1B8VA

Malate dehydrogenase from aquaspirillum arcticum
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
327
structure length
327
Chain Sequence
KTPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPVILQLLEIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPMTAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRNIKVLVVGNPANTNAYIAMKSAPSLPAKNFTAMLRLDHNRALSQIAAKTGKPVSSIEKLFVWGNHSPTMYADYRYAQIDGASVKDMINDDAWNRDTFLPTVGKRGAAIIDARGVSSAASAANAAIDHIHDWVLGTAGKWTTMGIPSDGSYGIPEGVIFGFPVTTENGEYKIVQGLSIDAFSQERINVTLNELLEEQNGVQHLLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cold adaptation. Sequence, biochemical properties, and crystal structure of malate dehydrogenase from a psychrophile Aquaspirillium arcticum.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords PROTEIN (MALATE DEHYDROGENASE)
total genus 110
structure length 327
sequence length 327
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1999-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b8vA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1b8vA02
2R00C 4JP3A 4CMGA 2JHGA 2GN8A 3DMYA 2W98A 2B69A 3PXXA 2X7HA 2HK9A 3D7LA 5FYDA 3FTNA 1TT5A 3U9LA 4F3YA 2GR9A 1M66A 4E0BA 1WLYA 5I7EA 4DREA 4CMKA 3BTVA 1NPTO 1KEUA 4HNGA 2GRAA 4EITA 1YBVA 2GASA 1P45A 1NAIA 1OOEA 2P2SA 2RH8A 1ZEJA 5HS6A 1A7AA 4QUKA 3BA1A 4W82A 4RQUA 4JCOA 1VRWA 1N2SA 3TFOA 1GR0A 4EZBA 4FS3A 3W4JA 3I83A 1HTBA 2D4AA 2QRLA 2PH3A 3WLEA 2NWQA 1MLDA 3RFVA 3KV3O 3VHRA 1WNTA 5EESA 2O2SA 5FF9A 5TX7A 3I6IA 1EUZA 4II2A 2OUIA 2YUTA 4OMUA 4JJFA 4E5YA 1AXEA 3NTRA 4EBFA 5L7WA 4OYRA 5I7SA 1DC6A 2NVBA 3EY4A 3TL2A 1I3NA 1E7MA 4RVHA 3G0OA 1JKIA 3RC7A 1NBOA 2HO5A 5FFFA 2FR8A 4BKRA 4AJ2A 4H16A 5A06A 3TWOA 4DWVA 4YB8A 5IN5A 4MKXA 4QXMA 3ZNOA 3NTQA 3MWEB 1LSUA 2V6BA 2Z5LA 3DBLB 3JV7A 3PJEA 1FDSA 3K5PA 2VWQA 1GD1O 1UR5A 3VKVA 4ZA2A 1LU9A 3VH3A 1I10A 3BHJA 2JFGA 1M75A 4B79A 1MG5A 4FC7A 3D64A 4FOOA 5JS6A 4LN1A 3DFZA 3T4EA 1DSSG 4FJ1A 4JXKA 2PV7A 3ZHXA 1GQ2A 3EAGA 4YXFA 3QWHA 4RQTA 3JYPA 5GY7A 4JBGA 1N7HA 2FHSA 1I3LA 4RZHA 3VZSA 1X14A 2DPHA 1Y81A 3H65A 1ZVMA 3I52A 1ISGA 4GI2A 1FDUA 5IXYA 2OL4A 3HJAA 1B7GO 4XRRA 1DC4A 4BNGA 1SZJG 3OJOA 1I36A 2IE0A 3GVHA 3AUAA 4CM8B 4PN3A 1KERA 3H2ZA 1MXFA 2X9NA 3KUXA 3JQAD 1GV1A 3AY7A 1UP4A 1SPXA 4ND4A 4NJMB 5IG2A 2I67A 3WGIA 1FMCA 3ZH2A 5TF4A 4OXNA 1I30A 2IYPA 4IQ0A 4KOAA 4ZQBA 2ZCVA 4ZVVA 2GZ2A 1NP3A 2HRBA 4CM9D 3CEAA 1Q0QA 2VYND 3JTMA 5I9MA 4BIIA 1E6UA 1RYEA 1YONA 1NPDA 2IYOA 1JTVA 2EP5A 4I9NA 2UYYA 4PG6A 4BNNA 4AJ4A 1ZUD1 3LLVA 3QVTA 4K1LA 3DZHA 1J4AA 3EDMA 3JQ6A 3QHAA 1GEEA 4PG8A 3DAFA 5K6AC 2JD0A 1XELA 3M2TA 3PQFA 4W6ZA 4UEJA 4P4GA 4DVJA 1X13A 4WCFA 3PZBA 4NPCA 4YJFB 5I8ZA 5A9RA 2ZYAA 2B5WA 2X9GA 3D4OA 1KVSA 3GEDA 2GZ3A 3ULKA 5L51A 1GUYA 3JYQA 2AG8A 2DUUA 4M49A 3PJFA 4OSOA 5KWEA 1ZK3A 2OORA 4N7RA 4OKIA 4BNWA 5ADHA 4DLAA 5BSHA 1UP6A 2Q1UA 1MC5A 2VHXA 1LA2A 3KEQA 4A10A 2E6UX 3H2SA 1P31A 2Y99A 3N74A 3H4VA 1O6ZA 4E31A 2O3QA 1DBVO 4F45A 1G0NA 3MOGA 3H9GA 3L77A 3WQSB 2YV3A 3PP8A 2O3JA 2Y66A 1G0OA 4U7WA 4DA9A 3GMDA 1E5LA 2VUTA 1YXMA 5CAEA 1PGPA 4G5HA 3LLSA 1E5QA 2Y1DA 4L4XA 2P68A 1LTHR 3DZFA 3RD5A 4CM7A 3ANMA 1AXGA 3VTFA 1KVTA 3I3OA 4BO0A 3INRA 1MV8A 4OXKA 2J6IA 4JNKA 4NBWA 2P9EA 3NDRA 4NU5A 4AJJA 5A3JA 2OFPA 4BMVA 5JSFA 1DLIA 2NQ8A 1BDMA 2Q2WA 4CQMB 3KTDA 4E32A 2DFDA 4NDNE 1K0UA 2C2XA 2IRWA 4YJDA 1DXYA 4TZKA 1DIRA 3OA2A 3VPFA 1Z75A 5L4LA 1VKNA 2J5QA 2NM0A 3ZWCA 5GZ1A 2VT3A 3GZ4A 1R15A 1IB6A 2CNBA 3AOGA 5DBFA 4Z6KA 4OOEA 4OAQA 1K5HA 2BI7A 4I5FA 1QYCA 4YCAA 1GYPA 4YTEA 1UP7A 2XPCA 1PS0A 3H5AA 3L4BA 4D45A 4BQRA 3DZBA 2I65A 3KM0A 4I1IA 4PZCA 4PG5A 4XB2A 4I08A 1PZGA 2BMAA 4BO8A 3ICCA 1PL8A 5G4KA 1LC0A 1NR1A 4GKBA 5KOIA 4J9VA 2VHZA 4NI5A 2ZTUA 4O1MA 2J3IA 2C29D 4K6CA 3RC1A 3ETDA 2WWRA 3HDJA 3IJRA 4P38A 2PWZA 1N5DA 1KC3A 4G81A 3RQSA 3VVCA 1R6DA 3WLFA 3C24A 3NKLA 1JQBA 4MP8A 3KOUA 3CSDA 4FPXA 4MP6A 3OBBA 4CL8A 4NR0A 4CLOB 4JK3A 2PLAA 4MIEA 2OMEA 2HK7A 3QY9A 4ND5A 2PGJA 1EVYA 3JQ8B 3BMCA 3UCEA 4ALKA 4OHUA 1I32A 4WGGA 5C3MA 1BWSA 2UAGA 1FK8A 4WLVA 3C1AA 4OOFA 1Q7CA 4CLRB 4RO0A 1OFGA 1X1TA 4YRBA 2G5CA 4UULA 2R6JA 1X15A 3DQPA 3PYMA 4BKUA 1NAHA 3QVWA 3KSZO 4TWRA 2JAPA 1DFGA 3GZNB 4J43A 4CMEC 3AWDA 3IKVA 3ROPA 1TLTA 2J3HA 5EPOA 3PWKA 3O4RA 3L4SO 4L75A 1LDMA 3WB9A 4NBRA 2CD9A 2PKQO 4URFA 3ZI0A 4P8RA 1UAYA 2BELA 4CLEA 5U1PA 1RYDA 3W8FA 2JAHA 1ISFA 2C7VA 5JO9A 1IYZA 1PS8A 1UXGA 4B4UA 3CKYA 2BH9A 2J3KA 3KO8A 4B4VA 1EVIA 2DC1A 1DIAA 5H83A 4PLWA 3QW2A 5B12A 1LLCA 1I3KA 1W73A 3H5NA 2JFHA 2E49A 1HE3A 1BSVA 3E9MA 1LDBA 1DAOA 2VZ0A 2YDYA 1B0AA 1CYDA 1PJ3A 4U5QA 3NGXA 3D4PA 3OQ6A 3WGHA 4HY3A 3ZU5A 3AFNA 2CDCA 3U49A 1ENYA 1UDCA 1HLDA 2BGKA 2PZMA 3ZHBA 3TDKA 1SOWA 4BNLA 4ND1A 4IJKA 1FF9A 1XCBA 2Q4EA 1YGYA 5JY1A 1S6YA 2ZTMA 1J6UA 4BNTA 2AEJA 1YBMA 1BXKA 2VTDA 2JL1A 3V8BA 1EVJA 1YQDA 3NDIA 3ABIA 2PNFA 2X5JO 4K9DA 1HDRA 4C4OA 3LYLA 1EMDA 5K9ZA 3GR6A 4Z9XA 5T64A 3NAQA 1QORA 3NJ4A 5TQVA 5KKCA 4HX5A 1KETA 4XDYA 1T4DA 5CP8A 2Q49A 4CLXA 3HUDA 3NT5A 2YJZA 4MOWA 3SEFA 1WDMA 1H6AA 4FDAA 4XB1A 4DMMA 3PDUA 3I9NA 4WUVA 4AVYA 1GZ4A 1MUUA 4BNKA 2X5KO 3HHPA 4IMRA 3LF1A 1ARZA 1R66A 3Q9UA 3FRJA 3Q2IA 2DFVA 4IQ8A 1PZFA 4IXWA 5KVQA 3JYNA 4Q39A 4R51A 4Z0TA 1NNUA 4R1TA 2NSDA 4CQLA 3F5SA 3INGA 1ONPA 5LC1A 1GFSA 4BKOA 3Q0EA 1PL7A 3EYWA 4DQVA 4QT0A 1D3AA 4JROA 3LC7O 4JIGA 4II3A 2Y0EA 4N18A 3TZQA 2Q99A 3IKTA 3H8VA 5A5EA 1Y5MA 2JHFA 5JDCA 4N5LA 4ZJUA 2VRCD 3FWNA 3OIGA 3GVPA 3B1KA 3JQ8A 4O0LA 3F4BA 1C0KA 4B7CA 4OO3A 3S2EA 2BGLA 2VN8A 5A5FA 1CF2O 1IL0A 2I6TA 5G2OA 2V6FA 2FY8A 3OEWA 3R6DA 3P7MA 2FPPA 1BDBA 1R0KA 4XX0A 1E3WB 4BGEA 1WWKA 3F1LA 3JSAA 4LISA 4TZTA 1QXSA 2GN4A 2I3GA 3GDGA 4U0KA 3GG9A 3GZNA 3IS3A 1SNYA 3DZGA 2ZJ0A 3R3SA 4D0RA 1AGNA 1NVMB 4A2CA 1LXCA 5ICMA 3RUAA 1ENZA 4W9NC 3HNPA 1T1SA 3RUHA 3WX0A 3GC6A 2BFOA 5IDWA 3OA0A 3VC7A 3ZZNA 5L45A 3AI2A 3I9MA 5HA5A 5JYDA 1LJ8A 4F6LA 4ZQGA 1QLJA 1KOLA 1E3JA 3HFSA 4DYVA 4QO7A 2FP4A 4WK6A 1ISJA 4RPKA 1J0XO 4E5KA 4O6VA 3IDSA 1U3TA 3COSA 1HF3A 3U4DA 1NQ5A 3F1KA 4DLBA 2FPIA 2VUSA 3JYOA 5ILGA 5C7OO 4DLLA 4I8XA 4J90A 3S2IA 4OKNA 1LDGA 5AXAA 1H94A 1SBYA 2AA3A 2BKAA 2O23A 1B2LA 2ZTLA 3QWFA 4XYEA 4MVJF 1E1MA 1TVEA 2HMSA 2NU6A 1QG6A 4Q3BA 1MFPA 4MP3A 4OGWA 3AM4A 2W2KB 1NQTA 5F21A 4FFLA 2Z95A 3GOHA 4L73A 4M89A 4YAEA 5CDSA 3UHAA 4XJSA 1TXGA 2AQIA 3KYDB 4GMGA 4DRYA 1W4ZA 3QVXA 4K6FA 5ES3A 3FHLA 3CH6A 5EERA 3WQRA 3ZWVA 1B8PA 1R16A 5EIOA 2EEZA 4A5OA 3KRTA 1D4FA 1YB4A 1MXHA 1UZLA 1DOHA 3E6AA 3OQBA 4HFJA 1EEHA 1VL8A 3OEYA 2HMTA 4YJGA 1N1GA 3O8QA 1CIVA 4M8SA 2NU9A 4RL6A 2ZJ1A 4R5HA 3TOXA 4W4TA 5BNIA 4D3FA 4R3WA 4CV1A 1R0SA 1YH3A 3LDHA 4DMLA 4YR9A 5JCJA 3DOJA 4PLZA 3VDRA 1GDHA 4WLUA 1EVZA 3WNVA 2VOJA 4IY1A 4PG4A 1ADBA 4RLHA 3V2UA 5L9AA 3ASVA 4HBGA 4OSPA 4EUEA 2WYUA 3A4VA 3MJCA 5BSFA 1XQ1A 3PHIA 4CM4B 4UVHA 1KEWA 5A9TA 1U1IA 2GLXA 3BAZA 3ZV6A 1RJWA 3JD2A 3K9QO 5BNTA 2PZLA 7ADHA 3IOYA 3HG7A 4JBIA 5F5NA 3I4CA 3JQBC 3OHSX 4OXYA 1RM0A 4XEHA 2J3JA 3GUYA 1F12A 3BXXA 3GEMA 1JWBB 2A92A 2EGGA 1CERA 5DZSA 4E2WA 4BO1A 5L7YA 4ZRMA 3KBOA 3WQQA 1SEVA 1DIBA 3G1TA 5IDXA 2W8ZA 1EK5A 2X8LA 1J5PA 1W8DA 2P4HX 5LDHA 2YHIA 3ONDA 1E1KA 3WDSA 5AQ1A 3QV1A 5A03A 4G2NA 1P77A 4XR4A 1DIHA 4M1QA 4CR7A 1XYGA 5CEFA 2YFHA 4HFMA 5G0SA 3LZ6A 3DBVO 3N58A 3AI3A 1GV0A 1UXIA 3PDJA 4L9RA 4GX0A 4BO6A 3ROKA 3L4BC 2B4TO 1VE9A 3PI7A 5CDYA 3GFGA 2BFMA 3KYBA 4CQLB 5KJ6A 3P19A 1GUZA 3KSDO 2EKPA 3ZCXA 1Q2XA 3RKUA 1HKUA 1ZW1A 4O63O 4NH4A 5DDIP 3ZWNA 1EBUA 3OJFA 3PK0A 2CFCA 4TVOA 3S2FA 2POQX 4K26A 1GCUA 1ENOA 4E5MA 2VHVA 3TL3A 4IXTA 1YWGO 1V3UA 4ESOA 3AJRA 1ZIDA 2G1UA 1YQXA 1LI4A 2O3UA 3FPCA 1CDOA 4BGIA 5CG2A 3S8MA 2O3RA 2CVQA 4YT8A 2QIOA 3B70A 3HSKA 1A72A 3QSGA 4DC1A 5TS3A 2AEFA 1OI7A 2DAPA 4UUOA 3D4NA 2HKIA 1T2EA 1YB1A 1YL6A 2IEBA 1QV7A 1LRLA 2EJVA 4U6SA 1HDOA 4Q3DA 4YAJA 5EQDA 2VCYA 4RF5A 3E82A 4NJMA 4YEDA 3NT2A 3ZV4A 4BNXA 1C0IA 4NJOA 3TZHA 5JCJD 3TSCA 4NMHA 3EC7A 4J4TA 2WYVA 3QLJA 1QYXA 4UVDA 1DRUA 2TMDA 4M54A 4HUJA 3TNLA 3ZWMA 1F06A 1U3VA 3ITDA 2QW8A 3T7EA 3O03A 4RVSA 2QYTA 4IDFA 3JQ9A 4BB6A 5L7TA 1CEQA 2ZK7A 4FB5A 2ZB3A 4LW8A 1UDBA 1QMGA 1L1FA 3UGKA 1UXHA 4XYBA 4CL3A 3IUSA 4GGPA 1VPDA 2JCXA 3SXPA 5FEUA 1NVTA 4RJTA 1IY8A 2HU2A 4P4NA 3ST7A 3WGGA 2WEKA 3RVDA 5BQFA 3LT0A 3GUCA 4WNIA 3K30A 2CDAA 2GNAA 2DBZA 3PWZA 1Q1NA 4FBGA 4MVJG 5KVVA 5JDIA 3ZWBA 3DZIA 3C7CB 4MIOA 2DPGA 4PRLA 3SLGA 3VDQA 4EEZA 3IP3A 3V1YA 3DHYA 4ONEA 4IZIA 2H6EA 3L6OO 3CMCO 1RKXA 4JGBA 4N5MA 2QRKA 3F5QA 3WICA 3WFJA 3BYZA 4AJKA 4E6PA 3DFUA 1VC2A 5JNLA 4BO2A 1AE1A 1YJQA 3M2PA 1P1IA 5IXSA 1XU7A 4GL4A 1PL6A 4XGNA 2IODA 1H2HA 4GH5A 5ENVA 5BT9A 1XQ6A 1D1SA 2GO1A 4EJMA 3BMQA 4PCVA 2PZJA 2IZ1A 3BMNB 1OMOA 4E4YA 5JO0A 3UF0A 3MJEA 3IUPA 1MGOA 3MJ4A 1NYTA 1QLHA 1BVUA 3R0IA 1ZBQA 1L7EA 1LC3A 2Q3EA 1XHLA 2FMUA 2EXXA 1OZAA 3U62A 1DC5A 5JBIA 2F00A 4AG3A 2EGHA 5IF3A 1O9BA 1R37A 2Q50A 4RF3A 3F6YA 4DQXA 4IDGA 4FN4A 3FNEA 4NBVA 4E2XA 3RIHA 1LRJA 3DOOA 4EJ0A 2X86A 1D1TA 2FSVA 1LBEA 3FBGA 2DQ4A 4GBJA 4D0SA 2DM6A 3B6ZA 3WWZA 3EMKA 1M6WA 4JN6B 1RM4A 3MJTA 2PA3A 4XGIA 1E3EA 3FR8A 3QQPA 1IZ9A 3Q11A 3H9JA 1HRDA 3KYCA 3SBOA 4DIFA 4AFNA 4Z3KA 3GA0A 4WEOA 4UAGA 4BB5A 2WYWA 4FGWA 4PZEA 2B35A 3GQVA 4M55A 3MEQA 4I9HA 1R4NA 2E37A 5TGDA 1ENPA 5JAMA 1HSZA 1GL3A 1U4OA 3KYCB 1XLTA 3WSVA 2VWPA 4J91A 4ZRNA 4EDFA 3TJRA 4GAEA 1ZEMA 1BHSA 2DBRA 1XG5A 3JQBA 3W6UA 1DDOA 1DJQA 1H6BA 1HDXA 1PJCA 2PK3A 2CF6A 3IIEA 4Q3CA 4RPGA 5JAQA 1PWZA 3FCOA 5I8WA 4BKPA 4YT2A 5A9SA 5L40A 3HB5X 3W6ZA 4ALIA 4L4RA 4QQRA 4WASA 1DO8A 2HMWA 5BR7A 4ZICA 5A02A 1ZH8A 1P33A 1D8AA 2O4UX 1Y7TA 2QRJA 3ZU4A 4EI2A 1CQIA 1DRVA 3LT1A 1I0ZA 3BMOA 4XQEA 2IXAA 4B7UA 2ZQYA 2Y93A 4GKVA 4D7AA 4CV2A 4DQUA 4E21A 3GMSA 4FFRA 2C5EA 5AXBA 1EBFA 3DHNA 2NU7A 1HDCA 2LDXA 1BW9B 3W1VA 2B4RO 3K8ZA 2H9IA 4KTTE 4BL5A 3UW3A 2BF7A 4OJNA 3AK4A 5A04A 4MVJI 3ONEA 2ZYGA 1I01A 2VZ9A 4U8GA 3ENKA 3C85A 4DGSA 4IMPA 2GD1O 4RPLA 1YBAA 2VHYA 5DNAA 4CLRA 1H6CA 5TIIA 1Y8RB 1X0XA 3VZQA 1ZKMA 1XDWA 3ZGYA 4CMHA 1W0CA 4MKRA 4QFCA 4XZ3A 1BVRA 1RM5A 4RZIA 4QTZA 3F3SA 3GPDG 4R9SA 4CM8A 4Z0HO 4I5EA 1JA9A 3V1TC 3RBZA 4CM6A 4C7KA 5KCZA 3DBHB 1D7OA 3GRKA 2NTJA 1BRMA 3MWDB 3AY6A 3NTOA 3RBVA 2XAAA 4XRGA 1SCUA 1HXHA 3H5RA 4YAKA 1C1XB 3ROMA 5TRTA 3RFTA 4LCEA 5DCYA 3PYLA 3ZHZA 1K3TA 3HQ4O 4BNVA 1BTOA 5IDQA 1EZ4A 3MOIA 3N7UA 2PKRA 1H5QA 1PU2A 1NXQA 2X6TA 1WXDA 1BMDA 3NX4A 3L6EA 3O8QB 3AFMA 3JQGB 2EKQA 3WIEA 1YE3A 3PJDA 2Q2QA 1HSOA 4E33A 5KJCA 2GN9A 4PG7A 4CM1A 4RDIA 3AM5A 2R00A 1Z6ZA 3QP9A 4J0EA 5FWNA 4JX8A 4CR6A 4RLSA 2A35A 1CETA 4QEDA 1YQGA 3U4HA 3B20A 4J49A 3JQGA 4RDHA 1QYVA 2D0IA 4ZU3A 4CPDA 5MDHA 3LF2A 3LT2A 1GU7A 3CIFA 4Q3NA 4WPGA 1Y5RA 4E12A 1YKFA 3WGOA 2IEDA 3JD1A 3GPIA 1Z82A 3GVCA 3K96A 4L4SA 1LLDA 4YJGB 5FI5A 4CMBA 3GDOA 5B37A 4IS2A 3H3FA 1U8XX 3I5MA 1KY4A 4GSLA 4R69A 1Y9AA 1B16A 4IDDA 5KTKA 2E82A 2FR0A 1P1RA 3GK3A 2CZCA 1NVGA 3RSHA 1E0DA 4IDAA 4AJEA 2Y0CA 1ADGA 3DMTC 3G1UA 3WFIA 3ZWYA 5JDCC 2HJRA 2ZB4A 4MIYA 3WMXA 1EFKA 2V6GA 3C3XA 3R3JA 3I9JA 4Z9FA 3BTOA 4FC6A 4D41A 2GN6A 1VM6A 1E7RA 3C7AA 5CHEA 2PD3A 4TROA 2AEMA 4NIMA 3W8EA 3P5SA 3RUDA 3PFFA 2HUNA 2Q2VA 1XSEA 2JD1A 2WSBA 3OH8A 5JLAA 5K6AA 1Y9EA 1X1EA 3M6IA 4BNJA 4BVAA 1O5IA 2WE8A 1N7GA 3DTTA 4TVBA 2BD0A 4WJZA 2ILTA 3AOEC 4RVDA 2WDZA 2CMDA 4PLYA 2AE1A 3D3WB 6LDHA 4I5DA 4NBTA 1P1FA 3X2FA 4E5PA 1MX3A 3R1IA 3MTGA 1HL3A 3OF2A 2FZEA 1HE4A 1HLPA 1F17A 3NRCA 3QIVA 2HK8A 3WSWA 4ID9A 2WD7B 4J4HA 3D3EA 4IJUA 5K0ZA 2AW5A 1HZZA 4R1UA 3AY3A 3G3EA 1AHIA 1XR3A 1PQPA 1E1LA 3RCBA 2Z1MA 3OJLA 3H9UA 3LU1A 1A9YA 1SO8A 4GX1A 3OQ1A 1E6EA 1H93A 4WE3A 1VJ1A 1KY5A 3G17A 3EGOA 2CF5A 4CODB 1IOLA 2I3AA 4ALLA 3BMCB 2OZPA 4LVUA 5HS4A 4BOYA 2QHXA 4YWJA 1DPGA 2FRDA 1GZ3A 3ZWPA 1NFQA 1BW9A 3PEFA 4QSMA 5CEEA 1ZK1A 5T6BA 3IP1A 4RF2A 2OBNA 3PHHA 3ZN2A 4ALMA 3BZUA 1PX0A 4IIUA 3OECA 4N54A 3OMLA 3GGPA 3A06A 4NQZA 3K73O 3MTJA 1FDTA 2VYVD 1V3VA 4FCCA 2AG5A 4DUPA 1LUAA 4QECA 3ITKA 1BGVA 2G76A 3BMOB 2I9PA 3LQFA 1U9JA 1PGOA 3E1KA 4MVJD 4WKGA 3ZV3A 1JN0A 1IUKA 3NDJA 1DEHA 4KZPA 1GUFA 1N9GB 3D5TA 3DR3A 3DTYA 3ENNA 3RUCA 3VPXA 1ZO8A 1YOVA 4Y6SA 1AHHA 1WW8A 1LX6A 3NT4A 1R12A 4D3SA 1YRLA 1Q0HA 4E3ZA 5JPIA 3ZU3A 1ZSVA 3KB6A 2YY7A 1R4MA 4ZHSA 3TZCA 2DVMA 3EZLA 3VH1A 5KJEA 1HDYA 3CXRA 1PZHA 5JW6A 1P1HA 3DB2A 3SX2A 5DP2A 4GVLA 3VOSA 1KS9A 4XJTA 3WGYA 1E7SA 3KYDA 2ZKLA 3VTZA 2NV6A 1WZEA 4TRNA 3CE6A 4QFDA 2Y0DA 4UVGA 1UZNA 4RGBA 1A5ZA 2P91A 4HFRA 3PQDA 1MC4A 5AVOA 2AQHA 2HSDA 2VYNA 2HDHA 1B14A 4D42A 4KQXA 2B36A 2DBVO 4L74A 3UICA 4E30A 3U09A 1YL5A 4B3JA 5DN9A 4XGKA 3WOHA 4J3FA 5G4LA 2IZ0A 4XA8A 5DOVA 4HKTA 3UN1A 2V65A 4M86A 2HMVA 1U2GA 1U2DA 2OXIA 5DCUA 3E18A 3EK2A 4D79A 4TKMA 1RM3A 3QVOA 1Y1PA 1A4UA 5EMHA 2DKNA 5ILOA 2YZ7A 4PLGA 3INTA 3JD4A 3GN2A 5IZCC 3O26A 3PGXA 4X54A 4BV8A 3OP4A 3L0DA 4RPJA 3U4CA 1U7HA 1T2DA 2YW9A 3PJGA 3IL2A 4Z3DA 2AHRA 4GGOA 5CG1A 3ADPA 4B8ZA 1OAAA 4L0QA 2BLLA 1QSGA 3PIIA 3PRJA 2O2YA 2EF1A 4WCFB 3Q1LA 3PWSA 1JKFA 3GAFA 3RJ5A 2BFAA 3AW9A 2YYYA 5H81A 5IJZA 2D5CA 3K92A 4BNMA 1TI7A 4KUGA 1CRWG 1OC4A 1QRRA 4LK3A 4XQCA 4MVJM 2RHCA 3HN7A 2QYSA 3Q6IA 4AJPA 3VAZA 1FJHA 3KLPX 4BGVA 3Q9NA 3FNFA 1U5CA 3RWBA 4WLFA 4DPLA 1PGJA 4BO9A 5ITWA 1ZJZA 5IZCA 1N92A 4D44A 1CWUA 3NYWA 3ASUA 1JAYA 2O4CA 4WCDA 4PVCA 1I2BA 1Q7GA 2C07A 2VT2A 4PLVA 2NUAA 4CM3A 2I5PO 4E2ZA 3ZWAA 3RKRA 3TOZA 2HAEA 1ZNQO 1A9ZA 2X0IA 3A14A 4YQYA 1ULSA 3P2YA 4W9NA 2W4QA 3PQEA 1F14A 1VKOA 3ETEA 1WDKA 4B3HA 1NWCA 1Q0LA 3A28A 1BXGA 5DBGA 2H1SA 4BGUA 5THKA 1LSJA 2CSUA 1PQUA 2V7PA 3PFWO 2X23A 4AJOA 2NADA 3X2EA 4YVFA 5LCXA 3ZHYA 1O8CA 3WJAA 3KVOA 1MFZA 2QZ9A 1GAEO 4YT4A 4YJHB 1FDWA 1E3LA 1EE2A 3O38A 2DBQA 4ITUA 1LLUA 2FPGA 2J5KA 1WZIA 4TKLA 1PEDA 1T4BA 2CUKA 3CZMA 4WOJA 5TT0A 4R3NA 4J6FA 2VUUA 3L6DA 3MJVA 1I5RA 1G1AA 3DXFA 4R9RA 1YJ8A 3JQFA 1KEPA 4MVJH 3GDFA 5ER6A 3DBLA 5DCWA 2EWMA 3HDYA 4P22A 3I9KA 1N8KA 9LDBA 1K6IA 3QVSA 1EE9A 3FNGA 4CLOA 4WLEA 4CJXA 1UDAA 1EQ2A 3DO5A 5AXDA 1P1KA 2GSDA 4Y6RA 3ZNQA 4MDHA 5ENDA 4GQAA 2IXBA 1E77A 4XWYA 3FBTA 3U3XA 1LQTA 1PJ2A 3CZRA 3G79A 4IS3A 2PKQP 2VHWA 3EUWA 2LDBA 3FN4A 3I9OA 4PLFA 2C54A 5G0TA 5T8KC 4KUHA 3VPHA 4J7XA 2O50A 3I23A 1M76A 3QA9A 2C59A 3PTZA 4B4WA 5I7VA 1R4MB 1T2CA 1CQJA 3KETA 1CJCA 4A7PA 4XD2A 5G0VA 1V8BA 3W4KA 1DB3A 2W2LD 3D5QA 3WJ7A 5A4DA 5KNLA 4IJWA 3GHYA 3GLQA 3H9QA 5TLSA 1PJQA 2G82A 4TRMA 1EUDA 1LDYA 1E7WA 4WNCA 4XQ9A 2OP0A 2VQ3A 4RPHA 2ZTVA 4AJHA 1SB9A 3HE3A 4DBZA 2RBEA 2IZZA 4UUPA 2VTEA 1FDVA 2PD6A 3ICPA 5B4UA 2JD2A 1XGKA 2YQ5A 2YDXA 5HRUA 2DT5A 4H15A 2O48X 1HYHA 1QR6A 3RUEA 4BKQA 4KMSA 1DFIA 1H0KA 4BNIA 1DC3A 2ZYDA 3WNQA 3GY0A 4EUFA 5DOZA 1KVUA 3DC2A 2VRBA 3OICA 1XU9A 3PPIA 3UH1A 2Y1GA 4BMSA 1IHYA 2AQKA 4DC0A 4BS9A 2PY6A 4N5NA 1ZJYA 1T26A 4BO3A 1E6WA 3PZRA 3AOEA 4EW6A 4IIVA 4PLHA 5TNXA 2JJYA 2RIRA 4IGEA 1UAGA 3RU7A 2ZIZA 3D3WA 3FWZA 1XA0A 4IGFA 1V35A 3BTSA 1YL7A 4L76A 4GPD1 1B15A 2B0JA 3UAGA 3B1JA 3PYXA 3L07A 1LEHA 5F1KA 3E8XA 1EDOA 4LMPA 1NFFA 1ZSYA 5GZ6A 4EUHA 4RVGA 1Z73A 3DONA 3Q3CA 4CUJA 1U3UA 5IZ4A 2VRCA 2YV1A 3FNHA 4FQ8A 4H7PA 2EG9A 2D2IA 1Y6JA 2FZWA 1X7HA 1ZMTA 3E5MA 2DU8A 3KLMX 4IQGA 2NU8A 3I6QA 1GY8A 2EP7A 4DIOA 4CMCA 3EVTA 3WWYA 1T2FA 3ZWOA 3KHUA 4J1NA 2C5AA 2OOSA 4D3DA 4DTIA 2YFQA 1UXKA 4FFPA 3JQ7B 4DBVO 1T25A 4A03A 4DYDA 1O0SA 1C3VA 3VZPA 4CQMA 3DEYX 3PHLA 1U4SA 2P5YA 4BNYA 5T57A 1WAMA 2PFGA 1HEUA 3JQ7A 5IN4A 2NACA 2TMGA 1I8TA 7MDHA 2R2GA 4RVUA 2NTVA 1Z7BA 4PLPA 4AL4A 4JJGA 1A27A 1EDZA 3FPLA 2P9CA 1IPFA 2OBYA 3UKOA 4EJ6A 2SCUA 1P9LA 3DMTA 1X7GA 4YRAA 2BGMA 2OP1A 1ZFNA 4BUCA 4BNUA 2CVZA 1V0JA 1NWHA 4HP8A 2AQ8A 2C0CA 2EKLA 4GX2A 4UEKA 1B3BA 4YAIA 4UVEA 1UZMA 2ZCUA 5BNFA 1TT7A 4CUZA 1F8FA 5KVSA 3QRWA 4ZGWA 1P1JA 1UJMA 3UVEA 3FTPA 4UUMA 4WOKA 3VVBA 8LDHA 4D46A 1U7TA 4NNJA 1GQQA 4XYMA 9LDTA 2Q1WA 3GVXA 1ZSNA 3DZKA 4Q3AA 2H63A 1ONNA 2NTNA 5G0UA 4NU6A 2OO5A 3OJ0A 4RVFA 3WTBA 2EV9A 5JMPA 3HDQA 2W90A 4HWKA 1IULA 5JXWA 4BV9A 2FWMX 4LVCA 1YDEA 3D1LA 5BSEA 1MA0A 3S2GA 2A9FA 4FIZA 1X0VA 1Z45A 3AUUA 4J2OA 5CDTA 5DF1A 1N9GA 3DDNA 1JU9A 5JDIC 3AU9A 3V2HA 1M67A 4A26A 1EK6A 4I9UA 1NHWA 3PLRA 3TF5A 3PHJA 4DIBA 5C7IO 2X4GA 3K2EA 1QYDA 3V5NA 4IDCA 4MJLA 5COBA 3AI1A 5MGBA 4CLHA 4PZDA 3ZW8A 2D1YA 2YV2A 3QWBA 1HE2A 1PIWA 1KVQA 4KUEA 4R4JA 1HDGO 1A7KA 2EW8A 2ZB8A 2AE2A 4Y8VA 4FFOA 3UXYA 2PGLA 4CMAA 4IM7A 4LSMA 5EL0A 3VPGA 4Y98A 3BTUA 3G49A 1WVGA 1PJBA 3ZNNA 4NHEA 5KIAA 4HXYA 3SJ7A 3U5TA 3E9QA 4GSKA 5TJ9A 1H9BA 1LDEA 2G0TA 3DBRB 4UREA 3TQHA 1P74A 3LC2O 1K6JA 4R01A 5DP1A 4TMFA 3P2OA 3BMNA 1V9LA 3ONFA 1I24A 4YAGA 3PLNA 2D59A 2PR2A 1NR7A 3OM9A 1ISIA 4J2HA 4OL9A 2PH5A 3LSYA 1LNQA 5JE8A 2Q1TA 1E92A 4Y9DA 1ID1A 4J9UE 4FW8A 3ZWXA 3ZV5A 5JYEA 1V3TA 1IHXA 1DHRA 1B26A 4FJ0A 2YHIB 4B7XA 2EIHA 4NFSA 5DT9A 5C7LO 1PGQA 2Y05A 4P4LA 4ZQFA 2P9GA 3TFQA 1GPJA 2IDZA 4LCJA 1UH5A 4R1SA 3UCXA 2P4QA 3BMQB 4KWIA 4U0JA 3QWIA 4FSHA 5L53A 3OFSA 1DAPA 2Y68A 1DJNA 3OJEA 4G65A 1T1RA 1P0FA 2X0NA 5C5IA 5KJFA 3H6KA 3KEOA 5AYVA 2WM3A 1KBZA 5EQFA 2UUPA 3TPCA 2B83A 1PJLA 2O3SA 4ZQHA 2GCGA 4JJIA 1GPDG 1GQYA 2J8ZA 5CEJA 1GZ6A 1A71A 4YBZA 4Y6PA 4WEQA 4GWGA 1KEVA 1QKIA 1HE5A 2GYYA 2X22A 3ZNPA 4KTVE 2OHXA 5B4TA 5JCXA 2EW2A 4QO8A 2BFPA 1HETA 3HFGA 1SEPA 4LMRA 4HADA 3CTMA 1IE3A 1DIGA 5L4SA 4PFJA 5G4KB 4CM9A 4Y67A 4WCFC 5H82A 4L8VA 3WTCA 5ER9A 3F47A 3FSRA 1P0CA 3GGGA 4IDEA 5I7FA 5CFZA 1HYGA 4XQGA 4AJIA 3DAGA 4CMIA 1E7YA 4R1NA 1BXZA 3A9WA 1T2AA 5JAIA 2A94A 3T4XA 3CUKA 4W99A 4XYLA 1Y8RA 2GGSA 3E9NA 3GNSA 3MJSA 4GX5A 3NV9A 4ZN6A 5C37A 1NHGA 3W8DA 1PJSA 1G6KA 1PS9A 2Q46A 5HWSA 3A1NA 5IFLA 1P3DA 5T8KA 4NG5A 2I99A 3ON5A 1T24A 3SC6A 3UUWA 5A9SB 5T67A 2QQ5A 2GERA 2RH4A 4MVJP 2AMFA 3O9ZA 4CV3A 4EYEA 4A27A 2QX7A 5KKAA 4DXHA 2O7QA 1C14A 5L3ZA 3KXDA 1E7QA 3JQ9C 3VH2A 1MG0A 3E5RA 3M1AA 2PGDA 3U4IA 4YACA 3NUGA 4E2YA 2C82A 1S7CA 4LRSB 3I4FA 2Q4BA 4IUYA 4D43A 2RCYA 3H9EO 3DZJA 2FN7A 1TA4A 1PJ4A 1IPEA 1AUPA 4NZ9A 2VNAA 5EJ2A 2QG4A 3TN7A 3UCFA 3OIFA 2XOXA 4LGVA 1I33A 4B8WA 1ZXBA 1ADFA 3SC4A 2NVUB 2E4AA 1PR3A 4PIVA 5COQA 2X0JA 3EVNA 2HJSA 1H2BA 5CPBA 1GYQA 1ISMA 3QE3A 5EN4A 3VKUA 5CPFA 1WDLA 1HYEA 3AUTA 4BNHA 5I9LA 3ETGA 4IBOA 3DHEA 5A3VA 4CR8A 4RCVA 3WMWA 5J23A 4J0FA 3JQCA 4TSKA 3STHA 1GYRA 5F1PA 1TT5B 4J1SA 1N1EA 4B4OA 2E48A 1KC1A 1PGNA 4HFNA 6ADHA 5TT1A 5F5LA 2D3TA 1KVRA 2VNSA 3ZW9A 1UUFA 5TJHA 1YB5A 1Y8QB 5DULA 2UDPA 4S3MA 3T7CA 3VH4A 4JBHA 3GT0A 1EFLA 4PLCA 2Q1SA 2DTDA 3LK7A 5DBIA 4BO5A 3FI9A 4EGFA 1J49A 2UVDA 2CVOA 4BMNA 3SJUA 3JQDA 1LLQA 1C0PA 4H3VA 4XR9A 5COAA 1PZEA 4CV0A 3RROA 3WGQA 3Q2KA 3HWRA 4DPKA 1PSDA 1XEAA 4FGSA 4CMJA 1I2CA 5LDGA 1SMKA 4M87A 2HQ1A 2JFFA 3BHIA 3WBBA 4ALNA 2XXBA 4WLNA 1ZK0A 3VPSA 3QWAA 3V2GA 4ND2A 1R0LA 3EHEA 5JAZA 4NFYA 3WGZA 4OM8A 3NJ8A 2HMUA 2VYVA 2W2LA 4GVXA 2NQTA 3TZKA 3GNTA 2HRZA 3HB4X 1U5AA 4CQMD 1O94A 3K31A 4TRRA 1ULUA 4MPDA 1F8GA 3RU9A 4R16A 2WD8A 4KDFA 4NK5A 2FSSA 2CY0A 4CMEA 5TC4A 4YJHA 2QZZA 3JQEA 3KSUA 1Q7BA 2O7SA 2RHRA 3HADA 4F6CA 1VSVA 3RUFA 4F46A 4O59O 2WJPA 5JC1A 1RWBA 2BRUA 1YDWA 4BHTA 4INAA 3RJ9A 1TEHA 4J1QA 1C1DA 3GHHA 1K6XA 1GEGA 1C0LA 3CPSA 1LSOA 4BO7A 4YQZA 2JCVA 2J5RA 3E48A 1PR9A 2C20A 3B1FA 5AOVA 1KYQA 3RUIA 4R41A 1F0YA 2DTEA 4E13A 5IAAA 1OC2A 4XCVA 4CMIB 1I2ZA 1HZJA 3SLKA 5U9CA 4NBUA 3S55A 2A4KA 1DRWA 3GNQA 3WR5A 3AM3A 5L4NA 1GCOA 3F46A 5ITVA 1O89A 3JD3A 1IZ0A 1JAXA 4C7JA 1QV6A 1W6UA 1OBFO 3JQAB 4KQWA 4RORA 4BNZA 1V6AA 2I76A 1JLLA 3RC2A 2NLOA 3PGJA 3ROQA 4XDZA 1ADCA 2Y67A 2I66A 4XYGA 3DWFA 3LT4A 1XWFA 1GTMA 1ZCJA 3FF4A 3WXBA 1ML3A 2D5AA 3AUSA 3JQAA 3WIDA 3HN2A 1U8FO 1LSSA 1ZK4A 4J4BA 3IQDB 2C7GA 2WMDA 3WBFA 3DL2A 4U6QA 3C7DB 4OQYA 1ISHA 1JVBA 2VWGA 2Q45A 3U0BA 4KP7A 4BO4A 1LDNA 3F9IA 4PLTA 4E5NA 1B8VA 2F1KA 4NFHA 1UXJA 2FOIA 3NGLA 1TB4A 4ILKA 4PGFA 2NNLD 4HNHA 4YJFA 3WYEA 1BG6A 1H9AA 2GZ1A 1NTOA 1WP4A 4IPTA 4AJ1A 2Z1NA 5B1YA 2Y1OA 4YPOA 2OGUA 3GEGA 4UUNA 1B8UA 3RFXA 5I9NA 2VWHA 3JD0A 4AJLA 3IC5A 4IDBA 2EHDA 4K28A 4YT5A 1KIFA 1HWYA 5FI3A 1A4IA 4DPMA 1WMBA 4YRDA 2V6MA 2D8AA 4Q3EA 5CDGA 4PVDA 1M6HA 2YQ4A 5TSDA 3BHMA 1DLJA 1K89A 1VSUA 1SC6A 2ZATA 4RF4A 2BHLA 1YVEI 2P5UA 4AICA 4CLDA 1Z74A 2RAFA 3LVFO 1Y8QA 3K6JA 3ADOA 5G0WA 4MKZA 2PZKA 3MCVA 4FR5A 3WYCA 1ORRA 4XIJA 4ROSA 4Z0PA 5THQA 5B4VA 4MINA 3DBHA 1DFHA 3RAJA 2JKVA 5AXCA 5A05A 3PVZA 3WGTA 1SOVA 4TRJA 1H6DA 3OSUA 2O3TA 1X7DA 1M2WA 2X9VA 4QX6A 4IINA 5GZ3A 3GFBA 3GG2A 1SB8A 1E3IA 4YYZA 2PTGA 2GPTA 1ZK2A 4PRKA 2FR1A 3GRPA 3D0OA 2C2YA 3CINA 4I5GA 4B3IA 2Y1EA 4FJ2A 3IJPA 4LSWA 1JDJA 1ZXLA 3HZZA 2X1HA 5A1TA 4CM4A 5L95A 1XIVA 1GADO 4Q9NA 4W7HA 3HDHA 3GVIA 4OH1A 5HBRA 1DHTA 2X58A 1LRKA 1NX6A 4R5MA 1SAYA 3GN1A 3LC1O 4DL9A 3PHGA 1R4NB 1YS4A 3ZWWA 2WD7A 1AN9A 4HV4A 4ND3A 3L9WA 1QYWA 1VLLA 4FOSA 5F3RA 2GDZA 3E03A 2G17A 4GMFA 3KZVA 4MVJA 2ZQZA 3BIOA 4NK4A 4XKJA 1ONOA 2VOEA 3MZ0A 1E3SA 3GH3A 1L7DA 3ZDFA 1B3RA 2AXQA 4R68A 3RASA 4BQPA 1K2WA 4WECA 4RV9A 4ZQEA 3SVTA 2X5OA 2XF8A 4XIYA 3EW7A 1NM5A 5EINA 2NVWA 2GUGA 1P44A 2Y1FA 3JQFC 2YHUA 1VL6A 2UUOA 2XXJA 1BXGB 4J1TA 4ALJA 3PIDA 2VZ8A 3WYBA 5IDYA 4IJVA 1RPNA 3DOCA 2HCTA 3L9XA 4FFMA 1HT0A 1YO6A 1C1DB 5JMWA 4WLOA 1LQUA 1VJTA 2GF2A 3WS7A 2BI8A 4UVIA 1PTJA 1QP8A 3K2BA 3GF4A 4UEOA 1NQAO 3F4LA 1VL0A 1WPQA 4GLLA 4OQZA 4OIMA 5CDUA 4ZD6A 4CM5A 2DTXA 2B5VA 3CMMA 1Z7EA 1E1NA 1EQUA 1JKJA 4GWKA 2CDBA 3IMFA 2JCYA 3TZ6A 1E3WA 3IAHA 2H5LA 3OIDA 2PD4A 1ZZEA 4JLWA 5ICSA 2WE7A 3RI3A 2DUWA 1NFRA 4IZHA 4J7UA 4BNFA 1PJTA 5BSGA 3OETA 5F1OA 3H7AA 5JFOA 4MVJE 3ORFA 2EERA 3I1JA 4R54A 5KVCA 1PWXA 2DLDA 3V1UA 4W7IA 3AU8A 3EZYA 3W4IA 3ANLA 1C1XA 2WTBA 1EUCA 5KJ1A 4YA6A 3S1LA 3GAZA 4EEXA 4O5OA 1VJ0A 2HLPA 1FXSA 2B4QA 3ZU2A 2NVUA 2Y1CA 1MP0A 3GGOA 5HTOA 3FD8A 1JVSA 1NPYA 4KDEA 1U28A 3DAPA 1ZMOA 4S1VA 3RC9A 1JW9B 2UV8A 3C8MA 4JP2A 1HDZA 3VZRA 1NQOA 4CUKA 3C1OA 5HM8A 5GMOA 3ANNA 1U3WA 3I9LA 2X0RA 3QJ5A 3M1LA 1VI2A 3H3JA 4Z9YA 4FFNA 5JY6A 4A0SA 8ADHA 2W2KA 1YOVB 1NASA 1MB4A 1PQWA 2ZB7A 4J7CA 4MO2A 3RBXA 4AJNA 1I3MA 1JWAB 5JC8A 4JQCA 2B37A 3JYLA 3C1TA 5T5QA 3WG9A 3JCZA 4YDRA 2EJWA 3TRIA 4A73A 4KWHA 2ET6A 3DBRA 4LRTB 1O95A 4GLOA 5U4QA 3UOGA 4TQGA 1XKQA 3UFXA 1WMAA 4J16A 4FD3A 3FR7A 3NEPX
chains in the Genus database with same CATH superfamily
2G06A 2VR1A 4JP3A 3HFJA 2PMEA 4CMGA 2AOTA 3VR5D 2E6KA 1SBCA 1RMYA 2B69A 3LLMA 3PXXA 3D7LA 2ECKA 1PQYA 4F3YA 2X8AA 1M10A 5CYGA 4QBGB 3U16A 2ZOSA 3EEIA 1A0OA 5KEIA 2I7DA 4Q9DA 3UW1A 4CMKA 4PBTA 1YMVA 3MERA 1NVVQ 1QGED 3DEHA 1SFRA 1NPTO 1KEUA 1QZTA 4RWEA 4S1NA 5DYWA 5FTJA 3UMBA 4CPDA 5E7IA 2IEGA 1DRJA 2RH8A 1M1YA 2DPXA 2PJZA 2AL7A 1R5NA 3PQ4A 5FBLB 2PUEA 4Q24A 3LQRA 3JWGA 1KY3A 3F5MA 1T15A 2JFXA 2V45A 2C31A 4Q03A 4NS1A 2JI9A 3Q6NA 5DTJA 2Z08A 1SHZA 1RTKA 2QNIA 2ZUSA 1R9JA 4KN8A 3M6UA 4FEEA 3W2FA 4CTNA 1E9FA 1G9TA 4RTLA 3PUKA 3W4JA 1XE3A 2HD4A 3PXAA 4L85A 1WHSA 1UBMS 3LA6A 3VMFA 2E1PA 3VYSB 1BOFA 2NWQA 1FLAA 2QT1A 4RZQA 5GOZA 3RFVA 4B09A 4CFZA 5LLSA 1Z2DA 3SFTA 5TX7A 3G2JA 2J4CA 4II2A 4P08A 3RW9A 5IARA 4JOBA 1WD5A 3FETA 5JSHA 4NQRA 3UPUA 4OMUA 4S12A 1AXEA 1OZHA 4EBFA 5L7WA 5EIEA 2LZ0A 1X8JA 5DM4A 1N8NA 4ZC8A 4CCSA 3IAS1 4EW2A 3GJ5A 2FRXA 2UZ1A 2QN9A 1C9JA 1H3NA 3GMTA 3ZCPA 2I1WA 1ULZA 5FFFA 5JJ5A 2HF8A 2JVKA 3EIUA 4IOJA 1PT6A 2HPVA 1JSRA 1T34A 3IQIX 3AWIA 3P27A 5ELMA 3I72A 1TTTA 1YUNA 5GGYA 5TF0A 1B23P 4G89A 4E07A 3WRXC 3ZNOA 3IAS6 2VJOA 1EM8A 3SC2A 3ITNA 1S9DA 1LKZA 1ND6A 2VWQA 1EDBA 3K7EA 5FEMA 1W29A 3ZDZB 2AOUB 4JXJA 1LU9A 2P6NA 4ZA2A 1WY5A 3T12A 1I10A 4IKOA 1N2BA 1NQVA 1T6ZA 3LPCA 3TX6A 3HEAA 1AKEA 3DYBA 1MG5A 4FOOA 4DSUA 1JR6A 1P2UA 4LN1A 2AZ4A 4JT8A 3T4EA 4B40A 3LIIA 3M6MD 1XPOA 1DSSG 3GFPA 1QZXA 4FJ1A 4URUR 4I55A 4W6QA 5JZVA 3JZMA 4Z7NB 3LHIA 2OE2A 4RMJA 4JI6B 3EAGA 3QWHA 3MWLA 4JBGA 1QGZA 4CL2A 1I3LA 3F49S 4X95A 3IIKA 2WR8A 3A4IA 3FJ1A 4GPIB 3OC0A 4WXHA 3RYFA 4DA0A 1OH7A 5FBQB 1ISGA 1FDUA 2Y92A 3HJAA 2HCRA 4UE6A 2HSWA 3H5OA 2OV3A 2J4FA 3O2SB 4IMIB 3SEAA 3C3YA 1TQDA 3FH0A 1N0VC 1NUHA 3L7JA 3QLVC 3GVHA 5BMVA 2IY8A 3OAAD 4M0UA 2XXAB 4KPGA 4GKAA 4QTUB 3VKGA 1H4VB 3JQAD 5JANA 5BY2A 421PA 4INPA 2HQSA 1X7YB 5IG2A 1A9QA 2WSYB 2I67A 3RBAA 4ZCPA 1FMCA 2X4IA 4YAUA 2Z1DA 1FW8A 5ALGA 3L49A 4ZVVA 2AI3A 4KV9A 4OEHA 4OQXA 3D7KA 1RACA 5JAOA 2PQMA 1OH8A 4TMWA 3ZXXA 4QGFA 4FMCF 3W05A 4KXMA 4C7BA 2ZUBA 4ZV4A 4ZYUA 1JTVA 3HKCB 2PPVA 3TR6A 5CDHA 4BNNA 4MPJA 2REOA 4D8UA 1KHTA 3CLTC 4MQBA 4Q9JA 1ZUD1 5GM1A 3DZHA 3EDMA 1V2GA 4V0SA 5BV7A 4LWOA 4W5HA 2GPWA 5EIXA 4C1NA 1I6MA 2ALJA 4REMA 1VECA 3T7AA 2PM8A 1YB2A 2Y76A 1NNSA 3U3DA 4MWDA 4J0IA 2ZYAA 2B5WA 1AO3A 1SK8A 2PMCA 3R3XA 5LXTB 3LBFA 3CH4B 2WTNA 3B6IA 2GZ3A 2H11A 2WJ6A 4GRDA 3UMVA 4ZWNA 3KUUA 4IIXA 4MYDA 3A32A 3GCGA 4YV0A 3GIDA 3TSZA 5KWEA 3K0SA 5D6NA 2H9AA 1VA4A 2E87A 5EKXA 4MR9B 2CXNA 5C8DA 1RYHA 5I5GA 3RS0A 3KEQA 1S3SA 3H2SA 1E9CA 4GR9A 2K87A 2XBLA 2XBUA 1ZKDA 1O6ZA 4Z5XA 5EIHA 5KQRA 2BJVA 4NENB 4M1ZA 1G0NA 5IU6A 4KSCA 3H9GA 5C52B 1B73A 3L77A 1FW6A 3MAAC 4U00A 5A7HA 2X0FA 2O3JA 2ENWA 3CR7A 3V2IA 5L3SB 4LFBB 3TW8A 1G0OA 1POXA 4JGGA 2BUAA 1NC3A 2DWPA 2ZBPA 2B7BA 4DANA 3HCPA 1CF9A 1YXMA 3LZDA 4EVRA 1PGPA 4G5HA 2WVGA 1E5QA 1A5BB 2R85A 1VL5A 2Y1DA 2P68A 2Y1XA 5KSPA 2OBBA 1G5PA 3J7TA 3RD5A 3DWGA 3UGTA 4ZV9A 5JH7A 5FTMA 2O1SA 3VTFA 1KVTA 4L7QA 2B98A 2LKDA 1S7GA 4JR1A 3EEQA 4JLAA 1KEZA 5B1HA 1I7QB 3AF2A 4G5XA 4J07A 3RVRA 2YNMA 3COYA 5CAEB 2OFPA 4BMVA 3UV6A 2EQBA 1DLIA 2NQ8A 4E32A 4KYVA 1SG9A 1RQPA 1GUBA 3FGOA 4DIEA 4G07A 5LSAA 1FSSA 3WDMA 1DXYA 2PS9A 4GKJB 3O2NA 1VTKA 1U3GA 1NVXQ 2ZIUB 2NM0A 1R5BA 3GZ4A 2H00A 4YX9A 1NATA 3V2GA 2CNBA 5ARBA 2BCJQ 3UMCA 5DBFA 4JB3A 4Z6KA 1D5WA 3Q85A 2HV8A 5TMDA 4Y2XA 5LUAA 4ZGGA 2ZB2A 4BN5A 3UIEA 1NVVR 4LBZA 1WIWA 1YQQA 4NCBA 2XQFA 1G55A 1KI7A 2GCNA 3F90A 5CX1B 2LR0A 2XPCA 3EIHA 1H0RA 5FHQA 3L4BA 1E9VA 2WVAA 3RRZA 2J0VA 3KM0A 3QVJA 4U8HA 1SCJA 3EZXA 5JROA 3LP6A 2RBGA 4PG5A 3DFMA 2AKEA 4HQKA 4AMYA 4BO8A 5E6RB 3OUUA 3A37A 1UEJA 5CLGA 3ZCVA 4GKBA 5JS2A 1T5TA 2OUKA 4NI5A 2PZ8A 4O1MA 2C29D 2FK7A 4CKEB 5CFLA 4DUYB 2XXAA 3I1FA 1QOPB 4P38A 2ILVA 3OM0A 5AJVB 5JAPA 3PKIA 3GGDA 1HFWA 5HQTA 1TZMA 1QO0D 3CSDA 4FPXA 3OBBA 2H06A 1FPQA 1E20A 1Y4SA 3OY7A 4MIEA 5FDFA 5JTTA 3O8CA 3IBFA 2C2KA 2B20A 1DIOB 2OQ2A 4ND5A 1EVYA 4HDSB 2LWIA 2O6HA 2QAGC 3JQ8B 4WD3A 1YS7A 2YWRA 5EYPB 5D7NA 4OHUA 5MN4A 1QV9A 1ZWLA 2AW3A 3ZKWB 2OHVA 3D3KA 1MEEA 2BBOA 4OOFA 1KIMA 3IEXA 1Q7CA 1W2WB 1SUPA 1Z5WA 3VYUB 1OFGA 3RIEA 4CLRB 2Q5QA 2VK4A 3FRHA 2ZS9A 1WUYA 1EUDB 3V4OA 1X15A 2VHJA 3PYMA 3CLHA 1SIWA 2XGGA 3QVWA 1EFCA 3M49A 3HXOA 2WJVA 4CMEC 3FUTA 4IXDA 5F5XA 1SBQA 4UMEA 4DW8A 4QYTA 1PR5A 2PDAA 1OH6A 3AEZA 4YH1A 3AHGA 5EPOA 1JQ3A 1LZLA 3EMVA 4HRXA 1FXWA 2E1RA 4TTAA 3L4SO 1MIOB 3IQWA 1RCFA 5CH8A 2XCLA 4HC4A 1VIAA 7YASA 1JALA 3B6EA 3H11B 4HAVA 1CJTC 2BELA 5SZIA 3BB3A 1QH9A 4G5GA 5AM4A 4DSZA 5BN3B 3EA5A 1VBFA 4KLCA 2BWJA 4NOLA 1PBNA 1ISFA 3EZNA 1HE8B 1T3TA 2ZSKA 4OUKX 5JO9A 2FDCA 2TRSB 2M98A 4C7OA 1XCPA 3KO8A 4IEFB 1EVIA 4F9TA 2DC1A 3DD1A 3QJGA 4QM6A 4EVQA 1MBZA 3AVUA 5DT2A 1LLCA 3FZQA 2JFHA 2JF0A 1HE3A 3KHTA 3SHTA 5JDIA 2IHUA 2YDYA 3JR7A 5DLYA 3GDWA 2SKEA 3GFOA 4U5QA 5K0TA 1X80A 1B6TA 2PLWA 3NGXA 1SVKA 3D4PA 3VBCA 4JY7A 4AKHA 3RHTA 1FC0A 2C7BA 3R7LA 4Z4CA 3AFNA 3O95A 4V38A 4AKSA 1W4BA 4B35A 1ENYA 4WFKA 1ULHA 3F6EX 1ZD1A 2VPPA 1SQSA 4DMRA 2BGKA 2PZMA 2WLTA 5GAJA 4EHDA 4MQMA 2B1JA 1RAFA 3TDKA 4TSRA 2E5LB 3OEHD 4ND1A 2HT1A 4Q1CA 1FF9A 2IS4A 2GZSA 2Q4EA 4R1LA 4EUNA 5I01A 1TYAE 2X2FA 1V7PC 3ABSB 2OY0A 2AEJA 2GJ8A 2I4LA 1BXKA 2O2DA 3DAOA 3FCEA 2NTEA 1MF7A 3CURA 3QLUA 4ZVNA 4DMFA 3K71B 2H7YA 2X5JO 1G8KA 2HHCA 3PNYA 1R10A 1HDRA 1UKZA 2Q5LA 2YJGA 4IG9A 4I3GA 4KV7A 1EMDA 4UPEA 3ML1A 1RWNA 4JC5A 1QORA 5BT8A 1FBTA 5TQVA 2LP4Y 1KO1A 4FFBB 4BFUA 2Q49A 4F0JA 3CZ5A 1FSGA 2YJZA 4MOWA 3RS9A 3V00A 4KYIB 1L5SA 1SXIA 3VKHA 1H6AA 2FSIA 3UJ6A 3LX5A 4FDAA 1DP4A 3VV2A 4KSBA 4EUKA 2CLKB 3RTBA 1G3MA 3TMKA 4G1BA 4UBMA 3AUXA 1W4CA 2MSCB 5CXQA 1A9OA 1LK7A 2Q07A 2IUFA 3H87A 1CCWA 2CYCA 5BN1A 1ARZA 3AV0B 4I4IA 3FRJA 4P36A 3V55A 2DFVA 4IXWA 4X92A 5DHQA 2X5NA 5FLEX 4G6ZA 1H4TA 1ZINA 4K6OA 1V8OA 2Q9UA 1K0FA 2C98A 4R1TA 2NSDA 4C0XA 2PMFA 1FDIA 4JI3B 1P5JA 1JHQA 2ZSHA 5IKOA 3P9XA 4CQLA 4CTKA 1ONPA 4DLPA 1DQZA 4LZLA 4CHGA 5JUWA 1EPUA 4BKOA 1G4UR 1PL7A 4RTKA 2K7FA 2XVAA 4GU5A 1D3AA 1VJRA 2IXGA 4II3A 5AUNB 3WK5A 1LPMA 2XAUA 4OFWA 5IK2A 3R0QA 2RFLA 3EVFA 2CFTA 1A9PA 3MINA 5UKDA 4N18A 4LOAA 2Q99A 1FA9A 3KC2A 4GMXA 3IKTA 3H8VA 5A5EA 1Y5MA 4S04A 2JHFA 1AUOA 2UYQA 1EWKA 1NVDA 2ZYHA 4BJ3A 5KTOA 5A7GA 3ILSA 2K7ZA 2G80A 3OMXA 5AI6A 4YDSA 1TL7C 1FRQA 3O0TA 3DL7A 3GVPA 1SRQA 3B1KA 3JQ8A 4ZVMA 4B31A 3W2TA 4CKXA 1P2BA 2ERYA 4L22A 3GP8A 2BGLA 3WRYA 5DXAA 5ALWA 5LOVA 4MUBA 1IL0A 2I6TA 2L17A 4HG2A 5AM0A 2GM5A 2NXJA 3DZCA 3NBQA 3O9VA 3R6DA 4BDTA 1JT2A 2NXNA 2FPPA 1BDBA 3M5WA 1WWKA 2KX7A 4B87A 1QXSA 1U3CA 3NBXX 4MQLA 3ODGA 4HGYA 1HEIA 5JVDB 1FU4A 2Q8PA 4L4YA 1NQWA 4A2CA 4JLSA 1GLNA 3R7WB 4LXXA 4W9NC 4O5AA 3HNPA 2P40A 1T1SA 1YK0A 1L1EA 3WX0A 1SBIA 5G02A 3ZC3A 1Z5OA 3TQTA 3AI2A 2IQIA 2JGFA 2O05A 2ZULA 1EHCA 4MRMA 5HA5A 1IEQA 2V3VA 3PNVA 4WXYB 3S7ZA 3FOBA 4QELA 4ZYLA 3EG9B 1QDLB 1KOLA 2B1IA 3HFSA 3P52A 2ZIEA 2BMWA 3PR1A 4DYVA 4ICIA 3PC7A 4RPKA 1OLOA 3QM1A 3V7UA 3PEUA 3OHMA 2A9VA 4O6VA 1YE5A 2RGDA 1XVTA 4LK2A 4ZAZA 1UBEA 2JIOA 1NBEA 5BUQA 3II6X 1Y98A 2E9SA 2WYIA 2V54A 3I28A 1X80B 4K9PA 4LYHA 1Z4PX 5FA5A 4EG7A 2HBZA 4OKNA 4MGHA 1UKBA 1XQYA 3KJGA 4M6WA 4A5SA 3VU1A 5AXAA 2QTMA 3TEJA 4E22A 2VNKA 1H94A 4XYEA 2J30A 2QRQA 1B2LA 2YZGA 2ZP1A 2VJCA 2ZTLA 3B1WA 5JHHB 1IK4A 4MVJF 2HMSA 2W6PA 5BN3A 3PNOA 2DYKA 2QVGA 1MFPA 2FPIB 1X1CA 2CL6X 4I14A 1K06A 5E95A 3AM4A 2W2KB 1ADJA 3ROEA 1FLVA 3SF8A 3EOZA 4MGKR 3ZY5A 1EFRA 1M1NA 1JXMA 3KTFA 3RVOA 3B60A 2XRMA 3FYUC 3N2ZB 4LJ7A 5T4HA 4U2EA 5CM2Z 3KYDB 2D5LA 1I4DD 1EJ6A 4GMGA 3PWTA 3DKRA 3F96A 3RYHA 4K6FA 4HDKA 5J2UF 5ES3A 3FHLA 4I1SA 4N3GA 3O82A 4PAGA 4MDEA 4O1IA 4EB3A 4XD7A 3E6AA 4HFJA 1W7AA 4G0UA 1EEHA 1JXQA 5KTSA 3L0BA 4FK8A 4R9VA 2PE5A 1M0SA 1VL8A 2PGNA 1NMZA 3O8QA 2RCNA 3PB3A 1UKCA 4YJGA 2OCBA 2P4EA 1SULA 2P65A 3IPRA 4R5HA 1LLFA 2IYQA 2ONYA 4D3FA 4QG3A 4CV1A 2QVBA 1PFKA 1ZUNB 4L7VA 4CKBB 1UQTA 2W5UA 3T15A 1ZBDA 2R6DA 4M1YA 3SOPA 3TBHA 4HNUA 1ZH6A 2OKGA 3VDRA 5CCEA 3ZI7A 2PUHA 3H4TA 2VOJA 3O7MA 4IY1A 4PG4A 2BDEA 4RLHA 5DI3B 3RLFA 1N2HA 3ASVA 4O8CA 4XLTA 4LNUA 2QN7A 1N6KA 3CC8A 4AUKA 4F9EA 1JT9A 3MJCA 1E63A 2QKYA 4CM4B 4F6RA 3DKPA 2QN3A 4F1JA 2ID7A 3HA2A 5TEVA 1YA8A 1YASA 3ZV6A 4DUGD 2ZRDA 1RJWA 2ZKIA 4C4ZA 2OOKA 2YRXA 4XFDA 4XI9A 3OFND 5BNTA 2Q5OA 3AL2A 3K0AB 1KH1A 3MNFA 1M6YA 2X2OA 2QE7A 4L0DA 3SR0A 4EB8A 1UKEA 5F5NA 5CDFE 4OLJA 4EHJA 6REQA 3LVQE 4AF8A 1RJ9A 1V4NA 2EGGA 3L46A 3MUNA 4QBIA 5A4IS 1S1MA 3KKMA 4HLDA 1P39A 2K6GA 1ZIOA 4BO1A 4LHXA 3KBOA 2A84A 3CNLA 4LOHA 5TQ0B 3WQQA 1ECPA 3L93A 1YQ9A 5C1DA 4U7DA 1KSGA 4HMOA 4L28A 1PNVA 1GVNB 1W8DA 3FAZA 4UW9A 1UZAA 2YHIA 3FAKA 3NWBA 5LDHA 5AQ1A 5A03A 1C3XA 4MZDA 2JAWA 1OY1A 3INNA 5BPHA 3ESAA 1NJGA 5JH7F 4W5OA 1PQ4A 1UBRS 1XYGA 1BHO1 1QIHA 1M2HA 4L9WA 4HFMA 5G0SA 1I2AA 5IBPA 5D85A 2PVPA 4KU4A 1I0IA 1G21B 4UHJA 1AK1A 1REQA 2WAOA 3Q7EA 4YS6A 4ZVUA 4FILA 5BURA 5JSZB 2YV5A 1GV0A 3KFVA 4JJKA 4NFLA 1NJ8A 3ZCQA 1L3IA 4ECAA 2QLJA 3LTNC 4MQEB 1KAHA 4PPYA 2B4TO 3PI7A 3GFGA 1FJ2A 1TKBA 3HJGA 2BFMA 1C3JA 3C6KA 1U1FA 3KYBA 2CFSA 4MPRA 3T7KA 1ST3A 2IYUA 5JH7B 2PX4A 3P19A 4ML3A 3KSDO 4YJ3A 5HMLA 5TS2A 2X6RA 3A6KA 4GUDA 3RYIB 1HKUA 4O63O 4B6GA 5HRCA 1M1XB 3IKMB 3PX2A 4N7MA 1D2MA 3PK0A 3T35A 5DNUA 4QRIA 2WQ7A 1ENOA 3SS9X 2VHVA 3D8UA 3KQOA 3OQIB 5CIQA 5AQEA 2GM3A 3RT7A 1V3UA 4CDNA 4C7VA 1ZIDA 4FGKA 4RENA 2O3UA 1IN6A 2AD5A 3AO0B 1CDOA 3FPCA 4LY9A 3RABA 3S8MA 3UAYA 3VV3A 4BGIA 5CYOA 2DR2A 4D9NA 2POCA 5BYBA 1V48A 4GPEA 2R0QC 3NOQA 1II9A 1RU3A 3HY4A 2R1VA 2XB9A 3MHTA 2CLOB 4P0TA 4DC1A 5TS3A 1OI7A 1N32B 4ZJYA 3A1TA 4UUOA 1D07A 2IBSA 2XB8A 2QUIA 4LS3A 1QE0A 5ABPA 2IEBA 3L82B 3M9XA 4LWPA 1LRLA 1OFHA 4JBLA 2UZ1B 4AKTA 1J8DA 1HDOA 3BH0A 4RVNA 3RJTA 1H3FA 5HIKA 1EKXA 2BTOA 5M29A 3K9NA 3B6JA 3NHRA 2ID4A 1ZITA 3E82A 3QKWA 4NJMA 4HGNA 4YEDA 5DBEX 3X0DA 4B85A 2XCQA 4BNXA 5AW5A 2ANBA 1KNQA 1RHKA 3JZAA 1Z4QA 4OYLA 3TLZA 1XROA 1ZISA 2C9DA 1ZOOA 5KYYA 3GEHA 4M54A 5G1OA 3USCS 4UNRA 2Q3DA 4EB6A 3Q3GE 4Q4JA 4HUJA 1OYWA 3FCUB 3ZWMA 3KDAA 4TTRA 1YJXA 3O03A 1WQ1R 5CJPA 2LXNA 2PMBA 2WAAA 3BULA 3OZ7A 4H7IA 5DH9A 5B64A 4BB6A 3LMKA 1KQOA 2IKSA 1DL5A 2BONA 3UT5A 2CXTA 4B0PA 4FB5A 1Z26A 1QMGA 3R74A 1RS0A 1CUYA 1C1HA 3UGKA 5CBPA 1UXHA 1BGWA 4HGQA 2HXGA 4XYBA 3IUSA 4BWVA 1P6XA 3N0RA 3MS7A 1QTQA 1YACA 3SXPA 1T8RA 3MMNA 5FBZA 4RANA 1F0KA 3EF0A 3SM3A 3ST7A 2ZSEA 5BR4A 1LPBB 1VLJA 4BEJA 1L4BA 1VMDA 3JZDA 3ZXSA 1FS5A 2VSQA 3A1VA 3PL1A 4WNIA 5KQPA 2N1BA 3ACBA 4RU1A 3U81A 3PWZA 3FCCA 4FBGA 2QTVB 5EHZA 1C2YA 1JYSA 3GIWA 2W0MA 5KVVA 3K0KA 2ODAA 3HH8A 3ZWBA 3AV3A 3UC9A 2Q1YA 2H4HA 4MIOA 1OU4A 3SLGA 2BZGA 3M4NA 1ZMXA 4M21A 3V1YA 2O5VA 5PNTA 1P3Y1 3H9BA 3L18A 4IZIA 3STXA 2VQSA 3DKIA 2P7IA 3N86A 2B9VA 4WNYA 3FPAA 1WSAA 3FDFA 3HYSA 2WTMA 1U99A 1MT3A 4AJKA 3DEJA 4XFJA 4E6PA 3DFUA 3I39X 2V0CA 2EJUA 2HN9A 1AE1A 2R44A 3M2PA 4K6HA 2XKKA 2CHUA 4GOLD 4H0CA 4XGNA 4G8BA 3H6HA 2EIXA 4OYYA 4IUCS 1H2HA 4MS3A 4GR5A 3CUEF 2PSSA 2JATA 4PS0A 1XQ6A 3LY8A 3UENA 1M7BA 2GO1A 2IHVA 1BC5A 2IXFA 3AXSA 3CE9A 3EIWA 3O47A 3WDLA 2J59A 1QQTA 1YZLA 1SVMA 3FMOB 4RZ2A 3HDVA 1LFDB 3JVDA 3ZV7A 4AYXA 4BBZA 2IX3A 4ESEA 3KHKA 3INYA 4I4TF 1FQWA 1Y9DA 5LUBA 1F4PA 3B38A 2OC9A 2VJQA 3R0IA 1L7EA 3EY9A 3I2HA 4ZKDA 1A8UA 3QEBZ 4PFQA 2XIJA 1UDRA 2EXXA 4HDQB 1QU3A 1W46A 4IRUB 4QFBA 2KPOA 3AGQA 4LC1A 1DC5A 1RLMA 3SBEA 5JBIA 1CHDA 1D9ZA 1OROA 1VCMA 2H7XA 1T4GA 4FHDA 4C21A 1R37A 1VRCA 2GEBA 2HMYB 3C6XA 5K3EA 3BJZA 3TRJA 3LWNA 4ZAXA 4I1PA 1V95A 1N6RA 3AX6A 4IDGA 1XZKA 3UTDA 1GA6A 2NN3C 4NZOA 2XNCA 2X86A 4L3WA 2FSVA 1LBEA 3QVMA 3O8BA 4OJQA 4PRYA 4Z9AA 4GBJA 2C5BA 4A8JA 3B6ZA 3PL5A 3SPXA 4MARA 3CF4G 4ZEVA 5BN4B 2IYXA 2V8OA 2F4NA 2PN1A 2QK4A 3B2EA 3MJTA 2JJMA 5D1NA 4XGIA 4AUNA 1FVOA 3EFEA 1E1RD 3HWSA 2GZRA 2QG9A 3DM5A 1E0KA 5KDLA 3Q11A 3BX1A 3DLPX 4C4XA 2GAJA 1XTTA 3EASA 3U7HB 2BV3A 4BP8A 3HZHA 4OM7A 3E58A 4BB5A 1OR8A 4UAGA 5EMMA 1YU9A 4OHVA 2QSYA 1Z2EA 1TQ8A 1EWTA 2KHZA 1G8MA 2X0DA 3ND8A 4I9HA 3GNLA 5K99A 3B9BA 2E37A 3ZI4A 4YJ3F 5JAMA 1B1CA 2J7PD 2Z8YA 4QAQA 1A97A 6PFKA 4DR7B 1J24A 1GL3A 1E1YA 4B3BA 4DA4A 3TJRA 2GKSA 2KW5A 3BD6A 5H9WA 2W37A 4ACBA 3BN3A 4JI8B 1BHSA 1SCQA 1SCDA 2DBRA 2OD2A 3LWZA 3OLWA 4LXHA 2X0EA 3W6UA 1PJCA 2PK3A 4X0EA 4Q3CA 3GRZA 1XD2A 1KNXA 4BKPA 4JSTA 1JBEA 5KSOA 5TPZA 2C4TA 1AKMA 3RRBA 4EQ6A 1B41A 3ZDEA 1D6NA 3FOAA 4OB8A 1HYQA 2XEDA 4WASA 4E5VA 1E3MA 2HMWA 1RLUA 2V7XA 4O1HA 2YR0A 1XRMA 3K0FA 2HCBA 3KQSA 5GVRA 1P33A 3NM4A 3DKVA 3HYLA 4OU5A 3S0JA 2I0FA 3IT2A 3T54A 1MQ9A 1ORDA 1Y7TA 2OCAA 3QSYA 3FYTA 5HCUA 4I1VA 1I0ZA 2HZBA 1SKYE 2IXAA 4L95C 1F3LA 4GKVA 2JLUA 1IJKA 4CV2A 4E21A 3O90A 1DMSA 1C5KA 1OGYA 4TT3A 4FN5A 1KOJA 4PSCA 3EXEA 1BA3A 4G1UC 4NX2A 2RG1A 4B8YA 2LDXA 4K0RA 1BW9B 4I1YA 3PVSA 3K8ZA 4JELA 4K40A 4PYLA 4BL5A 4TPKA 4FB4A 2BF7A 2Y4NA 2W22A 1JZTA 2DBYA 4OJNA 4PV7A 1F1JA 4ZQCB 1QLWA 5KKNB 1F2TB 3TW0A 1LPPA 2VZ9A 2J31A 2H0RA 2CXQA 1RHJA 2Y1WA 4D6PA 3CX3A 5JVDA 3GDHA 4IMPA 4LNHA 2PRSA 4HMQA 4QZVA 3K0EA 5DNAA 5BW5A 1JQEA 3BIXA 1YDHA 4YCNA 3CUYA 4RD0A 3WK4A 1U7DA 3CS3A 2NUPB 1XDWA 2F7SA 3ZZMA 3EVBA 4KE8A 1W0CA 4MKRA 4QFCA 3RLIA 1KJ9A 3Q9SA 1KI4A 4RZIA 1DXHA 5EMJA 3HCFA 3TUZC 1KI2A 3EFHA 1JA9A 4FYMA 4DCJA 2AB0A 2F62A 3O74A 4C7KA 3DBHB 2EX0A 4D9JA 4KX5A 3C3BA 3F2IA 2FOLA 1FRNA 2OLEA 3BDVA 1YC5A 3BGDA 3NBYC 3PXEA 1Q83A 3RBVA 1SCUA 5EUQB 5AIAA 1C1XB 4XWGA 2KI5A 5TRTA 2AKYA 5ICEA 3HQ4O 4HLCA 1BKDR 3N7UA 3MOIA 1FFEA 2PG3A 1JH9A 2EJBA 3P4YA 4JKYA 4Z86A 5E9WA 4ZIRB 2C3UA 3L6EA 1CQJB 1Y3CE 2GLUA 2I4IA 1FPMA 3OKFA 2GXSA 3ROXA 2EKQA 4KQ9A 3JVVA 4E70A 1WB5A 3LKZA 3DBOB 4D4KA 5IULC 3A11A 3SBXA 4XTRA 4YIKA 4DARA 1KHHA 1ZR2A 4JX8A 1L5NA 3P0IA 1P2FA 2NV0A 5J5AA 4CIDA 3UWKA 4YRKA 4U5XA 1QS0A 5I3CA 1XOIA 4I6EA 3W7AA 1Z0JA 2XYHA 1QYVA 2D0IA 3JQGA 1Y5LA 4QUBA 4KRXA 2RJNA 3LF2A 2FWRA 2NZVG 3AERB 4EFNA 1Y5RA 3NONA 4JH0A 1RLOA 1O4VA 5CLHA 3JD1A 2ZBVA 3T9FA 3GPIA 2V9CA 1VJDA 4BEBA 4L4SA 5IAJA 4BUZA 4BVGA 4RX1A 3HUEA 1QF6A 1LLDA 3L8EA 5HRAA 4YJGB 5FI5A 4CMBA 1XFAA 2FMHA 1J2JA 1KY4A 4QATA 1W581 2QMYA 5EI5A 4R69A 1Y9AA 3EPLA 4DQLA 4IDDA 4LCBA 2ZAOA 3LUDA 5KTKA 3V4VB 4C22A 4RS4A 1Y3AA 2QI9F 3X1WA 1P1RA 3GK3A 1T6BY 1OW3B 4NPAA 2H2DA 3IEIA 4AJEA 3E05A 2Y0CA 5DLPA 3G1UA 2PUGA 3A26A 1KZ7B 1P7VA 2WICA 5DMHA 2GARA 3PUWA 5AKYA 2O54A 3ZWYA 2YJNA 5JDCC 4DAOA 2PWPA 3PDCA 2AN3A 2QRGA 1EFKA 2V6GA 3B78A 4UXHA 2BC9A 4Z9FA 3BTOA 3KX2A 1QHSA 4D41A 1EXNA 1U94A 4QBKA 3HY3A 2XUQA 1H2EA 3U4GA 3T38A 2C3OA 1XZNA 4TROA 4XLZA 3W8EA 4O25A 3P5SA 2ZJ4A 1XMXA 3PFFA 1NDQA 3W8RA 2HUNA 2Z56A 2V7UA 1A9SA 5JLAA 4DLZA 3RU2A 2G63A 1JGTA 1X1EA 4BVAA 3DTTA 1N7GA 1GN8A 1OLXB 1PZMA 4A23A 2BD0A 4MS1B 4OHPA 2H8GA 5E6SB 3VKWA 2ILTA 4JYCA 1NT2A 1CIPA 2HTEA 4W8GA 1NU8A 4ZT7A 1N3IA 2QUJA 4KI7A 3ZTYA 6LDHA 4I5DA 4K9LA 3X2FA 3PD0A 4C0BA 3A10A 3BH6A 3OF2A 4NAHA 3ZS8A 4D4JA 1HLPA 5KDOA 4LZWA 1F17A 3EQ8A 4RESA 1DDIA 2Q8NA 4C4SA 4WBNB 1TFRA 2W6JA 1SCKA 1S4QA 3OTOB 3A3KA 4FYJA 4R1UA 4FT2A 1M9NA 4HLQB 3AY3A 5DVZA 3UXEA 1XR3A 1PQPA 2F9LA 1N9ZA 3X1KA 2H7CA 3V4PB 2RHOA 3DTVD 4EGSA 1VHWA 4MWZA 4B5KA 5EPUA 1WQ3A 4ARZB 1R0XA 2B8EA 4RPIA 1KY5A 1RLIA 3QMWA 3EC1A 3EGOA 4JL8A 2R1UA 1UMCB 2CF5A 1IOLA 3MHPA 4HRVA 4ALLA 3BMCB 2W93A 2YVUA 4HWSA 4MW2A 3E2PA 2FWBA 4AZ3A 2EFJA 4EKYA 4ZCIA 3JARB 1QQAA 3KOWA 3QITA 4YWJA 3K9GA 3L41A 1GZ3A 1QTIA 2JGNA 1BW9A 1ATZA 1N4DA 1Z5UA 3K16A 4WAUA 2ZREA 4ASUD 1LWOA 3RH0A 1Y1RA 5FTKA 5ALXA 1AA9A 5HYVA 2FKAA 1D09A 4PTLA 3VR4D 1PX0A 5BSUA 2IA5A 2OZEA 3GGPA 3AR4A 3V8EA 1WXIA 3ABOB 5AICA 1ACJA 1LPAB 3K73O 3MCTA 1G6OA 2VYVD 4DUPA 4OQFA 5BUSA 2FI1A 3SZGA 2WB4A 4QECA 2IOQA 2J48A 2RSLA 3U3KA 5JAHA 2G76A 3BMOB 1O03A 2I9PA 1BKYA 3E1KA 4H2DA 5G53C 1O54A 1W34A 1DXQA 1IUKA 3NDJA 3TM4A 3FOEC 1QO7A 2Z58A 5E6UA 3D5TA 3DTYA 3ZX5A 3RUCA 3R2JA 2ZYSA 3OJWA 5IJ9A 3A6GA 3UXHA 2CUZA 1M8JA 2I8LA 2ZEJA 3D8BA 1WW8A 5ALLA 2IP4A 2IV3A 4E3ZA 5IKXA 1L4YA 3A1CA 4KODA 3ZWKA 3TTYA 1ZSVA 1MEOA 4J29A 5HGJA 3TAHA 3VM6A 4DMCA 3GOQA 2GH1A 3HB9A 5JLJA 1E5VA 1W35A 3EZLA 3FSJX 5KJEA 5EWJB 1L7VC 3ENWA 1HDYA 2QM7A 3EWIA 4F5WA 3EA0A 4MLPA 4DYHA 2SECE 5HJEA 3SX2A 4DHWA 4C03A 4GVLA 1YJAA 4UM5A 3VOSA 1K08A 3ESDA 2XZTA 2PS1A 1E7SA 1XTPA 2LIVA 3IQGX 3KQPA 2WU1A 4WNAB 4BECA 5HE9A 4UNNA 3HBFA 1QHXA 1TM4E 3X44A 5HR5A 1GTRA 1RHRA 4QFDA 2YXPX 2WIKA 1GN9A 1PV1A 3I9V1 4WOPA 4QRDA 4X41A 1E99A 5ALOA 1NULA 5EJIA 3TX2A 3PQDA 1DZ3A 1PV2A 5KQGA 1OV4A 5ADVA 1I7PA 2VYNA 1JHYA 2ETXA 3QEMA 1B14A 2QOEA 1MVLA 1PFGA 1QS0B 1G18A 4KQXA 2B36A 1EX9A 4LSGA 4ETWA 1VP3A 4B3JA 4XGKA 3FUVA 5G41A 5EJGA 4BVFA 4D92A 4QC2A 4EIWA 4M86A 2K4MA 3DV0A 1QH8A 3UV7A 1ZJ6A 1RQ2A 1ZESA 5F98A 4NENA 1E0AA 1VXRA 3PC8C 2FWIA 1DRKA 3TS1A 1GKUB 1BE6A 1GPWB 1ETUA 2QTBA 1QGOA 4LVNA 4U39A 4TTVA 1T5SA 1Y1PA 2R87A 3HB1A 3LA8A 3P9IA 3WL3A 4OQDA 5B7GA 4KQEA 2YZ7A 4PLGA 4UU7A 2Q6OA 1U2PA 3DUFA 3INTA 1D04A 3C2QA 3GRVA 4FWIB 2VDOB 1K9SA 2VFAA 4MWCA 4MW7A 5IZCC 2QS9A 4X54A 2GZAA 4BV8A 4BQEA 4GEKA 1X1SA 1F7VA 4MQ5A 5I3ZA 2O8VA 5KHOC 2BMFA 1FMFA 3YASA 3CLUD 3OKAA 5BWMA 3U31A 4KWEA 1MEJA 2YW9A 4DLYA 3IL2A 4V2UA 4Z3DA 3H2YA 3V7FA 2ABWA 4WMLA 1PWHA 3UHPA 3C7TA 1IVSA 1BU5A 2HUPA 4MB6A 4MR8A 1XPUA 1HMYA 1MDBA 1TJ3A 5ALKA 2G72A 1YUBA 3DEIA 3LY9A 1XDGA 3QKRA 4DDVA 5H81A 4HQRA 2D5BA 5IJZA 2ODTX 3NC4A 2CCJA 3L05A 1ST2A 2XQJA 3MJDA 4LK3A 4MVJM 4MLZA 1VB3A 2QYSA 4XQCA 5ALQA 3W9BA 4ETMA 2Z4SA 3S44A 3VAZA 5JZSA 1Z0KA 3HKDB 1JR3D 3Q9NA 4RWZA 4BGVA 4C88A 5JZBA 1U5CA 1HURA 1VLVA 3VTKA 3RWBA 2G9NA 4JI7B 4WLFA 3DE2X 2OG1A 4DPLA 1PGJA 3B7WA 3QE9Y 3DMRA 1R1DA 3B9PA 5ITWA 2W00A 2GBLA 5IZCA 2EFCB 3MLEA 4KK3A 4MGIR 2IL1A 3UG6A 3ASUA 4JJ7A 4F85A 5FNVB 1TAUA 1QZUA 4E5DA 3M34A 2VT2A 4PLVA 4NMWA 4DIUA 4AY5A 4EQZA 3AUKA 4LI3X 4A8JB 3CRRA 3WLJA 2R86A 4CM3A 2WD9A 5AO9A 2NIPA 1OBHA 4YQYA 4BY9E 3PCRB 4WINA 1IQUA 1N25A 4W9NA 4YQFA 2GMWA 4PPGA 1MTZA 3ETEA 3PQEA 1WDKA 1RD4A 1NWCA 1Q0LA 2JH3A 1XMSA 4I5IA 3UAZA 3VO2A 2H1SA 4DCTA 2ORWA 4G9EA 3M6AA 1S9HA 2VT6A 1Y48E 3O8NA 1TE2A 3T5PA 2O52A 3L8MA 1W4LA 3KYJB 3KVOA 2PRZA 2QZ9A 1ZI6A 2C3PA 3UUFA 4YT4A 2E7ZA 1FDWA 1E3LA 3HA3A 5FAXA 1NJ6A 3UHJA 1YS2X 2FPGA 3GRRA 3W2GA 1RYBA 3VR2D 4GOJA 2CUKA 2ZJ7A 2DPMA 3CZMA 1EVLA 4CKCA 5L3VA 1WMDA 2VUUA 4KDCA 4UAJA 3L6DA 7MHTA 2HWUA 2L69A 1CLUA 3IUJA 2ZUUA 4D6XA 2X13A 1VCOA 4WIAA 4MVJH 3O3OB 1NJ2A 3IDZA 3O9MA 1L5QA 1Q22A 3DBLA 2QLFA 3RRYA 1KDOA 3UJHA 4FM9A 2R4QA 3C48A 3L1HA 2AOUA 4IX1A 9LDBA 3I9KA 3OG9A 2O2ZA 1HI9A 3E4DA 3G6KA 1J8VA 4Q1AA 1R6XA 3D0RA 2BSAA 4WLEA 2P2CA 3JRNA 1EQ2A 1VPLA 4N5DA 3UQZA 4WXEA 5DTEA 4D8WA 4EENA 3P9NA 4RKFA 4TXHA 3G7SA 4YMGA 1G5IA 2JJ8A 2X7JA 3NEAA 1TMOA 4ZZ1A 3C39A 4MDHA 1M73E 1OBCA 1WL8A 4TWIA 3V46A 2GWRA 1R9MA 4M8KA 4J0HA 1DQRA 3OCVA 2XTJA 3PG5A 1LQTA 3ZYCA 1KZHA 2QRNA 1MJ5A 1N6PA 1NVEA 2PKQP 2Q5FA 3EUWA 2LDBA 2RGNC 2ZIFA 2AJBA 4HWTA 1U98A 4M7RA 4ZCTA 1C1YA 1OAOC 3IA2A 4RD2A 2FMTA 2O50A 2VXCA 4NXMB 4QBHA 1M76A 3C5EA 2FP4B 3WJ2A 3QA9A 3QKTA 3RSFA 1J39A 3I6YA 1R4MB 5JRJA 1T2CA 4KPUB 1CQJA 3HXMA 2VP0A 3QFFA 3ZCUA 1V8BA 2I6SA 3O8OA 3TD9A 1JQLB 1GRVA 5JCOC 3AJDA 4YUWA 3WJ7A 3SJZA 5BXQC 1N2OA 1QNFA 3AT1A 1MX9A 4IJWA 2QJTA 3MPUA 5KNLA 3OQMA 5T4BA 2RG7A 2VQ3A 4BLSA 4RPHA 3IAUA 3B36A 2BY4A 2ZSBA 2RBEA 3OP1A 4DWJA 1FDVA 1OREA 1NUQA 1TTQB 3I0ZA 1V11A 3ICPA 4UOQA 2EX4A 5EC8A 1U90A 4DR3B 1FVHA 5B2FA 4J0JA 4JWKA 2YDXA 2DY0A 4M1TA 5HRUA 2IOYA 2BEUB 4GDMA 4AB1A 2QMHA 4FYHA 3FHOA 1XZHA 1C8VB 2C4WA 3B53X 5IAGA 3ZZTA 4B3CA 2MYTA 4BMCA 3UH1A 2QPOA 1RKQA