2IA 2XQFA 1LS6A 5DASA 3N5KA 3D54D 3PVCA 3U7HB 1N6IA 3N3AC 2H00A 1EQ2A 3KXPA 5AW9A 1QGED 1ORVA 3I04M 4DM4A 2JGIA 3H5IA 4L3WA 4CM8B 3EPKA 2HZ7A 4RK4A 2QL7A 4D8TA 3I8OA 3WAKA 1NI4A 1HSOA 2HXYA 5G3ZA 3IP9A 1OX4B 1MG5A 3QMVA 1D2AA 4LJ5A 2YJ6A 4NBLA 4OHOA 4Q7JB 3UMCA 3MWEA 1C0EA 2F7SA 3COWA 5IBRA 3OTWA 3BSSA 1HQCA 2GJKA 1TA4A 1C8BA 1JW9B 3T7AA 1NRJB 5EVCA 5ITWA 4J4TA 4R84A 4TLCA 4YDSA 1WOYA 2O0KA 5DGIA 5K8VA 3AC0A 1QC5A 2RGNC 1KJJA 2FWAA 3QE4A 3UB3A 3CO0S 5KTSA 2BFBA 2XTZA 4QQRA 5T3YA 2YH2A 4DRXA 4HAOA 4CUKA 1IG0A 3ZDZB 2E4WA 1L5FA 2X40A 1MG0A 2W2KA 2VBGA 2I7XA 2E4XA 1IY2A 4JVLA 4KPFC 4JIMA 5SZIA 1LRKA 4R41A 3KVNA 3P9ZA 3H97A 4IIHA 1QYXA 1Y4ZA 1B3RA 3IURA 3LQFA 5D5QA 5HX7A 2VPQA 3NTRA 1GDTA 4FWTA 1A2OA 1OQAA 2M32A 1QNFA 5DTIA 4ZANA 4N5DA 3EFOA 1R00A 1QIEA 4MS4A 4HGRA 1YJBA 2QI9C 3NAQA 3QPAA 3W2TA 1KNQA 4EHNA 5AVVA 3F0TA 5CVDA 1AD2A 1UMKA 1NSYA 2FEOA 5KYYB 2WMNB 3IBSA 1F5NA 4HGOA 2HJWA 2PMCA 2YJNA 4G9BA 3VR0A 3NT5A 1ICIA 2KBEA 1G16A 2PIAA 2HYIC 5A2GA 4Z4FA 1SFRA 4GL4A 1CERA 4UOQA 2EHDA 3RB8A 2RB5A 4L4XA 3WK6A 3I0NA 2QL6A 3PPWA 2RONA 3MMPA 4G8CA 3A1TA 1UOQA 1G8PA 3ZCXA 1E9RA 1TM7E 2WT9A 2C5FA 2YX1A 4B6RA 3USCS 3HYLA 4MPTA 4H1WA 1RNLA 4ZVKA 2ZTUA 4BEBA 4GPTA 4L8FA 2FB9A 3GRKA 1H05A 3G02A 3FWNA 1YR7A 1LDYA 4U2GA 1GLGA 1XGKA 3NHMA 4IOJA 1GTZA 1BXGB 3T3HA 1BOFA 1V9LA 5H8WA 3E9RA 2BI4A 1MV8A 1SR8A 1THGA 4QGSA 2Z0MA 4IYRA 4RAOA 2ADMA 3VR2D 4P0PB 3WGTA 3Q3EA 1BXRA 4XJSA 2V8BA 1JHVA 2PBFA 2H52A 1TYZA 3OZDA 3PXAA 2QN8A 3CBGA 3QVSA 4RKQA 2GZ2A 1EWYA 4RQTA 1RC1A 3L8CA 5AQEA 1KXZA 3FNIA 3PL1A 3KQKA 2W4IA 4Q03A 2YFKA 2IRWA 4RYDA 1E59A 4FONA 2FPRA 5DM4A 5JRDS 5CVTA 3HE3A 3D6UA 3U13A 2JAQA 3JR7A 2PRZA 2QAIA 5A9SB 2BTOA 2R97A 3LO5A 4PYOA 4IWXA 3ROXA 3FVWA 1I4TD 4GWGA 2OLEA 4ATNA 1OH8A 1WZUA 3IDOA 1SOUA 1OPRA 5A05A 1KJNA 1CIJA 1L5SA 1O5OA 2I55A 2ZJYA 3KCQA 2P8JA 3KU1A 1Q22A 3MGGA 4W5WA 4OXQA 2F55A 3BMNA 2QYOA 2B5VA 2RGNA 2E3JA 3QUQA 5TT0A 1C29B 3FDJA 3SC2B 4KQWA 3ESRA 1ES9A 1HNWB 2ZEJA 2GLTA 3VVLA 4QT0A 5AKJA 1IY9A 4BATA 1G21E 1P7YA 3PHLA 1XWFA 4B4OA 4A6EA 1Z82A 3JYHA 4N3AA 1HYQA 4LHSA 1JIIA 3HVIA 1M2VA 5ALIA 1D07A 1FTQA 1PNTA 3BWBA 4ZV4A 1PEDA 4H0CA 4INJA 3HBNA 3PHHA 2J08A 3HY6A 5CEJA 2OMKA 1HOTA 2QT0A 2FSGA 2FNAA 1NWHA 3EZNA 3LYLA 4OKSA 5EAIA 5A5VA 1E9VA 1L5WA 2ZAYA 1G8HA 3GFFA 2OEPA 2QTVA 5CLIA 1U7TA 5CM2Z 5FPPA 1JPVA 5FJIA 2IYEA 4QATA 4AJ2A 4DJTA 1EG2A 4HX2A 4JQZA 3U2QA 2H08A 3II6X 3GCGA 1DC8A 4OBWA 2IGTA 1YHZA 1UFOA 3DGFC 4Z3DA 5A6SA 3DEYX 5KQRA 4ALLA 1GT6A 3GA7A 3FR7A 5CAEA 2E87A 4KWEA 5KWEA 2GN2A 1BOOA 3C3CA 4K5QA 5NLLA 2YWCA 1TA0A 1OLSB 3L7JA 2CSXA 1ADGA 3DH0A 3KPVA 1Z47A 1PJZA 4KXMA 4PPQA 4A1FA 4F11A 1K88A 1G64A 2W8ZA 3BRWD 3G2KA 4Z4IA 4BMDA 1PLKA 1YV9A 2HSDA 3OQJA 1CX9B 2PVSA 1KA9H 2Z08A 1C7QA 1XRLA 2GHQA 1CYDA 1IOVA 3ZEIA 2Y2UA 1HPLA 4PSKA 3ZHCA 3TFOA 2KM1A 3EIEA 1NMEA 1CFZA 3LLMA 3VPGA 1WMFA 5IUKC 5AVQA 1RLMA 3KFLA 1X9IA 3L07A 1SOAA 4N6OA 3B9QA 2OFPA 3ZCSA 2XCIA 5ED0A 2H5JA 1COZA 1KJYA 1T3SA 2BZGA 2AJCA 1J09A 2CLFB 3F74A 3IXQA 4FFMA 5EERA 5HFNA 4C88A 4ZK2A 2FY8A 1FMJA 3RUFA 4LC1A 3TIXB 4X65B 1ZIPA 2GXSA 2YMPA 2PPLA 3PK0A 1JTVA 4WI1A 3WLTA 4L5YA 5K0LA 2O7SA 3IYLW 2Q1XA 2X7XA 3ZW9A 4B1FA 4MVYA 4EB8A 4OHRA 4A0RA 4K9OA 5I7RA 1GZDA 1U9CA 3K53A 4TYMA 3X2SA 5BXYA 1U99A 3DZBA 1P4RA 1QM5A 3ENVA 3O2NA 3WQQA 1OLSA 3JZMA 5HFJA 1RJFA 4MRMA 3COSA 1TC1A 5CFRA 1DAMA 4FUTA 2C96A 1R4NB 2WIBA 3E5NA 3KVVA 2POQX 4L51A 1CDZA 4MJ3A 2TMYA 3PEEA 3OFSA 4FSDA 4WH0A 3IEKA 1K6MA 1NI5A 2PQ6A 1UT8A 3LS2A 4HN2A 1D3AA 1F8GA 3GGPA 1RWWA 2R62A 3TTWA 3UXHA 1IM5A 2W42A 1QZ3A 4QJBA 1H66A 2Q2NA 4IICA 3WYGA 3NHBA 2KLHA 1QHXA 1RLTA 2OGSA 1EE2A 2VDJA 4KTVE 3BSYA 3U3JA 3Q8MA 1WUYA 4G4JA 1GGJA 3V3KA 3K30A 1Z2EA 2B8TA 3QFHA 4CI9A 3KELA 4UBMA 5J2TB 3NV9A 4BECA 1YDHA 3PXGA 3I5UA 1GG2A 1TJPB 1LTHR 1P4AA 5YASA 3ZR4B 5EWMB 3NIGB 2PG3A 2V6MA 1WLSA 3OWXA 1YS2X 4WJZA 4PZDA 2XGGA 1EU1A 3QEJA 4ZARA 2XCRB 2E4UA 4ICIA 4NC9A 2I2AA 4C5AA 1OZGA 2IVFA 5JXGA 2O8BB 3CX3A 4PHGA 3CUKA 3AWDA 4Y6SA 5HGJA 1D6JA 1PR9A 4LOLA 3SR4A 3NDBB 1M0WA 1PI3A 4MO9A 2IS2A 3UUGA 2CUTA 5TSDA 1HRKA 1G8SA 4E1VA 2C7GA 2X7JA 4Q9DA 2I4RA 1FDUA 2WDPA 3JD1A 4IDBA 3PDIA 1VLQA 3DOOA 3NHLA 3HL4A 3OKCA 1XMVA 1LD3A 1Z2AA 2C1XA 4ZV7A 3CRNA 2CHQA 3IQFA 5I8WA 4DSOA 5JSKA 4LVCA 3OT5A 3DDSA 2YINC 3G82C 4PGAA 1GYQA 2YRWA 1B00A 4FFBB 4IKPA 2WHRA 2O3QA 4URZR 1JG1A 2I3GA 4I8DA 1UPTA 2A30A 4HAYA 3BORA 1XFAA 1E1RA 4WN9B 2X0RA 1JHQA 2Q4TA 2OG2A 1UWLA 2R5FA 3GI1A 3AR9A 4M7RA 1QR2A 2RHLA 4CHGA 4CETA 4KFCA 4GI3A 4EHAA 2O20A 4BB5A 2OZPA 2UYYA 4WSOA 2SKCA 1WL8A 3UHPA 3C39A 3B1ZA 3L0YA 1QOPB 4MGIR 3CA8A 2AKYA 1ULSA 2PMDA 3FVVA 1VIAA 3GEHA 1C14A 1A5AB 1P7PA 2I1WA 4QYSA 2GEBA 3LU1A 1Y1SA 5FWDA 5LLSA 2AJ8A 1KI9A 3C74A 4DE5A 3SJZA 4ENQA 1WV1A 1TJNA 1WMAA 4F84A 2GEVA 1VPTA 1DAFA 2ATEA 3WGGA 1EI9A 1F3LA 4KQGA 5FL7D 4XB1A 2IWRA 1RRCA 3PGVA 5FNVF 1NJ1A 2VAXA 2VDKB 2XGOA 3WBBA 5JCPA 3R9WA 1MJ5A 4QT4A 2AIRA 1S3IA 3C3PA 3KXIA 1UUFA 2PQMA 1W52X 3HJTA 2PD6A 1USGA 4O2BF 2XRZA 4IXTA 3ZDYB 4KQ6A 4E13A 1YA4A 4OMCA 1F8YA 4PPFA 2RIPA 2HGSA 1KO7A 1NW4A 4KP7A 3F78A 2Q1SA 2WNIA 2ZSAA 3EJWA 2G4VA 1U2RA 3HEBA 4WL0A 4RFSB 1HFJA 1O6CA 1KQNA 1QANA 4ZVOA 1FLDA 3ZS9A 4QHSA 4BIIA 2OV6A 3FDIA 1AK2A 4YUVA 5TDHA 5FFFA 1K75A 2X2EA 3PLNA 1AB5A 2G71A 3EXIB 1GN8A 3TK1A 4OJNA 1PEKE 2OHIA 1ZR2A 3JATA 4S12A 4Q3AA 5BW5A 3T1TA 1NN0A 1BRTA 2DHEA 3BFXA 3RFVA 1O6ZA 1U0GA 4PRLA 3RE1A 4F6LA 3UT6A 4EJFA 1RM4A 4I36A 5JYBA 4D81A 5JATA 3L6RA 1ZD1A 2YWRA 1C30B 4HLDA 2IZ1A 3AF1A 4EPXA 1VRWA 4BMPB 1QQ7A 4DR7B 1YJCA 1Z37A 2WJIA 3T61A 1W581 4K88A 1Z3IX 1ZI8A 5EFOA 3HK2A 3NXSA 4WCFC 2I3AA 3PFHA 1EGAA 2R4UA 3USES 1BN7A 4H17A 1JLRA 2K7ZA 4H35A 4HXYA 4KLZA 1VCMA 4HWTA 1SBZA 4ME6A 5AHRA 3RV4A 3H3JA 1FPQA 2C9ZA 3BULA 4II2A 1VKOA 3AHEA 4PX5A 2O8FA 3DBLB 4F7DA 3WXMA 1VQ1A 3CF2A 1R8SA 2GO1A 3FI0A 3BWEA 1RBZA 2HADA 1W1WA 4MZDA 1O58A 1CQIB 2JAPA 3IVCA 4EEXA 3AF5A 3RSLA 2JI7A 4C01A 1CJSA 1Y9AA 2WKWA 3C1OA 4G25A 3ONEA 2YZ7A 2G70A 4FXPA 1DI0A 3W3AH 3UGTA 3N76A 3ZQUA 4BX8A 3J7TA 4HLQB 3UAYA 4JVSB 3ZWXA 4DDKA 2OV3A 3PJFA 4NH0A 1O57A 5BN4A 4BNDA 2HIMA 3I2YX 5IANA 3QOWA 3MBOA 1DKQA 2AQ8A 4XUGB 1BEUB 3GEBA 1ST2A 1WQ4A 5D3QA 3FGPA 3BD8A 5KYGA 1T0JB 3I34X 1NBME 4ZN6A 3C85A 5A7HA 3K5HA 3ZQJA 2QUAA 2JBAB 1BKDR 4UHFA 4DNPA 5BUZA 1ZX1A 2QX4A 1GPLA 1DE0A 3STTA 2H1RA 3GMIA 1TAQA 3EIWA 4URHA 1J0EA 2I4MA 3ZS8A 2RAPA 4Z7NB 3MEQA 5LQSA 4DWVA 3LLCA 5CPBA 1ORHA 3FYUC 1QLJA 1U4SA 3NBMA 4LV6A 2FW8A 4U63A 3T7TA 5B2EA 1ESEA 2QRJA 5AKIA 1CS0A 4DEXA 1R0KA 3WIBA 5IS2A 3A3KA 2WHQA 4J1TA 3HB5X 4B7UA 1K3UB 3D3NA 5K3AA 2P68A 3BF7A 4O4JB 5C3MA 2AFIA 4Q7LA 3CXUA 4GMDA 1KAEA 1XK6A 1BS2A 1HYHA 3JQQA 3HBFA 3DDCA 2V96A 3SY8A 3WYBA 4MUHA 3TM5A 1X3LA 4B9AA 3GX1A 3RSCA 1NASA 3EEYA 4HDNA 4IIJB 5HIMA 3S0JA 5EJ8A 1Q77A 1T6NA 2G76A 4OBEA 5SICE 1DXOA 1K3TA 1RYFA 4XYEA 1EPUA 3ESDA 4HWOA 5TF4A 2REQB 3WGYA 1KP3A 2BUAA 1TTQB 2BEJA 3HRIA 3IMGA 2YYSA 4N5NA 4MUEA 4U0KA 1GPH1 3K9BA 4G41A 1R0WA 4AY2A 4IIGA 1FFYA 3BSWA 3AEUB 4KIUA 1P0MA 4XSHA 5JSZB 3H9JA 1J25A 1I0IA 1N0VC 2EIXA 3AKCA 3AUYA 3PX2A 2P9FA 4FIDA 3V8PA 3IAEA 2HPHA 4X5OA 3U7GA 3H1TA 1AZTA 1R0ZA 3ZHZA 1ZXBA 3UAVA 4PLYA 5DBIA 1GL7A 4MV8A 4RTOA 1FZTA 2BUCA 1V37A 3DPSA 1PR2A 2RH5A 3LNCA 4DVJA 1W96A 5JARA 5CJJA 3PUXA 4OI1A 1HDZA 4R1TA 1D03A 3D6JA 4DCPA 3KJQA 4LXGA 3WWOA 4LC0A 4IDAA 3M3HA 3PE3A 1V8FA 2HHJA 3G7UA 3QH4A 4EHIA 5ICCA 3W6ZA 2EZUA 2RG1A 4G5SA 4QDJA 2GBLA 3EK2A 4X1YA 3TD6A 1ZFNA 1M6HA 2CKDA 5ALKA 5JDCC 1NHWA 4JELA 1T8SA 1AGNA 1E2UA 4WKCA 4CQMD 3F49S 4RCYA 5K05A 1P9NA 1BVHA 4J2HA 4XCXA 1SC6A 1EK5A 3DTYA 4FW9A 3CT6A 1Z83A 3HRHA 3K9LA 4NKRA 4RWZA 4U3JA 5T3UA 2FEAA 3ZCUA 3GQBA 5EJ2A 3RVNA 4YV2A 2XZTA 1W8DA 3IQGX 2AOUB 3NHFA 4HDSA 5K2OA 1XEWY 1W46A 3NEAA 5EHXA 4UUAA 2XNJA 1AX9A 1E2LA 1Z17A 5H3HA 1ZD9A 4GPAA 4UZEA 4LOKA 1F2UA 2GEUA 2G5CA 5E7QA 3D31A 4MLDA 2JFOA 3IIKA 4RLHA 3GGGA 3SDBA 5B1DA 2ACVA 4FHFA 4FN5A 2NZVG 3LPDA 4FGSA 5AW3A 1J7KA 5TGTA 3NBAA 2ORYA 1NIPA 4HJRA 5MFZA 1W25A 4FFBA 1RI5A 3OPNA 2GYVA 3ERCA 2H6EA 2PR2A 3EOBI 4Z6KA 2HRBA 4NJMA 2DQ4A 3NANA 3UJHA 4BB6A 4MWZA 4C4PA 5L7WA 4S2EA 4DA0A 1W19A 3VUEA 4Q3KA 1SZDA 1HL3A 2WE7A 2WT8A 4HAWA 4C7VA 2WJPA 1EGHA 1K8ZB 2VFAA 1L1FA 4CKXA 4F2WA 1D1PA 3DLHA 2CZQA 4PANA 4TTPA 3OSUA 2WSLA 3E8XA 4P2GA 5D3MB 1TGYA 4EVSA 4ER3A 2D5IA 3GJQA 3GFQA 1PP4A 4UW9A 4L4ZA 4E1AA 2PSSA 1UOOA 1O2DA 5HZHA 5HR5A 3BH6A 2ZVJA 3GPLA 3SGLA 1D04A 1J8MF 1FDIA 1PDOA 3GFGA 3ADBA 2JLVA 3K73O 1I24A 3NJRA 1M6EX 5FUXA 3GRRA 1EFRA 1ECGA 1UKEA 3BXZA 1JJFA 1GZVA 2ALJA 1QB8A 1YACA 3OBIA 4RJKA 3ETNA 1Q44A 1YAHA 4EUFA 3PFCA 4Q47A 3JALA 3LOPA 1G8AA 3CONA 4DBVO 3WS7A 3BF8A 5EGNA 3QGMA 4L5JA 3RARA 3SJ7A 5CDSA 2FLKA 1MX9A 2LWIA 2VP6A 2LE0A 2YASA 4B7CA 3QF7A 1V39A 4D1YA 5B7NA 4K0RA 4C0AC 4BGVA 4C6HA 3INRA 1LDMA 4UEWA 4M7WA 5E9WA 1U9IA 2ZRKA 5J58A 3MS2A 3S8YA 3TW0A 1EEXB 1YKGA 5COAA 2IV7A 4Y2TA 4ESHA 1WKVA 4MEJA 5FA6A 3N74A 1XTRA 5E3IA 4RZUA 2WVGA 5DPMA 4P9NA 3V00A 2OHGA 1XAGA 1VHDA 3HPQA 5HRAA 4ZGBA 2P9EA 2V45A 3ZPXA 2MYPA 4ZD6A 1DIGA 1ODLA 3RUHA 4AN1A 1L7BA 5A4JA 3UK2A 1SH7A 2GXAA 1JFFB 2J7KA 3OEED 4IYJA 3WBFA 1NNSA 1M2HA 1JKIA 2Q5CA 5LMUB 3VH2A 3HCRA 1ZBDA 1VKRA 2IHTA 1RYZA 5DHTA 3GA5A 1S7GA 2R79A 1MQ9A 3C5HA 2MMCA 3ZGLA 3DAPA 3PDHA 3UV3A 2P90A 4POOA 3MOSA 3IAXA 3GBPA 1Y33E 3THWB 1LBEA 2BFAA 5ELLA 3R7WB 1C9MA 3HYNA 4HDKA 3RFUA 3N7TA 3NHUA 3O92A 5HS4A 3WP0A 4LRSB 4FYIA 3I6MA 4BO8A 4WE3A 2ZBPA 1TRKA 3HA7A 1PD0A 2GN6A 2W2PA 3DLIA 1D6SA 3IEXA 3GJ0A 4FDLA 3WGHA 4BQQA 3H1FA 4LMAA 1HYGA 1OLOA 4QDUA 1JEDA 2C4MA 3GLUA 3P0RA 1TLLA 4FC6A 4Q37A 4TV8B 5ALMA 1AHHA 3ZLUA 3ZZUA 3E9DA 4Z7OB 1BVUA 1RBMA 1XSEA 2IIPA 5LUBA 1QGOA 2R48A 3UT5A 4DLTA 1GAEO 2Q41A 1U7OA 1EVKA 3SEQA 3TLGA 1BMTA 1Y9JA 2H0AA 3DE6X 3OVMA 1L6IA 4WNAA 1QE3A 2GD2A 1S01A 1XV5A 1L7NA 1RAAA 4NENA 1A9QA 2RHGB 1XP5A 4BFTA 2FFHA 5JSUA 3AY6A 2BJVA 4YP5A 4Q12A 3KD2A 2BKXA 3G8DA 1PHRA 3WGVA 1V5WA 2QTBA 2XQVA 3QE9Y 3Q9UA 1YZGA 4KH1A 2YV1A 2YIJA 4H1VA 1WZIA 4JXKA 3ZU3A 5D86A 4A8TA 2Y0EA 2PSHA 3AR4A 3R24A 4RIFA 3SNKA 3TCNA 4BVEA 3R5KA 4OMFG 3PC6A 4BBZA 4FHZA 2OV2A 4KU4A 3VYWA 1VIYA 3JZAA 1FNNA 1Y81A 4A7PA 1SOVA 2PMWB 3ZOKA 3GLIA 1MAHA 1RHUA 5EJMA 1FRZA 1UJMA 3O8OB 4JWTA 1GGNA 1L7XA 5HF9A 1XMJA 3WKBA 2Q3LA 3KEQA 3G2MA 1E9BA 3T99A 1T2EA 1N2HA 1JJ7A 1T8TA 2G67A 2EW8A 3EXFB 3VPFA 3VR6A 1YZYA 3RVLA 3GEEA 3BT7A 4XASA 2CMFA 1UZUA 1V1MA 1Z6TA 3TLGB 1Q19A 1CP2A 2WM2A 4LJRA 1CZRA 1BE0A 4B76A 1C0PA 3NTXA 3PL5A 4QBIA 2OORA 2F64A 1DADA 3MLAA 3BCRA 1V4VA 3FLEA 3T9AA 1SXHA 4NU5A 3AKDA 2XQJA 3IQZA 1T3ZA 1JR2A 2C4TA 1SKYB 3KU4A 4GP7A 3QX3A 1ONNA 1PZFA 4QYXA 4WZBA 4AZWA 2H65A 5HKKA 1HYBA 2HI0A 3BIWA 3PQDA 3TLBA 2NACA 3DE0X 5EUQB 5C5EA 3OCCA 1QGAA 4Q16A 3R76A 1TO2E 4RTKA 3ZWAA 1NKVA 1TUGA 1WPRA 4Q24A 2XHZA 1Z0IA 1RKUA 3ITEA 3EIXA 4PS0A 2EARA 3LUAA 2Z5VA 3R23A 1T3GA 3AHJA 3I2IA 4FGUA 3G9UA 1DC5A 4YAKA 1NLMA 3TIVA 2LUOA 2FMIA 4M0CA 3VU9B 3B3AA 1ZZGA 3CNBA 3WMXA 3CR7A 3ZWDA 1YE3A 4P5DA 1TO6A 3UJBA 4YUAA 1YB2A 1OGIA 1GKKA 1EJ2A 3OQHA 1X80A 3LHIA 5THXA 3AVVA 2ZIVB 1CUBA 2MTBA 4OOFA 5JXIA 3PNSA 2P69A 1U80A 3FBTA 4PO8A 1C9YA 2NO6A 2P40A 4Q1EA 3KR1A 1DAIA 1XFDA 2DR0A 1ZH2A 1JSZA 3OLWA 4H9GA 5CURA 5EZ5A 1KK2A 5IP5A 3INNA 3KXLA 4EL0A 3U44B 5GJBA 3RREA 5KKAA 1EAYA 1T1EA 5PNTA 4ZXPA 2H4HA 1ZCBA 4TQ9A 1VPEA 4PM4A 1KORA 2OCAA 4ZHQF 5FTLA 4TYYA 3AKZA 3G6KA 4KXYA 3U7QA 1KEKA 3TQQA 2XNDD 3G2QA 4TSFA 4DT1A 3OHSX 2X8JA 3DFKA 1EDZA 1NNI1 1ISIA 1J56A 1KO8A 1NN3A 2YTZA 3CH4B 1ODJA 3ED1A 4LJ4A 5DK4A 1N4AA 4Q4HA 5HM6A 4ZOQI 1M2NA 3DFIA 3K0CA 2O8EA 1X94A 4WY5A 1P4SA 1ZGCA 4Y6GB 3EA5A 4WKGA 1JEQA 2EC5A 4WXRA 2F3UA 2NPOA 4RTMA 4KFUA 5DP1A 2O19A 2JI4A 3AO0B 2ZAIA 4YMUA 1KKMA 1MW8X 4BY9E 5C1OA 1PAUA 1XKLA 3ZLTA 3PQ7A 2G9RA 1YZKA 2P9BA 1X1DA 1ZM7A 1G8YA 4HUQB 1AQ6A 4MQMA 2J5RA 3KUUA 5MN5A 1T4MA 2BSQA 1L7AA 3EGXA 1JJVA 2QPOA 4ECAA 3SLRA 1SBCA 2CVQA 3DB2A 5JCOA 1P2BA 3IAAA 5TJ9A 1M9NA 3IALA 4C04A 4JHLA 1U2TA 1UC8A 2JASA 5LP6B 3QUAA 3GK3A 1BE8A 3HGTA 3HV2A 3ZX5A 5DNWA 4FEEA 3PQ6A 1VBMA 2AG6A 4CR8A 1FFWA 4U7WA 1PK8A 2HDWA 1E1CB 4R7TA 4UBKA 1LVHA 3OEHA 2XXAB 3E8SA 4LGVA 1D5CA 3G6WA 3LK6A 4C2AA 2ZRBA 4Z8XA 3CNNA 4HDRB 3UJDA 2QAGA 4EB6A 1GDHA 3WQSB 4RVDA 2JLAA 5JWRA 4ZHQB 2ZSDA 2WJAA 3STWA 2WF6A 4ACBA 4KOEC 4G56A 1ZCAA 3SBOA 3I01A 4Q6BA 4EZEA 3PIDA 3IJ5A 2W5UA 1WDWB 3AG5A 3KUCA 3LDHA 2JHGA 1U7DA 3FHLA 2H59A 4FYWA 3F7NA 3A06A 1L4YA 3QI7A 2LDBA 4ZVUA 4H1UA 2G1PA 1C9EA 3D8TA 3CQ9A 4YJHA 3C3EA 4UPVA 5GZ6A 3RV3A 4KKVA 3DZGA 3PPVA 3LZCA 4HH0A 1Y6GA 3LLSA 2FR0A 3IEPA 1Q14A 4LS3A 4PNPA 4IUYA 4GRIA 2H4ZA 3L4EA 5DSZA 1DGQA 3LQ2A 1N1GA 3EZFA 3SDZA 3UCXA 3ZV5A 3U56A 2VHTA 1G9SA 3HJUA 3I42A 5G4LA 1A2QA 3VC1A 1ZIOA 4MAMA 4NBRA 4NDZA 1MTOA 4UU0A 4XPIA 1A9SA 1ECJA 5AKKA 3DDZX 2BJWA 1ADJA 1RWXA 1PV4A 3LIPA 4R7ZA 2QL9A 1B8VA 4UMEA 5K0JA 1GFWA 4MW1A 2N42A 3GRVA 4ZWNA 5EIHA 4DPKA 5JZBA 3NC4A 3QG5A 5U4QA 1NF9A 1YJXA 1DFIA 1HORA 1ZRMA 2L0XA 1JS1X 3QJGA 4AJNA 3WMEA 1HZZC 4JBXA 4AX4A 4RXTA 3CZQA 4AS1A 2GNAA 2P5YA 1QFYA 3AX6A 3P2YA 1NX9A 4RGBA 2FZKA 2CK3A 1PT6A 2PZBA 4GO1A 3JV7A 2KW5A 1A9XA 1DUVG 1NR7A 2CD7A 2WJJA 4KE8A 2XXJA 3I92A 3DEAA 3VHLB 1WOMA 3OZRA 2O2ZA 1XD8A 4DKXA 5JSQA 5KDDA 2IS1A 1UBCA 3CF6R