1B9JA

Oligo-peptide binding protein (oppa) complexed with klk
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
total genus 190
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b9jA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b9jA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b9jA02
2OZZA 1N04A 1XOCA 1B3GA 2RC9A 1B46A 1B0LA 1SI0A 1H3DA 3FVNA 4IO5A 4U21A 4WEPA 4KYDA 5DVIA 2QPQA 3N6TA 5BWJA 4RA1A 1A8FA 4MLQA 3CRBA 1B7UA 2Z8EA 3IOVA 4XKQA 2H9BA 5EHMA 1UIVA 3DRJA 4KI0E 4M1VA 4QFPA 5H8HA 4ESXA 2X7QA 3O6IA 1NNFA 2QS2A 3L6GA 4G8MA 3TAJA 1I69A 3QSLA 4F1UA 3OSRA 4X1DA 4L17A 2V25A 4C0RA 3K1MA 3QXMA 4JDFA 4R6HA 4H1XA 2XXRA 2A5TA 3CR9A 5TP9B 3RUMA 3TTNA 3TTMA 3TTRA 1B5HA 3N6UA 3ZKLA 3U72A 1NNPA 2PX1A 4OERA 3EHTA 1II5A 4THIA 5AA4A 1QUJA 2ONSA 5DEXB 2QMWA 4JSOA 3V5AA 4N6PA 3RGYA 2H99A 1FCKA 2O1MA 1MRPA 2I49A 3G7WA 4FJPA 3UIFA 3RYAA 2AL5A 3VV5A 2XXVA 3H6UA 3UN6A 5DVJA 5I84A 5JK4A 2RKMA 5HM4B 1MY0A 4R74A 2Q2CA 5EHSA 4DIGA 1L5TA 5CMKA 3GZGA 4KFQA 1XHYA 1FTLA 3RTFB 4IO3A 3G3KA 4MFIA 1LFIA 5CM6A 1MPCA 3TQLA 2F5XA 4OETA 2I6EA 5ITOA 1POTA 5JTYB 2VGQA 3PUZE 2PVUA 3S9NC 1AOVA 2B3BA 3O6HA 3O6GA 4KYEA 3QUFA 4OYVA 3VXCA 5L9SA 3CG1A 4BDLA 5TP9A 2UXAA 3TCHA 2XXWA 1UTBA 4NF8B 1AMFA 1B3LA 1EZ9A 4IO6A 5AE4A 3VFJA 1EZPA 3DP6A 3VXBA 1N3XA 1BIYA 3VLUA 4QFLA 1CE2A 1S7YA 1UTHA 4GL0A 4LVQA 1IQ7A 2H98A 2XXHA 3WAFA 1B51A 3B6TA 1URGA 1B7ZA 1Z7NE 4ZEBA 2REGA 2V3TA 4OVJA 1JW5A 2G93A 4YKIA 3E9XA 1VR5A 3ILUB 3M3FA 3Q27A 4FEBA 4OEUA 2I0CA 4Q5TA 4U4XA 1JEVA 4WKMA 3U94A 4HW8A 1Q35A 1MQGA 3A09A 3FV1A 3K1NA 3LBSA 1EZOA 1J1NA 2D3IA 2OLBA 2CMOA 4EQBA 1MY1A 1FTMA 3W9VA 4QFKA 5HBCA 3E13X 1MDP1 2X26A 3PUYE 4FORA 5I56B 1N7WA 1VFEA 1ZMGA 2DP8A 4H8JA 1FQDA 4X1BA 3HCQA 3PD9A 3K02A 3IOTA 4GVOA 2P0SA 3AXFA 2I48A 5I56A 1MM7A 4PFUA 1B1XA 1TFAA 2RC8A 3EF7A 3FJMA 1B05A 1R9QA 2ANJA 1NH7A 2V3QA 3QUJA 3H4ZA 4JB7A 4ND9A 4ELQA 3JZJA 2I3WA 3KSXA 2O1LA 2ZYKA 5FHMA 5B70A 3T66A 2PMSA 1MXXA 3FJ7A 3B6QA 3FVOA 3PD8A 3PUWE 4LUBA 2D21A 2NOOA 4Z0IA 2GH9A 3FVKA 3VLVA 3IX1A 3C32A 1B32A 5I2KB 3DRHA 1R9LA 1MG1A 2QS1A 3B6WA 3ONMA 2DE4A 1URDA 2YLNA 5KZTA 3TMGA 3HN0A 4NTLA 1GTKA 4DXCA 3SETA 3ODBA 1XT8A 5L8DA 2ALUA 2XXUA 3EPEA 3THIA 4P11A 1NL5A 1ZBMA 1YCJA 3V8XB 4EQ7A 3S9LC 3JV9A 3CHGA 1MQHA 1S50A 3CSGA 1MM6A 2XXYA 3KEIA 4FEDA 5DYHA 3LC8A 2UVGA 4DXUA 1QW0A 4JXIA 3TCFA 1P1NA 4N13A 1LAHE 3ZSFA 1N3WA 2THIA 1MXZA 3LR1A 1MQDA 4IO7A 5EYFA 1Y3QA 2VP1A 1LCFA 1JW1A 1B7HA 4O3CA 4TLMB 1TWYA 3GXAA 3PPRA 1EH3A 1D9VA 2DWIA 2P2AA 3A3UA 3UK4A 1A40A 2VOZA 3C31A 1B52A 3VDFA 2XX7A 3SEYA 4G8HA 3MC2A 2F8DA 2QL3A 3I6VA 1BP5A 3EQ1A 1FQFA 1MPBA 1P99A 3G3JA 3O66A 4MBPA 4TQUQ 3MP6A 2F78A 1A55A 2F36A 4QSDA 1DMBA 4DXBA 1ZTYA 1PDAA 4QF9A 5I2NA 1B9JA 2A5TB 2AL4A 2Y84A 5ICTA 1MXYA 2XX9A 3DM0A 1LAGE 3S4UA 4ZEDA 4Q8RA 3MZBA 1H45A 3PUVE 2HEUA 3S9MC 2Z8FA 3U1OA 2NUVA 4WEDA 1YAEA 3H3GA 4GOTA 4ZZEA 3K4UA 4ZZAA 5H8NB 4G77A 4LP2B 2HZLA 2QJEA 4RJZA 3MJNA 2OK2A 3PPNA 2XD3A 4YKJA 4R72A 4O3AA 4QFNA 3RY3A 1H43A 2GHBA 4NF8A 3RT8A 1QKBA 5IKBA 4U2RA 4OFJA 2Y7WA 1LBBA 3FD3A 4R6KA 2XXIA 3BBRA 4KR5A 4DE8A 1XC1A 2FA7A 3MPKA 3Q29A 1US4A 1WVJA 4IY5A 4LZ5A 2DWJA 4ZE9A 2HAUA 3FXQA 5FHNA 4RPNA 1PBQA 3MVYA 1LAFE 1NNKA 1Y1ZA 5AA2A 2V93A 3CVGA 2OWTA 1MY4A 2CZLA 2VD3A 2ZXTA 3IO4A 2FNCA 2GRVA 4G2ZA 4XTCQ 4BDMA 2O84X 1DPPA 3IOUA 4JBZA 1Q1KA 3B7DA 3PGFA 2ZMBA 3TUSA 3PU5A 2RCBA 3OELA 1PC3A 1Y4TA 2NWJA 5CBRA 4PFTA 2F35A 4H0WA 3K01A 1FTJA 4F22A 5JEIA 3KGCA 1MY2A 3PPQA 4LQ5A 3KSJA 5FTIA 1FW0A 4F3PA 1PB9A 5CMBA 1DTZA 5JTYA 1FQEA 4ISUA 1A99A 3IO6A 3MW0A 1D3KA 4KYSA 3PMWA 3Q28A 1ZJLA 1TT1A 2O6AA 5FTHA 1NMUA 1P1OA 1R6ZA 4K3FA 3OEKA 2I3VA 4NF5B 2ZYOA 4I62A 3H7MA 3L6HA 5DVFA 2DVZA 1ZIUA 4U1OA 3DRIA 4IO2A 4QRZA 1MS7A 1B4ZA 1QUIA 2M8CA 1MY3A 3C34A 4IO4A 1B5IA 4OESA 4HCYA 2AIXA 4GFRA 1O64A 4ECFA 1QJMA 5I58A 2F6GA 1SD3A 4FAJA 1FQBA 2AYSA 2QMXA 3K6VA 3QIMA 3OOAA 3TQWA 1FTKA 1Z7ME 2QS4A 3LUYA 1M5FA 4POWA 1IXGA 3D4GA 1BTJA 3HHGA 4P0IA 4ZEKA 4QSEA 4BDOA 2XXXA 1D4NA 1LAXA 2F7CA 4AB6A 2OCUA 3IL1B 4QSCA 4NMYA 3TFLA 4ZDMA 1ZU0A 3MVXA 4G4PA 5L9OA 5I57B 1OMPA 4ZEFA 1TXFA 4UA8A 3FGSA 1MPDA 1Y1MA 2DWAA 3SESA 2Z8DA 3QYTA 1RYXA 1AH5A 1B40A 2PBWA 2Q88A 3KOTA 3HHFA 3MZ9A 1SW2A 2UYEA 4PETA 4NF6B 1AIVA 2REJA 3RTWB 2GHAA 1LSTA 1UQWA 1PB7A 1QVSA 2FYIA 2KLFA 2O69A 3GBBA 3KOSA 4KD5A 4EQ9A 5KCJB 1H44A 1FQCA 2Y7KA 4OQOA 3DRKA 3K0VA 2F97A 2DVCA 3O97A 3TCGA 4G68A 4U22A 3JYRA 2BJJX 3T9HB 5K2XA 3G3FA 3EHSA 5L9MA 1MXUA 4EDPA 3IB2A 4EUOA 4JWXA 3ZS6A 3IJXB 3V83A 4LQ2A 4JWOA 1XVYA 4YU0A 1TFDA 2Y7RA 2GFEA 4X9TA 4EF2A 5F1QA 2E1SA 4F2QA 3SEXA 3LVUA 3VVDA 3RT6B 3SEVA 2DS9A 4GWOA 2ESNA 3Q25A 3R26A 4X48A 1B5JA 1IEJA 1PEBA 4FIMA 3HSTA 4PFYA 1BKAA 5ICQA 2E0SA 2Y7IA 4KHZE 3VE1B 4F2OA 5H8QB 5ITPA 2WOLA 2Q2AA 4NF6A 2O68A 3TYHA 5KDTA 3FXUA 3OENA 3MP8A 3O9PA 4LZ7A 3TODA 3MP1A 1M5BA 5TU0A 4JSDA 3IJOB 4DDDA 1XS5A 1PBPA 4BDRA 3D4CA 1ELJA 3SERA 4KQPA 4F3BA 5I57A 4U4SA 1JW4A 2QSXA 3RNNA 4YAHX 5TPAA 2Q89A 2YPNA 4YB7A 1NH8A 4YKKA 1UIUA 3UA8A 3H6VA 2IEEA 3T9XB 2DQVA 4TOZA 3TELA 2NXOA 5A5XA 4HS7A 3UGWA 1BLFA 1FQAA 1R1NA 1JEUA 3C9HA 3C36A 1B3FA 5IAIA 1YPNA 1VFDA 2F7AA 4MH5A 4Z7EA 4OFLA 5I59A 3TPAA 3DLNA 2UVHA 5AA2D 4R75A 1IITA 1PB8A 4H5GA 3M8UA 3KZGA 3M3KA 5I59B 1XVXA 1P1QA 3F11A 1OLAA 4PQJA 4ZE8A 4Q30B 2W7YA 1B6HA 4LONB 4HTGA 5I2NB 3S2VA 4H67A 1USYH 2R71A 3N26A 3USDA 4N07A 1I6BA 2IA4A 2ABHA 4PE5B 2D5WA 3OMBA 5H8QA 2B3FA 3DP4A 2G29A 2DSFA 3MPLA 4KCCA 3T93B 4YB6A 3PPOA 2RCAA 3TDJA 4NE4A 1N84A 1Y9UA 4TLLB 1SYIA 2RF1A 5ISUA 3OEMA 1LFHA 2DYXA 2H4IA 2V84A 1MQJA 2Z23A 3UORA 1DPEA 3GLBA 5CRYA 3RPWA 3SKPA 2O7IA 1DOTA 3MQ9A 3RYBA 1VSOA 2B4LA 3OD7A 4OTEA 5B7DA 1LB9A 1LB8A 1QULA 1EU8A 2PYYA 4M4GA 4H8IA 2P1SA 5ELVA 5BUUA 1MH3A 5CMMA 5H8FA 3U92A 3KN3A 5I58B 2XD2A 1OLCA 3ECRA 2A5SA 4GLIA 3EHUA 1B1HA 1SW5A 4XXUA 3MAMA 3H03A 2I4CA 3GBAA 4U1ZA 4LA9A 4E0XA 1B4HA 3FATA 4AQ4A 2UVIA 3C4MA 5H8NA 3KJ7A 3U93A 3FVGA 5TPAB 1A7LA 4NF5A 3H06B 3OO7A 1SQYA 4R73A 4E0WA 2O7UA 1VE4A 1Y20A 2I4BA 1HSJA 1IXIA 3PUXE 5CBSA 2NVUB 2PT2A 3IB0A 4H5FA 4BDNA 4YMBA 4F3SA 4F18A 3TTKA 1Y3NA 1JVYA 1SYHA 1MDQA 1US5A 3IK6B 3PAMA 4IY6A 2Q8JA 2ONKE 1ZKBA 2VD2A 1SVXB 1SDXA 4GRKA 2ZNSA 4RYAA 5CI5A 3K00A 3E3KA 1LFGA 5HPQA 3PPPA 3G3IA 4I1DA 4P0GA 3S9EA 3P7IA 4MLVA 1FTOA 3KN8A 2R9JA 3LSLA 3KBRA 3M3LA 4GF8A 4XKPA 2HXWA 3OXNA 3W9WA 3FASA 1T0KA 1O63A 1QKAA 4F1VA 2DXRA 4IB2A 3CI8A 3H6TA 1JVXA 1QUKA 4ZEIA 4H6DA 4ZS9A 1GV8A 4ONYA 3CSBA 1O7TA 2DE2A 4RXLA 1GR2A 5DT6A 3G3HA 2XXPA 3RLFE 1NFTA 2I0BA 2YJPA 3KG2A 4G68B 3G3GA 4EF1A 3BFUA 2DE3A 3BFTA 4IGRA 3O6PA 5A5XB 3MBPA 1GGGA 2F6PA 4OEVA 1DTGA 1H76A 1S9TA 1IZ1A 1USYE 3EN3A 4KCDA 3TKDA 1OVTA 2RINA 3CFXA 1WODA 3PV0E 3KN7A 4NF4B 1IXCA 3IORA 2B65A 4XKNA 3FV2A 5H8FB 1HSLA 3O28A 3CFZA 2PT1A 3C33A 1M5DA 4UACA 4RNSA 3MZ1A 2VHAA 4OENA 4F19A 5H8SA 5AA2B 3OO6A 1DSNA 4XKRA 2XXTA 2ZYMA 3IB1A 4O3BA 3K6XA 1Y4CA 4F29A 4NWDA 2DXYA 2O51A 1WDNA 2RC7A 4OFOA 3CG3A 4NF4A 1I6QA 1N0TA 4ELRA 1IIWA 1POY1 2R6GE 2ZYNA 1NNTA 3CFLA 4R9FA 3T9VA 3VLWA 3SEWA 2H25A 3IR1A 3H6WA 3HO7A 1B2HA 1OQHA 3IOWA 1OVBA 2HZKA 3RN8A 4WXJA 4RY1A 4EXKA 4I8CA 4Q0CA 1GVCA 1LLSA 2UVJA 5J1DA 3PMXA 4OHNA 2V3UA 4MF3A 4RPOA 1B58A 1F9BA 3K6WA 2HFBA 3FJGA 5DEXA 3CIJA 3QK6A 4GD5A 4I9DA 3T9UA 3WAEA 4AB5A 5AA4B 4DZ1A 4ZECA 4NEDA 4FECA 3T22A 5CMCA 3Q26A 1MXWA 3FIRA 4LATA 5CC2A 2F7BA 1AL3A 3DRFA 3LSXA 1RKMA 2HCAA 3BKIB 3LSFB 4GQOA 4YZZA 1LBCA 2OJTA 3V89B 1B3HA 4R2FA 4JWYA 4C1UA 1Y3PA 4GXAA 1UTHB 2Z22A 3LSWA 3K2DA 3N5LA 1CB6A 3OSQA 3C35A 3TTLA 1SBPA 2QS3A 3W15C 5I2KA 3U8QA 3DRGA 4GL8A 4PFWA 3T96B 2WOKA 1OQGA 3N94A 4IGTA 1M5EA 1MQIA 2HAVA 2XXQA 3FZVA 3K1PA 3MVWA 3DP8A 3HPIA 3IAZA 4LZ8A 4OZ9A 3QAXA 4BDQA 2B4MA 1IUDA 3I3VA 4RK9A 4KPTA 2X7PA 3MVZA 5KDTB 2WKYA 1D9YA 4ELOA 4PP0A 4HCWA 2DWHA 3UP9A 1LGBC 4POXA 3PMVA 1LCTA 2WOPA 4FATA 1SI1A 3O2AA 4OMBA 2QRYA 4DCYA 5K2YA 4R6YA 1IXHA 4H65A 4YB5A 1JNFA 4ESWA 1JQFA 4FE8A 4R2BA 3VVFA 4R9GA 4F1YA 5AA3A 1ANFA 4RK2A 3FTOA 1MH4A 1B3EA 3OO9A 3KJTA 4YICA 3R6UA 3SDFA 4BLAA 4DLDA 5M2VA 5LOMA 2H5YA 2OWSA 1P1UA 3FUZA 3RQTA 3HV1A 4OWDA 4YKPA 2ONRA 1YTVA 1M5CA 4NWCA 5DTBA 2I58A 4G8NA 3K6UA 2UYFA 1B0HA 1HSEA 3A3CA 4YMAA 2LAOA 4F31B 1JETA 1I6AA 3ZKKA 3MWBA 1SW1A 3E4RA 2Y7PA 4GXSB 4OXVA 3R7XA 3ILTB 3TEPA 3MUQA 1SW4A 2DOJA 2ZNTA 5KCJA 3VVEA 1A54A 1OIBA 3OO8A 4G68C 4F39A 3I5OA 3FXRA 4DCXA 5H8HB 4C1TA 4GIZA 2OBGA 1URSA 2F34A 3TZAA 4ELPA 4EXLA 3KFMA 2ZNUA 4QHQA 1UTBB 1ZLQA 1N7XA 1ATGA 2HQ0A 2XHDA 4QFOA 1N76A 4U23A 5F7VA 5FHOA 5AA1A 2Q9TA 1RYOA 3O29A 3SEUA 1A8EA 2XX8A 1P1WA 3DELB 1MXVA 1NKXA 4XIGQ 1KWHA 4F3GA
chains in the Genus database with same CATH superfamily
1XOCA 2RC9A 1SI0A 4KYDA 2QPQA 3N6TA 5BWJA 4RA1A 2Z8EA 5ET7A 4XKQA 3DRJA 4KI0E 4ESXA 3IFCA 3OSRA 4L17A 4R6HA 4JDFA 2ONSA 2QMWA 3V5AA 2H99A 1MRPA 3UIFA 2XXVA 5I84A 5DVJA 4GWWA 5JK4A 4KFQA 1FTLA 4OVRA 3TQLA 5ITOA 2B3BA 3O6HA 4OYVA 5L9SA 4BDLA 5TP9A 2UXAA 3TCHA 1EZ9A 1EZPA 4KXPA 3ROJA 4LVQA 1UTHA 3B6TA 1B7ZA 1Z7NE 2G93A 4P47A 4HW8A 1EZOA 1MY1A 3W9VA 3PUYE 1MDP1 4H8JA 3HCQA 3IOTA 1FPEA 5I56A 3MAMA 3FJMA 1R9QA 4N6DA 2ANJA 1NH7A 4FBPA 4ND9A 3T66A 3TTLA 1MXXA 3FJ7A 3FVOA 2D21A 2GH9A 3VLVA 3IX1A 3C32A 1MG1A 2DE4A 5I7IA 1GTKA 3SETA 1XT8A 2ALUA 3THIA 4QBAA 1CNQA 3S9LC 2FBPA 3JV9A 3KEIA 4PF6A 3LC8A 3TCFA 2THIA 3LR1A 4IO7A 1Y3QA 4MNPA 5EYGA 4O3CA 3PPRA 2P2AA 2VOZA 4MIJA 1LBXA 4G8HA 2QL3A 4HE1A 1MPBA 3MP6A 1B9JA 2AL4A 2Y84A 3DM0A 2Z8FA 4YKJA 2QJEA 2OK2A 1EYJA 2Y7WA 4R6KA 2XXIA 3BBRA 2FA7A 2DWJA 3MVYA 2VPOA 1Y1ZA 2OWTA 2VD3A 2FNCA 3OELA 2NWJA 4OVQA 2F35A 3K01A 1Q9DA 5JEIA 1MY2A 3PPQA 4LQ5A 1FW0A 1FQEA 1D3KA 1TT1A 1R6ZA 3KBZA 4IO2A 4QRZA 2M8CA 1MY3A 1QJMA 2QMXA 4ZEKA 2CEYA 2XXXA 4NMYA 4G4PA 5L9OA 4ZEFA 1TXFA 1RYXA 2PBWA 2ZZVA 2UYEA 2Q74A 1UQWA 2FYIA 3GBBA 5IZ3B 1H44A 5ESYA 4OQOA 3O97A 2BJJX 3EHSA 4MNCA 4EDPA 4YU0A 2Y7RA 4X9TA 2PFZA 4X48A 3MSTA 1BKAA 3VE1B 4KHZE 4PE3A 3FXUA 4G61A 2ZZXA 1XS5A 1PBPA 4KQPA 2Y5KA 5I57A 4YAHX 3UA8A 3H6VA 4TOZA 3UGWA 4H5GA 1NV5A 1P1QA 5I2NB 4N07A 1I6BA 4N8GA 1YZ0A 3DP4A 4KCCA 3MPLA 1SYIA 4H46A 3SKPA 1DOTA 2XXKA 4GX6A 1EU8A 4HE2A 2P1SA 2ZZWA 5CMMA 5LTCA 5I58B 2A5SA 3EHUA 2I4CA 4AQ4A 5H8NA 3U93A 5TPAB 2O7UA 1HSJA 3PUXE 2NVUB 1Y3NA 3IK6B 3PAMA 2VD2A 1ZKBA 4GRKA 2XA5A 3FXBA 5CI5A 5HPQA 3G3IA 3S9EA 1FTOA 3KN8A 4GF8A 2HXWA 1XI6A 2WBDA 4IB2A 1GV8A 4ONYA 1O7TA 2XXPA 3RLFE 4G68B 3BFTA 4IGRA 3O6PA 1GGGA 3EN3A 3TKDA 3CFXA 3IORA 1NUXA 2PT1A 4UACA 4RNSA 4OENA 2VHAA 1DSNA 4O3BA 3K6XA 2DXYA 2RC7A 2WYPA 2R6GE 3CFLA 1NNTA 3SEWA 2H25A 1OVBA 3RN8A 4RY1A 1LLSA 2UVJA 1F9BA 2HFBA 3WAEA 4AB5A 4ZECA 5CMCA 4LATA 1MXWA 2F7BA 1AL3A 3BKIB 1CB6A 3OSQA 2QS3A 4QXDA 3T96B 1OQGA 4MAGA 1MQIA 3FZVA 4OZ9A 4MMPA 3MVWA 3HPIA 2B4MA 2X7PA 4ELOA 1D9YA 4PP0A 2DWHA 4PDDA 1LGBC 2WOPA 2QRYA 4DCYA 4AS4A 4FE8A 2WBBA 1B3EA 1P1UA 4OWDA 1M5CA 1B0HA 4YMAA 1JETA 1SW1A 3E4RA 2ZNTA 1OIBA 3I5OA 4GIZA 3TZAA 4QHQA 1N7XA 2XHDA 5F7VA 3O29A 2XX8A 1NKXA 1KWHA 4U21A 4IO5A 5DVIA 1A8FA 4GWUA 5EHMA 2H9BA 4M1VA 3O6IA 1I69A 4C0RA 3K1MA 4H1XA 5TP9B 3TTRA 4OERA 1QUJA 5ET6A 2XWKA 3RGYA 3RYAA 3UN6A 4O7IA 5HM4B 4R74A 4DIGA 1XHYA 2HXRA 3RTFB 4IO3A 4MFIA 4PGPA 5CM6A 2I6EA 4OETA 2VGQA 3S9NC 3VXCA 3CG1A 4P1LA 1S7YA 1IQ7A 2XXHA 1FTAA 1B51A 1URGA 4ZEBA 2V3TA 4OVJA 1FBDA 4DI4B 4FEBA 2FIXA 4U4XA 3T0JA 1Q35A 4EQBA 2OLBA 2CMOA 4QFKA 3E13X 1VFEA 1AWBA 2P0SA 3AXFA 2I48A 4N17A 4PFUA 2RC8A 2V3QA 3QUJA 3PUWE 3B6QA 4Z0IA 3FVKA 3DRHA 3ONMA 3TMGA 5KZTA 3HN0A 2WYKA 4PAIA 2XXUA 1NL5A 1ZBMA 1YCJA 1S50A 1MM6A 3RPLB 2UVGA 1LAHE 1N3WA 4PCDA 1MQDA 1B7HA 4UABA 1TWYA 3GXAA 1D9VA 4MCOA 3A3UA 2BJIA 2XX7A 1FBHA 1BP5A 1FQFA 1FBCA 1P99A 4MBPA 1A55A 2F36A 4DXBA 1ZTYA 1PDAA 5I2NA 2A5TB 1MXYA 3S4UA 3PUVE 2HEUA 3S9MC 2NUVA 4WEDA 1YAEA 4ZZAA 4G77A 4RJZA 4BDMA 4NX1A 3PPNA 2XD3A 4R72A 1FPJA 1G0HA 4QFNA 4O3AA 3RY3A 2Q8MA 4NF8A 1QKBA 3FBPA 1FBPA 3FD3A 4DE8A 1XC1A 3MPKA 4IY5A 1US4A 5FHNA 2HAUA 3FXQA 1LAFE 1NNKA 5AA2A 2V93A 3CVGA 1MY4A 2CZLA 2ZXTA 3GYYA 4JBZA 3PGFA 4MEVA 5CBRA 4PFTA 4X04A 3BIHA 1DTZA 4ISUA 3Q28A 1ZJLA 2O6AA 4NF5B 4I62A 3H7MA 3L6HA 5DVFA 2DVZA 1QUIA 1B5IA 2AIXA 2F6GA 2PCRA 3QIMA 3OOAA 3TQWA 5I58A 4POWA 3D1RA 4P8BA 3HHGA 4BDOA 4AB6A 2OCUA 3TFLA 1FJ9A 5I3SA 3HHFA 4PETA 2GHAA 1LSTA 2KLFA 2O69A 4EQ9A 5KCJB 4U22A 2FHYA 5EQ7A 5K2XA 4EUOA 3V83A 4LQ2A 4JWOA 1TFDA 3SEVA 2DS9A 4GWOA 2ESNA 3R26A 4PFYA 2E0SA 2Y7IA 5ITPA 2WOLA 3OENA 3TODA 1M5BA 2V4CA 3IJOB 3D4CA 1ELJA 2QSXA 2YPNA 3LUZA 1UIUA 2DDKA 4HS7A 1BLFA 1NV2A 1FQAA 4MH5A 4OFLA 1IITA 1PB8A 5I59B 4GBVA 3USDA 4H67A 3HFUA 2ABHA 4NG7A 4MX6A 5H8QA 3KC0A 3PPOA 2RCAA 1N84A 3OEMA 1LFHA 1K9ZA 1MQJA 1NV6A 5CRYA 2O7IA 3RYBA 4OTEA 1LB8A 1RDZA 5ELVA 1MH3A 3KN3A 3ECRA 4GLIA 1B1HA 4XXUA 3GBAA 4HE0A 4U1ZA 2UVIA 3KJ7A 4DI3D 1KA0A 4NF5A 3H06B 2I4BA 1IXIA 5CBSA 2PT2A 2PFYA 3TTKA 4IY6A 1US5A 2ONKE 2XWVA 2ZNSA 3K00A 1LFGA 3PPPA 3M3LA 3KBRA 4XKPA 3OXNA 2DXRA 2VT5A 1JVXA 1QUKA 4ZS9A 4H6DA 3CSBA 1NFTA 3G3GA 5LDZA 1DTGA 1H76A 2RINA 2B65A 1LBWA 1HSLA 3C33A 1M5DA 3QMFA 4F19A 3OO6A 4XKRA 2XXTA 4NQ8A 4O8MA 4NF4A 3CG3A 4ELRA 1I6QA 1YYZA 3B50A 4R9FA 1LEVA 3IR1A 3H6WA 1B2HA 1OQHA 2HZKA 4Q0CA 5J1DA 2CZKA 4OHNA 1D9QA 1B58A 3QK6A 4NEDA 4FECA 4P9KA 5IGAA 3LSXA 1RKMA 2QVVA 4YZZA 1LBCA 1UTHB 3LSWA 3W15C 5I2KA 1DCUA 2WOKA 4IGTA 1FPDA 2HAVA 4BDQA 3DP8A 3MVZA 5KDTB 4POXA 4FATA 4P1EA 5K2YA 3U65A 5AA3A 1ANFA 4RK2A 3FTOA 1MH4A 3OO9A 5LOMA 3R6UA 4YKPA 3FUZA 3RQTA 5DTBA 4NWCA 2UYFA 3A3CA 3R7XA 4GXSB 3ILTB 1SW4A 1A54A 3OO8A 4F39A 5H8HB 2OBGA 3KFMA 1ZLQA 1ATGA 1T0KA 3SEUA 3DELB 1MXVA 2OZZA 1IMDA 1B3GA 4WEPA 1B0LA 2XWOA 4MLQA 1B7UA 4QFPA 5H8HA 1NNFA 3L6GA 2XWIA 3TAJA 4F1UA 2V25A 3QXMA 3RUMA 1VDWA 3TTMA 3N6UA 3U72A 3EHTA 1II5A 4GBWA 4THIA 5AA4A 1FPIA 4JSOA 4N6PA 1FCKA 2I49A 3G7WA 4FJPA 3VV5A 4PC9A 1MY0A 2Q2CA 1L5TA 1LFIA 1MPCA 2F5XA 3PUZE 2PVUA 1AOVA 3O6GA 3QUFA 1UTBA 1B3LA 4IO6A 3VFJA 3VXBA 1N3XA 4QFLA 4GL0A 1NUYA 2REGA 1JW5A 3E9XA 2F3DA 3M3FA 3Q27A 3U94A 4OEUA 2I0CA 4Q5TA 1MQGA 2D3IA 1FTMA 5HBCA 5I56B 2X26A 1N7WA 2DP8A 1FQDA 4X1BA 3PD9A 4GWZA 4GVOA 3A29A 4X8RA 1MM7A 1B1XA 3IOUA 3H4ZA 2I3WA 3KSXA 2O1LA 2ZYKA 4JVIA 3PD8A 4LUBA 2NOOA 2JJKA 1R9LA 4MJOA 1SPIA 2YLNA 4NTLA 4DXCA 5L8DA 3EPEA 3V8XB 2P3NA 3CHGA 3KC1A 5DYHA 1FSAA 5EYHA 4N13A 1MXZA 3E79A 5EYFA 2VP1A 4NN3A 1FPKA 4PBQA 2DWIA 4N91A 3UK4A 1A40A 3C31A 3VDFA 1NV7A 3MC2A 2F8DA 3EQ1A 2F78A 4QSDA 5ICTA 2XX9A 3MZBA 1H45A 3H3GA 4ZZEA 1FPBA 5IKBA 4U2RA 4KR5A 1WVJA 5JTYA 4ZE9A 4RPNA 1PBQA 4PAKA 4XTCQ 4G2ZA 2HHMA 2Y5LA 3TUSA 2ZMBA 3PU5A 4H0WA 1EYKA 3KGCA 3KSJA 5FTIA 1DK4A 4F3PA 1FBGA 1NV0A 3MW0A 4KYSA 3PMWA 1NMUA 3SZPA 2I3VA 1QGXA 1ZIUA 3DRIA 1MS7A 3C34A 4IO4A 4HCYA 1O64A 4ECFA 1NUWA 4FAJA 1FQBA 2AYSA 2QS4A 3LUYA 1M5FA 4QSEA 4P0IA 1D4NA 1LAXA 2F7CA 1ZU0A 5I57B 3FGSA 1MPDA 1Y1MA 2DWAA 3SESA 1NUZA 2Z8DA 1AH5A 1B40A 2Q88A 3MZ9A 1SW2A 2REJA 4JVCA 3RTWB 1QVSA 3KOSA 4KD5A 4MHFA 3K0VA 2DVCA 4GX4A 4N15A 3G3FA 5L9MA 1MXUA 3IB2A 3ZS6A 2FIEA 4EF2A 2OX3A 5F1QA 2E1SA 3LVUA 3VVDA 3RT6B 4FIMA 2WX9A 3MYUA 5H8QB 4NF6A 2O68A 5KDTA 4LZ7A 3MP1A 5TU0A 4U4SA 1JW4A 5TPAA 4YKKA 4XEQA 4I3EA 4NGUA 3TELA 3C36A 1B3FA 2F7AA 4Z7EA 5A5LA 3KZGA 1LBZA 1XVXA 1OLAA 4PQJA 4Q30B 1B6HA 4LONB 4HTGA 3S2VA 1USYH 2R71A 2IA4A 4PE5B 4YB6A 3TDJA 1Y9UA 5ISUA 2DYXA 2H4IA 3GLBA 3MQ9A 5B7DA 1LB9A 4M4GA 4OVTA 4GWXA 5BUUA 5ET8A 3U92A 2XD2A 1OLCA 1SW5A 3H03A 4LA9A 1B4HA 3C4MA 5IZ3A 2HPGA 1A7LA 1SQYA 4PDHA 4E0WA 1VE4A 1Y20A 1KA1A 4BDNA 4YMBA 1NI9A 4F3SA 4F18A 1JVYA 1MDQA 1SVXB 3BIGA 3E3KA 4I1DA 3P7IA 4MLVA 2R9JA 4F1VA 3H6TA 2DE2A 4RXLA 1GR2A 3G3HA 2I0BA 3KG2A 2F6PA 4KCDA 4OEVA 1IZ1A 1USYE 4XFEA 1LBVA 1WODA 3PV0E 3KN7A 4NAPA 4XKNA 4PF8A 3MZ1A 2CZHA 3IB1A 5H8FB 1WDNA 4OFOA 4IR8A 3VLWA 2VPNA 3IOWA 4WXJA 4I8CA 1GVCA 1KZ8A 3PMXA 5DEXA 2V3UA 4MF3A 4RPOA 5AA4B 4GD5A 4DZ1A 3T22A 3Q26A 4N81A 3DRFA 3LSFB 3V89B 4C1UA 1Y3PA 4GXAA 2Z22A 3K2DA 3N5LA 5ET5A 3T1BA 3C35A 4PAFA 3U8QA 4PFWA 5IZ1A 4LZ8A 2XXQA 3K1PA 3IAZA 1FPFA 3I3VA 1NV4A 3UP9A 2F3BA 3PMVA 3RPLA 1SI1A 4OMBA 1IXHA 1IMFA 1JNFA 4ESWA 1JQFA 4R9GA 4BLAA 3KJTA 3SDFA 4DLDA 2OWSA 3HV1A 1YTVA 4G8NA 1HSEA 2LAOA 4F31B 1I6AA 3ZKKA 2KQZA 3MWBA 5FBPA 3MUQA 2DOJA 5KCJA 3FXRA 4DCXA 4EXLA 2F34A 4ELPA 1IMEA 2QFLA 5AA1A 1N76A 4U23A 1P1WA 4XIGQ 1N04A 4GWYA 1B46A 1H3DA 3FVNA 5J16A 2R8TA 3CRBA 3IOVA 1UIVA 2X7QA 2QS2A 4G8MA 3QSLA 4X1DA 3TTNA 2XXRA 2A5TA 3CR9A 1B5HA 3ZKLA 1NNPA 2PX1A 5DEXB 4LN5A 1RDYA 2O1MA 2AL5A 2P3VA 3H6UA 2RKMA 5EHSA 5CMKA 3GZGA 3G3KA 5F24A 5JTYB 1POTA 4KYEA 3EKIA 4NF8B 2XXWA 1AMFA 3DP6A 1BIYA 3VLUA 1CE2A 2H98A 3WAFA 4YKIA 1VR5A 3ILUB 4WKMA 2WEFA 1JEVA 3A09A 3FV1A 3K1NA 3LBSA 1J1NA 4FORA 1ZMGA 3K02A 4P3LA 1DBZA 1TFAA 3EF7A 1B05A 4ELQA 1LBYA 4JB7A 3JZJA 4MNIA 5FHMA 5B70A 1INPA 2PMSA 1RDXA 1B32A 4H45A 5I2KB 2QS1A 3B6WA 1URDA 3ODBA 4PGNA 4P11A 4EQ7A 1MQHA 4FEDA 3CSGA 2XXYA 4DXUA 1QW0A 4JXIA 1P1NA 3ZSFA 1LCFA 1JW1A 4TLMB 1EH3A 1B52A 3SEYA 3I6VA 3G3JA 3O66A 4TQUQ 1DMBA 4PFRA 4QF9A 1LAGE 4ZEDA 4Q8RA 1FBFA 1IMCA 5EQ8A 3U1OA 4GOTA 3K4UA 5H8NB 4LP2B 2HZLA 3MJNA 1H43A 2GHBA 3RT8A 4OFJA 1LBBA 3Q29A 4NF4B 4LZ5A 5H8FA 4GX3A 5AE4A 3IO4A 4N6KA 2GRVA 2O84X 1DPPA 1Q1KA 3B7DA 4OVPA 2RCBA 1PC3A 1FTJA 4F22A 1PB9A 5CMBA 2OWZA 1A99A 3IO6A 5FTHA 1P1OA 2CZIA 4K3FA 3OEKA 2ZYOA 2QVUA 4U1OA 1B4ZA 4OESA 4GFRA 1EYIA 1SD3A 2L5VA 3K6VA 1FTKA 1Z7ME 1IXGA 3D4GA 1BTJA 4NHBA 3LV0A 3RYDA 4PTKA 2QVRA 3IL1B 4QSCA 4ZDMA 3MVXA 1OMPA 4UA8A 3QYTA 3KOTA 4PFIA 4NF6B 1AIVA 1PB7A 1FQCA 2Y7KA 4PFBA 3DRKA 2F97A 3E78A 3TCGA 4G68A 4N4UA 1IMBA 3JYRA 3T9HB 4JWXA 3IJXB 3B8BA 1XVYA 2GFEA 4PBHA 4F2QA 3SEXA 4GWSA 2FVZA 3Q25A 1B5JA 1IEJA 1PEBA 3HSTA 5ICQA 4F2OA 4O7MA 2Q2AA 3TYHA 3MP8A 3O9PA 4JSDA 4DDDA 4BDRA 3SERA 4F3BA 3RNNA 2Q89A 4O94A 4YB7A 1NH8A 1IMAA 2IEEA 3T9XB 2DQVA 2NXOA 5A5XA 1R1NA 5IM2A 1JEUA 3NOHA 3C9HA 5IAIA 1YPNA 1VFDA 5I59A 3TPAA 4NF0A 3DLNA 2UVHA 5AA2D 4R75A 1BK4A 3M8UA 3M3KA 5EQ9A 4OVSA 3F11A 4ZE8A 2W7YA 3N26A 4OANA 2D5WA 3OMBA 2B3FA 2G29A 2DSFA 5IZZA 3T93B 4NE4A 4TLLB 2RF1A 2V84A 2Z23A 3UORA 1DPEA 1K9YA 3RPWA 1VSOA 2B4LA 3OD7A 1QULA 2PYYA 4H8IA 1NV3A 4E0XA 3FATA 3FVGA 4N8YA 3OO7A 4R73A 4XF5A 3IB0A 4H5FA 1SYHA 2Q8JA 4RYAA 1SDXA 4P0GA 3LSLA 3W9WA 3FASA 1O63A 1QKAA 3CI8A 1G0IA 4ZEIA 4JVDA 5DT6A 4EF1A 2YJPA 3BFUA 2DE3A 5A5XB 3MBPA 1S9TA 1OVTA 4I40A 1IXCA 3FV2A 3IFAA 1YXIA 3O28A 3CFZA 1FPLA 5AA2B 5H8SA 5DW8A 2ZYMA 1Y4CA 4F29A 4NWDA 2O51A 1NV1A 1N0TA 1IIWA 1POY1 2ZYNA 3T9VA 3HO7A 4EXKA 3ISPA 1FJ6A 3K6WA 3FJGA 3T9UA 3CIJA 4I9DA 4OA4A 3FIRA 4P56A 5CC2A 4HXVA 4GQOA 2HCAA 1FPGA 2OJTA 1B3HA 4R2FA 4JWYA 2MKZA 4I3YA 1SBPA 3DRGA 4GL8A 3N94A 1M5EA 3QAXA 1IUDA 4AS5A 4RK9A 4KPTA 2WKYA 4HCWA 1LCTA 5I5PA 3O2AA 4R6YA 4H65A 2GQ1A 4YB5A 4R2BA 3VVFA 4F1YA 1FRPA 4YICA 2KR0A 3PTYA 5M2VA 2H5YA 2ONRA 2I58A 3K6UA 1FBEA 4OXVA 2Y7PA 3TEPA 5T3JA 3VVEA 4G68C 1JP4A 4C1TA 1URSA 2CEXA 2ZNUA 1UTBB 2HQ0A 4QFOA 5FHOA 2Q9TA 1RYOA 1A8EA 5EQAA 1Y4TA 4F3GA
chains in the Genus database with same CATH topology
2OZZA 1N04A 1XOCA 1B3GA 2RC9A 1B46A 1B0LA 1SI0A 1H3DA 3FVNA 4IO5A 4U21A 4WEPA 4KYDA 5DVIA 2QPQA 3N6TA 5BWJA 4RA1A 1A8FA 4MLQA 3CRBA 1B7UA 2Z8EA 3IOVA 4XKQA 2H9BA 5EHMA 1UIVA 3DRJA 4KI0E 4M1VA 4QFPA 5H8HA 4ESXA 2X7QA 3O6IA 1NNFA 2QS2A 3L6GA 4G8MA 3TAJA 1I69A 3QSLA 4F1UA 3OSRA 4X1DA 4L17A 2V25A 4C0RA 3K1MA 3QXMA 4JDFA 4R6HA 4H1XA 2XXRA 2A5TA 3CR9A 5TP9B 3RUMA 3TTNA 3TTMA 3TTRA 1B5HA 3N6UA 3ZKLA 3U72A 1NNPA 2PX1A 4OERA 3EHTA 1II5A 4THIA 5AA4A 1QUJA 2ONSA 5DEXB 2QMWA 4JSOA 3V5AA 4N6PA 3RGYA 2H99A 1FCKA 2O1MA 1MRPA 2I49A 3G7WA 4FJPA 3UIFA 3RYAA 2AL5A 3VV5A 2XXVA 3H6UA 3UN6A 5DVJA 5I84A 5JK4A 2RKMA 5HM4B 1MY0A 4R74A 2Q2CA 5EHSA 4DIGA 1L5TA 5CMKA 3GZGA 4KFQA 1XHYA 1FTLA 3RTFB 4IO3A 3G3KA 4MFIA 1LFIA 5CM6A 1MPCA 3TQLA 2F5XA 4OETA 2I6EA 5ITOA 1POTA 5JTYB 2VGQA 3PUZE 2PVUA 3S9NC 1AOVA 2B3BA 3O6HA 3O6GA 4KYEA 3QUFA 4OYVA 3VXCA 5L9SA 3CG1A 4BDLA 5TP9A 2UXAA 3TCHA 2XXWA 1UTBA 4NF8B 1AMFA 1B3LA 1EZ9A 4IO6A 5AE4A 3VFJA 1EZPA 3DP6A 3VXBA 1N3XA 1BIYA 3VLUA 4QFLA 1CE2A 1S7YA 1UTHA 4GL0A 4LVQA 1IQ7A 2H98A 2XXHA 3WAFA 1B51A 3B6TA 1URGA 1B7ZA 1Z7NE 4ZEBA 2REGA 2V3TA 4OVJA 1JW5A 2G93A 4YKIA 3E9XA 1VR5A 3ILUB 3M3FA 3Q27A 4FEBA 4OEUA 2I0CA 4Q5TA 4U4XA 1JEVA 4WKMA 3U94A 4HW8A 1Q35A 1MQGA 3A09A 3FV1A 3K1NA 3LBSA 1EZOA 1J1NA 2D3IA 2OLBA 2CMOA 4EQBA 1MY1A 1FTMA 3W9VA 4QFKA 5HBCA 3E13X 1MDP1 2X26A 3PUYE 4FORA 5I56B 1N7WA 1VFEA 1ZMGA 2DP8A 4H8JA 1FQDA 4X1BA 3HCQA 3PD9A 3K02A 3IOTA 4GVOA 2P0SA 3AXFA 2I48A 5I56A 1MM7A 4PFUA 1B1XA 1TFAA 2RC8A 3EF7A 3FJMA 1B05A 1R9QA 2ANJA 1NH7A 2V3QA 3QUJA 3H4ZA 4JB7A 4ND9A 4ELQA 3JZJA 2I3WA 3KSXA 2O1LA 2ZYKA 5FHMA 5B70A 3T66A 2PMSA 1MXXA 3FJ7A 3B6QA 3FVOA 3PD8A 3PUWE 4LUBA 2D21A 2NOOA 4Z0IA 2GH9A 3FVKA 3VLVA 3IX1A 3C32A 1B32A 5I2KB 3DRHA 1R9LA 1MG1A 2QS1A 3B6WA 3ONMA 2DE4A 1URDA 2YLNA 5KZTA 3TMGA 3HN0A 4NTLA 1GTKA 4DXCA 3SETA 3ODBA 1XT8A 5L8DA 2ALUA 2XXUA 3EPEA 3THIA 4P11A 1NL5A 1ZBMA 1YCJA 3V8XB 4EQ7A 3S9LC 3JV9A 3CHGA 1MQHA 1S50A 3CSGA 1MM6A 2XXYA 3KEIA 4FEDA 5DYHA 3LC8A 2UVGA 4DXUA 1QW0A 4JXIA 3TCFA 1P1NA 4N13A 1LAHE 3ZSFA 1N3WA 2THIA 1MXZA 3LR1A 1MQDA 4IO7A 5EYFA 1Y3QA 2VP1A 1LCFA 1JW1A 1B7HA 4O3CA 4TLMB 1TWYA 3GXAA 3PPRA 1EH3A 1D9VA 2DWIA 2P2AA 3A3UA 3UK4A 1A40A 2VOZA 3C31A 1B52A 3VDFA 2XX7A 3SEYA 4G8HA 3MC2A 2F8DA 2QL3A 3I6VA 1BP5A 3EQ1A 1FQFA 1MPBA 1P99A 3G3JA 3O66A 4MBPA 4TQUQ 3MP6A 2F78A 1A55A 2F36A 4QSDA 1DMBA 4DXBA 1ZTYA 1PDAA 4QF9A 5I2NA 1B9JA 2A5TB 2AL4A 2Y84A 5ICTA 1MXYA 2XX9A 3DM0A 1LAGE 3S4UA 4ZEDA 4Q8RA 3MZBA 1H45A 3PUVE 2HEUA 3S9MC 2Z8FA 3U1OA 2NUVA 4WEDA 1YAEA 3H3GA 4GOTA 4ZZEA 3K4UA 4ZZAA 5H8NB 4G77A 4LP2B 2HZLA 2QJEA 4RJZA 3MJNA 2OK2A 3PPNA 2XD3A 4YKJA 4R72A 4O3AA 4QFNA 3RY3A 1H43A 2GHBA 4NF8A 3RT8A 1QKBA 5IKBA 4U2RA 4OFJA 2Y7WA 1LBBA 3FD3A 4R6KA 2XXIA 3BBRA 4KR5A 4DE8A 1XC1A 2FA7A 3MPKA 3Q29A 1US4A 1WVJA 4IY5A 4LZ5A 2DWJA 4ZE9A 2HAUA 3FXQA 5FHNA 4RPNA 1PBQA 3MVYA 1LAFE 1NNKA 1Y1ZA 5AA2A 2V93A 3CVGA 2OWTA 1MY4A 2CZLA 2VD3A 2ZXTA 3IO4A 2FNCA 2GRVA 4G2ZA 4XTCQ 4BDMA 2O84X 1DPPA 3IOUA 4JBZA 1Q1KA 3B7DA 3PGFA 2ZMBA 3TUSA 3PU5A 2RCBA 3OELA 1PC3A 1Y4TA 2NWJA 5CBRA 4PFTA 2F35A 4H0WA 3K01A 1FTJA 4F22A 5JEIA 3KGCA 1MY2A 3PPQA 4LQ5A 3KSJA 5FTIA 1FW0A 4F3PA 1PB9A 5CMBA 1DTZA 5JTYA 1FQEA 4ISUA 1A99A 3IO6A 3MW0A 1D3KA 4KYSA 3PMWA 3Q28A 1ZJLA 1TT1A 2O6AA 5FTHA 1NMUA 1P1OA 1R6ZA 4K3FA 3OEKA 2I3VA 4NF5B 2ZYOA 4I62A 3H7MA 3L6HA 5DVFA 2DVZA 1ZIUA 4U1OA 3DRIA 4IO2A 4QRZA 1MS7A 1B4ZA 1QUIA 2M8CA 1MY3A 3C34A 4IO4A 1B5IA 4OESA 4HCYA 2AIXA 4GFRA 1O64A 4ECFA 1QJMA 5I58A 2F6GA 1SD3A 4FAJA 1FQBA 2AYSA 2QMXA 3K6VA 3QIMA 3OOAA 3TQWA 1FTKA 1Z7ME 2QS4A 3LUYA 1M5FA 4POWA 1IXGA 3D4GA 1BTJA 3HHGA 4P0IA 4ZEKA 4QSEA 4BDOA 2XXXA 1D4NA 1LAXA 2F7CA 4AB6A 2OCUA 3IL1B 4QSCA 4NMYA 3TFLA 4ZDMA 1ZU0A 3MVXA 4G4PA 5L9OA 5I57B 1OMPA 4ZEFA 1TXFA 4UA8A 3FGSA 1MPDA 1Y1MA 2DWAA 3SESA 2Z8DA 3QYTA 1RYXA 1AH5A 1B40A 2PBWA 2Q88A 3KOTA 3HHFA 3MZ9A 1SW2A 2UYEA 4PETA 4NF6B 1AIVA 2REJA 3RTWB 2GHAA 1LSTA 1UQWA 1PB7A 1QVSA 2FYIA 2KLFA 2O69A 3GBBA 3KOSA 4KD5A 4EQ9A 5KCJB 1H44A 1FQCA 2Y7KA 4OQOA 3DRKA 3K0VA 2F97A 2DVCA 3O97A 3TCGA 4G68A 4U22A 3JYRA 2BJJX 3T9HB 5K2XA 3G3FA 3EHSA 5L9MA 1MXUA 4EDPA 3IB2A 4EUOA 4JWXA 3ZS6A 3IJXB 3V83A 4LQ2A 4JWOA 1XVYA 4YU0A 1TFDA 2Y7RA 2GFEA 4X9TA 4EF2A 5F1QA 2E1SA 4F2QA 3SEXA 3LVUA 3VVDA 3RT6B 3SEVA 2DS9A 4GWOA 2ESNA 3Q25A 3R26A 4X48A 1B5JA 1IEJA 1PEBA 4FIMA 3HSTA 4PFYA 1BKAA 5ICQA 2E0SA 2Y7IA 4KHZE 3VE1B 4F2OA 5H8QB 5ITPA 2WOLA 2Q2AA 4NF6A 2O68A 3TYHA 5KDTA 3FXUA 3OENA 3MP8A 3O9PA 4LZ7A 3TODA 3MP1A 1M5BA 5TU0A 4JSDA 3IJOB 4DDDA 1XS5A 1PBPA 4BDRA 3D4CA 1ELJA 3SERA 4KQPA 4F3BA 5I57A 4U4SA 1JW4A 2QSXA 3RNNA 4YAHX 5TPAA 2Q89A 2YPNA 4YB7A 1NH8A 4YKKA 1UIUA 3UA8A 3H6VA 2IEEA 3T9XB 2DQVA 4TOZA 3TELA 2NXOA 5A5XA 4HS7A 3UGWA 1BLFA 1FQAA 1R1NA 1JEUA 3C9HA 3C36A 1B3FA 5IAIA 1YPNA 1VFDA 2F7AA 4MH5A 4Z7EA 4OFLA 5I59A 3TPAA 3DLNA 2UVHA 5AA2D 4R75A 1IITA 1PB8A 4H5GA 3M8UA 3KZGA 3M3KA 5I59B 1XVXA 1P1QA 3F11A 1OLAA 4PQJA 4ZE8A 4Q30B 2W7YA 1B6HA 4LONB 4HTGA 5I2NB 3S2VA 4H67A 1USYH 2R71A 3N26A 3USDA 4N07A 1I6BA 2IA4A 2ABHA 4PE5B 2D5WA 3OMBA 5H8QA 2B3FA 3DP4A 2G29A 2DSFA 3MPLA 4KCCA 3T93B 4YB6A 3PPOA 2RCAA 3TDJA 4NE4A 1N84A 1Y9UA 4TLLB 1SYIA 2RF1A 5ISUA 3OEMA 1LFHA 2DYXA 2H4IA 2V84A 1MQJA 2Z23A 3UORA 1DPEA 3GLBA 5CRYA 3RPWA 3SKPA 2O7IA 1DOTA 3MQ9A 3RYBA 1VSOA 2B4LA 3OD7A 4OTEA 5B7DA 1LB9A 1LB8A 1QULA 1EU8A 2PYYA 4M4GA 4H8IA 2P1SA 5ELVA 5BUUA 1MH3A 5CMMA 5H8FA 3U92A 3KN3A 5I58B 2XD2A 1OLCA 3ECRA 2A5SA 4GLIA 3EHUA 1B1HA 1SW5A 4XXUA 3MAMA 3H03A 2I4CA 3GBAA 4U1ZA 4LA9A 4E0XA 1B4HA 3FATA 4AQ4A 2UVIA 3C4MA 5H8NA 3KJ7A 3U93A 3FVGA 5TPAB 1A7LA 4NF5A 3H06B 3OO7A 1SQYA 4R73A 4E0WA 2O7UA 1VE4A 1Y20A 2I4BA 1HSJA 1IXIA 3PUXE 5CBSA 2NVUB 2PT2A 3IB0A 4H5FA 4BDNA 4YMBA 4F3SA 4F18A 3TTKA 1Y3NA 1JVYA 1SYHA 1MDQA 1US5A 3IK6B 3PAMA 4IY6A 2Q8JA 2ONKE 1ZKBA 2VD2A 1SVXB 1SDXA 4GRKA 2ZNSA 4RYAA 5CI5A 3K00A 3E3KA 1LFGA 5HPQA 3PPPA 3G3IA 4I1DA 4P0GA 3S9EA 3P7IA 4MLVA 1FTOA 3KN8A 2R9JA 3LSLA 3KBRA 3M3LA 4GF8A 4XKPA 2HXWA 3OXNA 3W9WA 3FASA 1T0KA 1O63A 1QKAA 4F1VA 2DXRA 4IB2A 3CI8A 3H6TA 1JVXA 1QUKA 4ZEIA 4H6DA 4ZS9A 1GV8A 4ONYA 3CSBA 1O7TA 2DE2A 4RXLA 1GR2A 5DT6A 3G3HA 2XXPA 3RLFE 1NFTA 2I0BA 2YJPA 3KG2A 4G68B 3G3GA 4EF1A 3BFUA 2DE3A 3BFTA 4IGRA 3O6PA 5A5XB 3MBPA 1GGGA 2F6PA 4OEVA 1DTGA 1H76A 1S9TA 1IZ1A 1USYE 3EN3A 4KCDA 3TKDA 1OVTA 2RINA 3CFXA 1WODA 3PV0E 3KN7A 4NF4B 1IXCA 3IORA 2B65A 4XKNA 3FV2A 5H8FB 1HSLA 3O28A 3CFZA 2PT1A 3C33A 1M5DA 4UACA 4RNSA 3MZ1A 2VHAA 4OENA 4F19A 5H8SA 5AA2B 3OO6A 1DSNA 4XKRA 2XXTA 2ZYMA 3IB1A 4O3BA 3K6XA 1Y4CA 4F29A 4NWDA 2DXYA 2O51A 1WDNA 2RC7A 4OFOA 3CG3A 4NF4A 1I6QA 1N0TA 4ELRA 1IIWA 1POY1 2R6GE 2ZYNA 1NNTA 3CFLA 4R9FA 3T9VA 3VLWA 3SEWA 2H25A 3IR1A 3H6WA 3HO7A 1B2HA 1OQHA 3IOWA 1OVBA 2HZKA 3RN8A 4WXJA 4RY1A 4EXKA 4I8CA 4Q0CA 1GVCA 1LLSA 2UVJA 5J1DA 3PMXA 4OHNA 2V3UA 4MF3A 4RPOA 1B58A 1F9BA 3K6WA 2HFBA 3FJGA 5DEXA 3CIJA 3QK6A 4GD5A 4I9DA 3T9UA 3WAEA 4AB5A 5AA4B 4DZ1A 4ZECA 4NEDA 4FECA 3T22A 5CMCA 3Q26A 1MXWA 3FIRA 4LATA 5CC2A 2F7BA 1AL3A 3DRFA 3LSXA 1RKMA 2HCAA 3BKIB 3LSFB 4GQOA 4YZZA 1LBCA 2OJTA 3V89B 1B3HA 4R2FA 4JWYA 4C1UA 1Y3PA 4GXAA 1UTHB 2Z22A 3LSWA 3K2DA 3N5LA 1CB6A 3OSQA 3C35A 3TTLA 1SBPA 2QS3A 3W15C 5I2KA 3U8QA 3DRGA 4GL8A 4PFWA 3T96B 2WOKA 1OQGA 3N94A 4IGTA 1M5EA 1MQIA 2HAVA 2XXQA 3FZVA 3K1PA 3MVWA 3DP8A 3HPIA 3IAZA 4LZ8A 4OZ9A 3QAXA 4BDQA 2B4MA 1IUDA 3I3VA 4RK9A 4KPTA 2X7PA 3MVZA 5KDTB 2WKYA 1D9YA 4ELOA 4PP0A 4HCWA 2DWHA 3UP9A 1LGBC 4POXA 3PMVA 1LCTA 2WOPA 4FATA 1SI1A 3O2AA 4OMBA 2QRYA 4DCYA 5K2YA 4R6YA 1IXHA 4H65A 4YB5A 1JNFA 4ESWA 1JQFA 4FE8A 4R2BA 3VVFA 4R9GA 4F1YA 5AA3A 1ANFA 4RK2A 3FTOA 1MH4A 1B3EA 3OO9A 3KJTA 4YICA 3R6UA 3SDFA 4BLAA 4DLDA 5M2VA 5LOMA 2H5YA 2OWSA 1P1UA 3FUZA 3RQTA 3HV1A 4OWDA 4YKPA 2ONRA 1YTVA 1M5CA 4NWCA 5DTBA 2I58A 4G8NA 3K6UA 2UYFA 1B0HA 1HSEA 3A3CA 4YMAA 2LAOA 4F31B 1JETA 1I6AA 3ZKKA 3MWBA 1SW1A 3E4RA 2Y7PA 4GXSB 4OXVA 3R7XA 3ILTB 3TEPA 3MUQA 1SW4A 2DOJA 2ZNTA 5KCJA 3VVEA 1A54A 1OIBA 3OO8A 4G68C 4F39A 3I5OA 3FXRA 4DCXA 5H8HB 4C1TA 4GIZA 2OBGA 1URSA 2F34A 3TZAA 4ELPA 4EXLA 3KFMA 2ZNUA 4QHQA 1UTBB 1ZLQA 1N7XA 1ATGA 2HQ0A 2XHDA 4QFOA 1N76A 4U23A 5F7VA 5FHOA 5AA1A 2Q9TA 1RYOA 3O29A 3SEUA 1A8EA 2XX8A 1P1WA 3DELB 1MXVA 1NKXA 4XIGQ 1KWHA 4F3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZZ A;  1N04 A;  1XOC A;  1B3G A;  2RC9 A;  1B46 A;  1B0L A;  1SI0 A;  1H3D A;  3FVN A;  4IO5 A;  4U21 A;  4WEP A;  4KYD A;  5DVI A;  2QPQ A;  3N6T A;  5BWJ A;  4RA1 A;  1A8F A;  4MLQ A;  3CRB A;  1B7U A;  2Z8E A;  3IOV A;  4XKQ A;  2H9B A;  5EHM A;  1UIV A;  3DRJ A;  4KI0 E;  4M1V A;  4QFP A;  5H8H A;  4ESX A;  2X7Q A;  3O6I A;  1NNF A;  2QS2 A;  3L6G A;  4G8M A;  3TAJ A;  1I69 A;  3QSL A;  4F1U A;  3OSR A;  4X1D A;  4L17 A;  2V25 A;  4C0R A;  3K1M A;  3QXM A;  4JDF A;  4R6H A;  4H1X A;  2XXR A;  2A5T A;  3CR9 A;  5TP9 B;  3RUM A;  3TTN A;  3TTM A;  3TTR A;  1B5H A;  3N6U A;  3ZKL A;  3U72 A;  1NNP A;  2PX1 A;  4OER A;  3EHT A;  1II5 A;  4THI A;  5AA4 A;  1QUJ A;  2ONS A;  5DEX B;  2QMW A;  4JSO A;  3V5A A;  4N6P A;  3RGY A;  2H99 A;  1FCK A;  2O1M A;  1MRP A;  2I49 A;  3G7W A;  4FJP A;  3UIF A;  3RYA A;  2AL5 A;  3VV5 A;  2XXV A;  3H6U A;  3UN6 A;  5DVJ A;  5I84 A;  5JK4 A;  2RKM A;  5HM4 B;  1MY0 A;  4R74 A;  2Q2C A;  5EHS A;  4DIG A;  1L5T A;  5CMK A;  3GZG A;  4KFQ A;  1XHY A;  1FTL A;  3RTF B;  4IO3 A;  3G3K A;  4MFI A;  1LFI A;  5CM6 A;  1MPC A;  3TQL A;  2F5X A;  4OET A;  2I6E A;  5ITO A;  1POT A;  5JTY B;  2VGQ A;  3PUZ E;  2PVU A;  3S9N C;  1AOV A;  2B3B A;  3O6H A;  3O6G A;  4KYE A;  3QUF A;  4OYV A;  3VXC A;  5L9S A;  3CG1 A;  4BDL A;  5TP9 A;  2UXA A;  3TCH A;  2XXW A;  1UTB A;  4NF8 B;  1AMF A;  1B3L A;  1EZ9 A;  4IO6 A;  5AE4 A;  3VFJ A;  1EZP A;  3DP6 A;  3VXB A;  1N3X A;  1BIY A;  3VLU A;  4QFL A;  1CE2 A;  1S7Y A;  1UTH A;  4GL0 A;  4LVQ A;  1IQ7 A;  2H98 A;  2XXH A;  3WAF A;  1B51 A;  3B6T A;  1URG A;  1B7Z A;  1Z7N E;  4ZEB A;  2REG A;  2V3T A;  4OVJ A;  1JW5 A;  2G93 A;  4YKI A;  3E9X A;  1VR5 A;  3ILU B;  3M3F A;  3Q27 A;  4FEB A;  4OEU A;  2I0C A;  4Q5T A;  4U4X A;  1JEV A;  4WKM A;  3U94 A;  4HW8 A;  1Q35 A;  1MQG A;  3A09 A;  3FV1 A;  3K1N A;  3LBS A;  1EZO A;  1J1N A;  2D3I A;  2OLB A;  2CMO A;  4EQB A;  1MY1 A;  1FTM A;  3W9V A;  4QFK A;  5HBC A;  3E13 X;  1MDP 1;  2X26 A;  3PUY E;  4FOR A;  5I56 B;  1N7W A;  1VFE A;  1ZMG A;  2DP8 A;  4H8J A;  1FQD A;  4X1B A;  3HCQ A;  3PD9 A;  3K02 A;  3IOT A;  4GVO A;  2P0S A;  3AXF A;  2I48 A;  5I56 A;  1MM7 A;  4PFU A;  1B1X A;  1TFA A;  2RC8 A;  3EF7 A;  3FJM A;  1B05 A;  1R9Q A;  2ANJ A;  1NH7 A;  2V3Q A;  3QUJ A;  3H4Z A;  4JB7 A;  4ND9 A;  4ELQ A;  3JZJ A;  2I3W A;  3KSX A;  2O1L A;  2ZYK A;  5FHM A;  5B70 A;  3T66 A;  2PMS A;  1MXX A;  3FJ7 A;  3B6Q A;  3FVO A;  3PD8 A;  3PUW E;  4LUB A;  2D21 A;  2NOO A;  4Z0I A;  2GH9 A;  3FVK A;  3VLV A;  3IX1 A;  3C32 A;  1B32 A;  5I2K B;  3DRH A;  1R9L A;  1MG1 A;  2QS1 A;  3B6W A;  3ONM A;  2DE4 A;  1URD A;  2YLN A;  5KZT A;  3TMG A;  3HN0 A;  4NTL A;  1GTK A;  4DXC A;  3SET A;  3ODB A;  1XT8 A;  5L8D A;  2ALU A;  2XXU A;  3EPE A;  3THI A;  4P11 A;  1NL5 A;  1ZBM A;  1YCJ A;  3V8X B;  4EQ7 A;  3S9L C;  3JV9 A;  3CHG A;  1MQH A;  1S50 A;  3CSG A;  1MM6 A;  2XXY A;  3KEI A;  4FED A;  5DYH A;  3LC8 A;  2UVG A;  4DXU A;  1QW0 A;  4JXI A;  3TCF A;  1P1N A;  4N13 A;  1LAH E;  3ZSF A;  1N3W A;  2THI A;  1MXZ A;  3LR1 A;  1MQD A;  4IO7 A;  5EYF A;  1Y3Q A;  2VP1 A;  1LCF A;  1JW1 A;  1B7H A;  4O3C A;  4TLM B;  1TWY A;  3GXA A;  3PPR A;  1EH3 A;  1D9V A;  2DWI A;  2P2A A;  3A3U A;  3UK4 A;  1A40 A;  2VOZ A;  3C31 A;  1B52 A;  3VDF A;  2XX7 A;  3SEY A;  4G8H A;  3MC2 A;  2F8D A;  2QL3 A;  3I6V A;  1BP5 A;  3EQ1 A;  1FQF A;  1MPB A;  1P99 A;  3G3J A;  3O66 A;  4MBP A;  4TQU Q;  3MP6 A;  2F78 A;  1A55 A;  2F36 A;  4QSD A;  1DMB A;  4DXB A;  1ZTY A;  1PDA A;  4QF9 A;  5I2N A;  1B9J A;  2A5T B;  2AL4 A;  2Y84 A;  5ICT A;  1MXY A;  2XX9 A;  3DM0 A;  1LAG E;  3S4U A;  4ZED A;  4Q8R A;  3MZB A;  1H45 A;  3PUV E;  2HEU A;  3S9M C;  2Z8F A;  3U1O A;  2NUV A;  4WED A;  1YAE A;  3H3G A;  4GOT A;  4ZZE A;  3K4U A;  4ZZA A;  5H8N B;  4G77 A;  4LP2 B;  2HZL A;  2QJE A;  4RJZ A;  3MJN A;  2OK2 A;  3PPN A;  2XD3 A;  4YKJ A;  4R72 A;  4O3A A;  4QFN A;  3RY3 A;  1H43 A;  2GHB A;  4NF8 A;  3RT8 A;  1QKB A;  5IKB A;  4U2R A;  4OFJ A;  2Y7W A;  1LBB A;  3FD3 A;  4R6K A;  2XXI A;  3BBR A;  4KR5 A;  4DE8 A;  1XC1 A;  2FA7 A;  3MPK A;  3Q29 A;  1US4 A;  1WVJ A;  4IY5 A;  4LZ5 A;  2DWJ A;  4ZE9 A;  2HAU A;  3FXQ A;  5FHN A;  4RPN A;  1PBQ A;  3MVY A;  1LAF E;  1NNK A;  1Y1Z A;  5AA2 A;  2V93 A;  3CVG A;  2OWT A;  1MY4 A;  2CZL A;  2VD3 A;  2ZXT A;  3IO4 A;  2FNC A;  2GRV A;  4G2Z A;  4XTC Q;  4BDM A;  2O84 X;  1DPP A;  3IOU A;  4JBZ A;  1Q1K A;  3B7D A;  3PGF A;  2ZMB A;  3TUS A;  3PU5 A;  2RCB A;  3OEL A;  1PC3 A;  1Y4T A;  2NWJ A;  5CBR A;  4PFT A;  2F35 A;  4H0W A;  3K01 A;  1FTJ A;  4F22 A;  5JEI A;  3KGC A;  1MY2 A;  3PPQ A;  4LQ5 A;  3KSJ A;  5FTI A;  1FW0 A;  4F3P A;  1PB9 A;  5CMB A;  1DTZ A;  5JTY A;  1FQE A;  4ISU A;  1A99 A;  3IO6 A;  3MW0 A;  1D3K A;  4KYS A;  3PMW A;  3Q28 A;  1ZJL A;  1TT1 A;  2O6A A;  5FTH A;  1NMU A;  1P1O A;  1R6Z A;  4K3F A;  3OEK A;  2I3V A;  4NF5 B;  2ZYO A;  4I62 A;  3H7M A;  3L6H A;  5DVF A;  2DVZ A;  1ZIU A;  4U1O A;  3DRI A;  4IO2 A;  4QRZ A;  1MS7 A;  1B4Z A;  1QUI A;  2M8C A;  1MY3 A;  3C34 A;  4IO4 A;  1B5I A;  4OES A;  4HCY A;  2AIX A;  4GFR A;  1O64 A;  4ECF A;  1QJM A;  5I58 A;  2F6G A;  1SD3 A;  4FAJ A;  1FQB A;  2AYS A;  2QMX A;  3K6V A;  3QIM A;  3OOA A;  3TQW A;  1FTK A;  1Z7M E;  2QS4 A;  3LUY A;  1M5F A;  4POW A;  1IXG A;  3D4G A;  1BTJ A;  3HHG A;  4P0I A;  4ZEK A;  4QSE A;  4BDO A;  2XXX A;  1D4N A;  1LAX A;  2F7C A;  4AB6 A;  2OCU A;  3IL1 B;  4QSC A;  4NMY A;  3TFL A;  4ZDM A;  1ZU0 A;  3MVX A;  4G4P A;  5L9O A;  5I57 B;  1OMP A;  4ZEF A;  1TXF A;  4UA8 A;  3FGS A;  1MPD A;  1Y1M A;  2DWA A;  3SES A;  2Z8D A;  3QYT A;  1RYX A;  1AH5 A;  1B40 A;  2PBW A;  2Q88 A;  3KOT A;  3HHF A;  3MZ9 A;  1SW2 A;  2UYE A;  4PET A;  4NF6 B;  1AIV A;  2REJ A;  3RTW B;  2GHA A;  1LST A;  1UQW A;  1PB7 A;  1QVS A;  2FYI A;  2KLF A;  2O69 A;  3GBB A;  3KOS A;  4KD5 A;  4EQ9 A;  5KCJ B;  1H44 A;  1FQC A;  2Y7K A;  4OQO A;  3DRK A;  3K0V A;  2F97 A;  2DVC A;  3O97 A;  3TCG A;  4G68 A;  4U22 A;  3JYR A;  2BJJ X;  3T9H B;  5K2X A;  3G3F A;  3EHS A;  5L9M A;  1MXU A;  4EDP A;  3IB2 A;  4EUO A;  4JWX A;  3ZS6 A;  3IJX B;  3V83 A;  4LQ2 A;  4JWO A;  1XVY A;  4YU0 A;  1TFD A;  2Y7R A;  2GFE A;  4X9T A;  4EF2 A;  5F1Q A;  2E1S A;  4F2Q A;  3SEX A;  3LVU A;  3VVD A;  3RT6 B;  3SEV A;  2DS9 A;  4GWO A;  2ESN A;  3Q25 A;  3R26 A;  4X48 A;  1B5J A;  1IEJ A;  1PEB A;  4FIM A;  3HST A;  4PFY A;  1BKA A;  5ICQ A;  2E0S A;  2Y7I A;  4KHZ E;  3VE1 B;  4F2O A;  5H8Q B;  5ITP A;  2WOL A;  2Q2A A;  4NF6 A;  2O68 A;  3TYH A;  5KDT A;  3FXU A;  3OEN A;  3MP8 A;  3O9P A;  4LZ7 A;  3TOD A;  3MP1 A;  1M5B A;  5TU0 A;  4JSD A;  3IJO B;  4DDD A;  1XS5 A;  1PBP A;  4BDR A;  3D4C A;  1ELJ A;  3SER A;  4KQP A;  4F3B A;  5I57 A;  4U4S A;  1JW4 A;  2QSX A;  3RNN A;  4YAH X;  5TPA A;  2Q89 A;  2YPN A;  4YB7 A;  1NH8 A;  4YKK A;  1UIU A;  3UA8 A;  3H6V A;  2IEE A;  3T9X B;  2DQV A;  4TOZ A;  3TEL A;  2NXO A;  5A5X A;  4HS7 A;  3UGW A;  1BLF A;  1FQA A;  1R1N A;  1JEU A;  3C9H A;  3C36 A;  1B3F A;  5IAI A;  1YPN A;  1VFD A;  2F7A A;  4MH5 A;  4Z7E A;  4OFL A;  5I59 A;  3TPA A;  3DLN A;  2UVH A;  5AA2 D;  4R75 A;  1IIT A;  1PB8 A;  4H5G A;  3M8U A;  3KZG A;  3M3K A;  5I59 B;  1XVX A;  1P1Q A;  3F11 A;  1OLA A;  4PQJ A;  4ZE8 A;  4Q30 B;  2W7Y A;  1B6H A;  4LON B;  4HTG A;  5I2N B;  3S2V A;  4H67 A;  1USY H;  2R71 A;  3N26 A;  3USD A;  4N07 A;  1I6B A;  2IA4 A;  2ABH A;  4PE5 B;  2D5W A;  3OMB A;  5H8Q A;  2B3F A;  3DP4 A;  2G29 A;  2DSF A;  3MPL A;  4KCC A;  3T93 B;  4YB6 A;  3PPO A;  2RCA A;  3TDJ A;  4NE4 A;  1N84 A;  1Y9U A;  4TLL B;  1SYI A;  2RF1 A;  5ISU A;  3OEM A;  1LFH A;  2DYX A;  2H4I A;  2V84 A;  1MQJ A;  2Z23 A;  3UOR A;  1DPE A;  3GLB A;  5CRY A;  3RPW A;  3SKP A;  2O7I A;  1DOT A;  3MQ9 A;  3RYB A;  1VSO A;  2B4L A;  3OD7 A;  4OTE A;  5B7D A;  1LB9 A;  1LB8 A;  1QUL A;  1EU8 A;  2PYY A;  4M4G A;  4H8I A;  2P1S A;  5ELV A;  5BUU A;  1MH3 A;  5CMM A;  5H8F A;  3U92 A;  3KN3 A;  5I58 B;  2XD2 A;  1OLC A;  3ECR A;  2A5S A;  4GLI A;  3EHU A;  1B1H A;  1SW5 A;  4XXU A;  3MAM A;  3H03 A;  2I4C A;  3GBA A;  4U1Z A;  4LA9 A;  4E0X A;  1B4H A;  3FAT A;  4AQ4 A;  2UVI A;  3C4M A;  5H8N A;  3KJ7 A;  3U93 A;  3FVG A;  5TPA B;  1A7L A;  4NF5 A;  3H06 B;  3OO7 A;  1SQY A;  4R73 A;  4E0W A;  2O7U A;  1VE4 A;  1Y20 A;  2I4B A;  1HSJ A;  1IXI A;  3PUX E;  5CBS A;  2NVU B;  2PT2 A;  3IB0 A;  4H5F A;  4BDN A;  4YMB A;  4F3S A;  4F18 A;  3TTK A;  1Y3N A;  1JVY A;  1SYH A;  1MDQ A;  1US5 A;  3IK6 B;  3PAM A;  4IY6 A;  2Q8J A;  2ONK E;  1ZKB A;  2VD2 A;  1SVX B;  1SDX A;  4GRK A;  2ZNS A;  4RYA A;  5CI5 A;  3K00 A;  3E3K A;  1LFG A;  5HPQ A;  3PPP A;  3G3I A;  4I1D A;  4P0G A;  3S9E A;  3P7I A;  4MLV A;  1FTO A;  3KN8 A;  2R9J A;  3LSL A;  3KBR A;  3M3L A;  4GF8 A;  4XKP A;  2HXW A;  3OXN A;  3W9W A;  3FAS A;  1T0K A;  1O63 A;  1QKA A;  4F1V A;  2DXR A;  4IB2 A;  3CI8 A;  3H6T A;  1JVX A;  1QUK A;  4ZEI A;  4H6D A;  4ZS9 A;  1GV8 A;  4ONY A;  3CSB A;  1O7T A;  2DE2 A;  4RXL A;  1GR2 A;  5DT6 A;  3G3H A;  2XXP A;  3RLF E;  1NFT A;  2I0B A;  2YJP A;  3KG2 A;  4G68 B;  3G3G A;  4EF1 A;  3BFU A;  2DE3 A;  3BFT A;  4IGR A;  3O6P A;  5A5X B;  3MBP A;  1GGG A;  2F6P A;  4OEV A;  1DTG A;  1H76 A;  1S9T A;  1IZ1 A;  1USY E;  3EN3 A;  4KCD A;  3TKD A;  1OVT A;  2RIN A;  3CFX A;  1WOD A;  3PV0 E;  3KN7 A;  4NF4 B;  1IXC A;  3IOR A;  2B65 A;  4XKN A;  3FV2 A;  5H8F B;  1HSL A;  3O28 A;  3CFZ A;  2PT1 A;  3C33 A;  1M5D A;  4UAC A;  4RNS A;  3MZ1 A;  2VHA A;  4OEN A;  4F19 A;  5H8S A;  5AA2 B;  3OO6 A;  1DSN A;  4XKR A;  2XXT A;  2ZYM A;  3IB1 A;  4O3B A;  3K6X A;  1Y4C A;  4F29 A;  4NWD A;  2DXY A;  2O51 A;  1WDN A;  2RC7 A;  4OFO A;  3CG3 A;  4NF4 A;  1I6Q A;  1N0T A;  4ELR A;  1IIW A;  1POY 1;  2R6G E;  2ZYN A;  1NNT A;  3CFL A;  4R9F A;  3T9V A;  3VLW A;  3SEW A;  2H25 A;  3IR1 A;  3H6W A;  3HO7 A;  1B2H A;  1OQH A;  3IOW A;  1OVB A;  2HZK A;  3RN8 A;  4WXJ A;  4RY1 A;  4EXK A;  4I8C A;  4Q0C A;  1GVC A;  1LLS A;  2UVJ A;  5J1D A;  3PMX A;  4OHN A;  2V3U A;  4MF3 A;  4RPO A;  1B58 A;  1F9B A;  3K6W A;  2HFB A;  3FJG A;  5DEX A;  3CIJ A;  3QK6 A;  4GD5 A;  4I9D A;  3T9U A;  3WAE A;  4AB5 A;  5AA4 B;  4DZ1 A;  4ZEC A;  4NED A;  4FEC A;  3T22 A;  5CMC A;  3Q26 A;  1MXW A;  3FIR A;  4LAT A;  5CC2 A;  2F7B A;  1AL3 A;  3DRF A;  3LSX A;  1RKM A;  2HCA A;  3BKI B;  3LSF B;  4GQO A;  4YZZ A;  1LBC A;  2OJT A;  3V89 B;  1B3H A;  4R2F A;  4JWY A;  4C1U A;  1Y3P A;  4GXA A;  1UTH B;  2Z22 A;  3LSW A;  3K2D A;  3N5L A;  1CB6 A;  3OSQ A;  3C35 A;  3TTL A;  1SBP A;  2QS3 A;  3W15 C;  5I2K A;  3U8Q A;  3DRG A;  4GL8 A;  4PFW A;  3T96 B;  2WOK A;  1OQG A;  3N94 A;  4IGT A;  1M5E A;  1MQI A;  2HAV A;  2XXQ A;  3FZV A;  3K1P A;  3MVW A;  3DP8 A;  3HPI A;  3IAZ A;  4LZ8 A;  4OZ9 A;  3QAX A;  4BDQ A;  2B4M A;  1IUD A;  3I3V A;  4RK9 A;  4KPT A;  2X7P A;  3MVZ A;  5KDT B;  2WKY A;  1D9Y A;  4ELO A;  4PP0 A;  4HCW A;  2DWH A;  3UP9 A;  1LGB C;  4POX A;  3PMV A;  1LCT A;  2WOP A;  4FAT A;  1SI1 A;  3O2A A;  4OMB A;  2QRY A;  4DCY A;  5K2Y A;  4R6Y A;  1IXH A;  4H65 A;  4YB5 A;  1JNF A;  4ESW A;  1JQF A;  4FE8 A;  4R2B A;  3VVF A;  4R9G A;  4F1Y A;  5AA3 A;  1ANF A;  4RK2 A;  3FTO A;  1MH4 A;  1B3E A;  3OO9 A;  3KJT A;  4YIC A;  3R6U A;  3SDF A;  4BLA A;  4DLD A;  5M2V A;  5LOM A;  2H5Y A;  2OWS A;  1P1U A;  3FUZ A;  3RQT A;  3HV1 A;  4OWD A;  4YKP A;  2ONR A;  1YTV A;  1M5C A;  4NWC A;  5DTB A;  2I58 A;  4G8N A;  3K6U A;  2UYF A;  1B0H A;  1HSE A;  3A3C A;  4YMA A;  2LAO A;  4F31 B;  1JET A;  1I6A A;  3ZKK A;  3MWB A;  1SW1 A;  3E4R A;  2Y7P A;  4GXS B;  4OXV A;  3R7X A;  3ILT B;  3TEP A;  3MUQ A;  1SW4 A;  2DOJ A;  2ZNT A;  5KCJ A;  3VVE A;  1A54 A;  1OIB A;  3OO8 A;  4G68 C;  4F39 A;  3I5O A;  3FXR A;  4DCX A;  5H8H B;  4C1T A;  4GIZ A;  2OBG A;  1URS A;  2F34 A;  3TZA A;  4ELP A;  4EXL A;  3KFM A;  2ZNU A;  4QHQ A;  1UTB B;  1ZLQ A;  1N7X A;  1ATG A;  2HQ0 A;  2XHD A;  4QFO A;  1N76 A;  4U23 A;  5F7V A;  5FHO A;  5AA1 A;  2Q9T A;  1RYO A;  3O29 A;  3SEU A;  1A8E A;  2XX8 A;  1P1W A;  3DEL B;  1MXV A;  1NKX A;  4XIG Q;  1KWH A;  4F3G A; 
#chains in the Genus database with same CATH topology
 1XOC A;  2RC9 A;  1SI0 A;  4KYD A;  2QPQ A;  3N6T A;  5BWJ A;  4RA1 A;  2Z8E A;  5ET7 A;  4XKQ A;  3DRJ A;  4KI0 E;  4ESX A;  3IFC A;  3OSR A;  4L17 A;  4R6H A;  4JDF A;  2ONS A;  2QMW A;  3V5A A;  2H99 A;  1MRP A;  3UIF A;  2XXV A;  5I84 A;  5DVJ A;  4GWW A;  5JK4 A;  4KFQ A;  1FTL A;  4OVR A;  3TQL A;  5ITO A;  2B3B A;  3O6H A;  4OYV A;  5L9S A;  4BDL A;  5TP9 A;  2UXA A;  3TCH A;  1EZ9 A;  1EZP A;  4KXP A;  3ROJ A;  4LVQ A;  1UTH A;  3B6T A;  1B7Z A;  1Z7N E;  2G93 A;  4P47 A;  4HW8 A;  1EZO A;  1MY1 A;  3W9V A;  3PUY E;  1MDP 1;  4H8J A;  3HCQ A;  3IOT A;  1FPE A;  5I56 A;  3MAM A;  3FJM A;  1R9Q A;  4N6D A;  2ANJ A;  1NH7 A;  4FBP A;  4ND9 A;  3T66 A;  3TTL A;  1MXX A;  3FJ7 A;  3FVO A;  2D21 A;  2GH9 A;  3VLV A;  3IX1 A;  3C32 A;  1MG1 A;  2DE4 A;  5I7I A;  1GTK A;  3SET A;  1XT8 A;  2ALU A;  3THI A;  4QBA A;  1CNQ A;  3S9L C;  2FBP A;  3JV9 A;  3KEI A;  4PF6 A;  3LC8 A;  3TCF A;  2THI A;  3LR1 A;  4IO7 A;  1Y3Q A;  4MNP A;  5EYG A;  4O3C A;  3PPR A;  2P2A A;  2VOZ A;  4MIJ A;  1LBX A;  4G8H A;  2QL3 A;  4HE1 A;  1MPB A;  3MP6 A;  1B9J A;  2AL4 A;  2Y84 A;  3DM0 A;  2Z8F A;  4YKJ A;  2QJE A;  2OK2 A;  1EYJ A;  2Y7W A;  4R6K A;  2XXI A;  3BBR A;  2FA7 A;  2DWJ A;  3MVY A;  2VPO A;  1Y1Z A;  2OWT A;  2VD3 A;  2FNC A;  3OEL A;  2NWJ A;  4OVQ A;  2F35 A;  3K01 A;  1Q9D A;  5JEI A;  1MY2 A;  3PPQ A;  4LQ5 A;  1FW0 A;  1FQE A;  1D3K A;  1TT1 A;  1R6Z A;  3KBZ A;  4IO2 A;  4QRZ A;  2M8C A;  1MY3 A;  1QJM A;  2QMX A;  4ZEK A;  2CEY A;  2XXX A;  4NMY A;  4G4P A;  5L9O A;  4ZEF A;  1TXF A;  1RYX A;  2PBW A;  2ZZV A;  2UYE A;  2Q74 A;  1UQW A;  2FYI A;  3GBB A;  5IZ3 B;  1H44 A;  5ESY A;  4OQO A;  3O97 A;  2BJJ X;  3EHS A;  4MNC A;  4EDP A;  4YU0 A;  2Y7R A;  4X9T A;  2PFZ A;  4X48 A;  3MST A;  1BKA A;  3VE1 B;  4KHZ E;  4PE3 A;  3FXU A;  4G61 A;  2ZZX A;  1XS5 A;  1PBP A;  4KQP A;  2Y5K A;  5I57 A;  4YAH X;  3UA8 A;  3H6V A;  4TOZ A;  3UGW A;  4H5G A;  1NV5 A;  1P1Q A;  5I2N B;  4N07 A;  1I6B A;  4N8G A;  1YZ0 A;  3DP4 A;  4KCC A;  3MPL A;  1SYI A;  4H46 A;  3SKP A;  1DOT A;  2XXK A;  4GX6 A;  1EU8 A;  4HE2 A;  2P1S A;  2ZZW A;  5CMM A;  5LTC A;  5I58 B;  2A5S A;  3EHU A;  2I4C A;  4AQ4 A;  5H8N A;  3U93 A;  5TPA B;  2O7U A;  1HSJ A;  3PUX E;  2NVU B;  1Y3N A;  3IK6 B;  3PAM A;  2VD2 A;  1ZKB A;  4GRK A;  2XA5 A;  3FXB A;  5CI5 A;  5HPQ A;  3G3I A;  3S9E A;  1FTO A;  3KN8 A;  4GF8 A;  2HXW A;  1XI6 A;  2WBD A;  4IB2 A;  1GV8 A;  4ONY A;  1O7T A;  2XXP A;  3RLF E;  4G68 B;  3BFT A;  4IGR A;  3O6P A;  1GGG A;  3EN3 A;  3TKD A;  3CFX A;  3IOR A;  1NUX A;  2PT1 A;  4UAC A;  4RNS A;  4OEN A;  2VHA A;  1DSN A;  4O3B A;  3K6X A;  2DXY A;  2RC7 A;  2WYP A;  2R6G E;  3CFL A;  1NNT A;  3SEW A;  2H25 A;  1OVB A;  3RN8 A;  4RY1 A;  1LLS A;  2UVJ A;  1F9B A;  2HFB A;  3WAE A;  4AB5 A;  4ZEC A;  5CMC A;  4LAT A;  1MXW A;  2F7B A;  1AL3 A;  3BKI B;  1CB6 A;  3OSQ A;  2QS3 A;  4QXD A;  3T96 B;  1OQG A;  4MAG A;  1MQI A;  3FZV A;  4OZ9 A;  4MMP A;  3MVW A;  3HPI A;  2B4M A;  2X7P A;  4ELO A;  1D9Y A;  4PP0 A;  2DWH A;  4PDD A;  1LGB C;  2WOP A;  2QRY A;  4DCY A;  4AS4 A;  4FE8 A;  2WBB A;  1B3E A;  1P1U A;  4OWD A;  1M5C A;  1B0H A;  4YMA A;  1JET A;  1SW1 A;  3E4R A;  2ZNT A;  1OIB A;  3I5O A;  4GIZ A;  3TZA A;  4QHQ A;  1N7X A;  2XHD A;  5F7V A;  3O29 A;  2XX8 A;  1NKX A;  1KWH A;  4U21 A;  4IO5 A;  5DVI A;  1A8F A;  4GWU A;  5EHM A;  2H9B A;  4M1V A;  3O6I A;  1I69 A;  4C0R A;  3K1M A;  4H1X A;  5TP9 B;  3TTR A;  4OER A;  1QUJ A;  5ET6 A;  2XWK A;  3RGY A;  3RYA A;  3UN6 A;  4O7I A;  5HM4 B;  4R74 A;  4DIG A;  1XHY A;  2HXR A;  3RTF B;  4IO3 A;  4MFI A;  4PGP A;  5CM6 A;  2I6E A;  4OET A;  2VGQ A;  3S9N C;  3VXC A;  3CG1 A;  4P1L A;  1S7Y A;  1IQ7 A;  2XXH A;  1FTA A;  1B51 A;  1URG A;  4ZEB A;  2V3T A;  4OVJ A;  1FBD A;  4DI4 B;  4FEB A;  2FIX A;  4U4X A;  3T0J A;  1Q35 A;  4EQB A;  2OLB A;  2CMO A;  4QFK A;  3E13 X;  1VFE A;  1AWB A;  2P0S A;  3AXF A;  2I48 A;  4N17 A;  4PFU A;  2RC8 A;  2V3Q A;  3QUJ A;  3PUW E;  3B6Q A;  4Z0I A;  3FVK A;  3DRH A;  3ONM A;  3TMG A;  5KZT A;  3HN0 A;  2WYK A;  4PAI A;  2XXU A;  1NL5 A;  1ZBM A;  1YCJ A;  1S50 A;  1MM6 A;  3RPL B;  2UVG A;  1LAH E;  1N3W A;  4PCD A;  1MQD A;  1B7H A;  4UAB A;  1TWY A;  3GXA A;  1D9V A;  4MCO A;  3A3U A;  2BJI A;  2XX7 A;  1FBH A;  1BP5 A;  1FQF A;  1FBC A;  1P99 A;  4MBP A;  1A55 A;  2F36 A;  4DXB A;  1ZTY A;  1PDA A;  5I2N A;  2A5T B;  1MXY A;  3S4U A;  3PUV E;  2HEU A;  3S9M C;  2NUV A;  4WED A;  1YAE A;  4ZZA A;  4G77 A;  4RJZ A;  4BDM A;  4NX1 A;  3PPN A;  2XD3 A;  4R72 A;  1FPJ A;  1G0H A;  4QFN A;  4O3A A;  3RY3 A;  2Q8M A;  4NF8 A;  1QKB A;  3FBP A;  1FBP A;  3FD3 A;  4DE8 A;  1XC1 A;  3MPK A;  4IY5 A;  1US4 A;  5FHN A;  2HAU A;  3FXQ A;  1LAF E;  1NNK A;  5AA2 A;  2V93 A;  3CVG A;  1MY4 A;  2CZL A;  2ZXT A;  3GYY A;  4JBZ A;  3PGF A;  4MEV A;  5CBR A;  4PFT A;  4X04 A;  3BIH A;  1DTZ A;  4ISU A;  3Q28 A;  1ZJL A;  2O6A A;  4NF5 B;  4I62 A;  3H7M A;  3L6H A;  5DVF A;  2DVZ A;  1QUI A;  1B5I A;  2AIX A;  2F6G A;  2PCR A;  3QIM A;  3OOA A;  3TQW A;  5I58 A;  4POW A;  3D1R A;  4P8B A;  3HHG A;  4BDO A;  4AB6 A;  2OCU A;  3TFL A;  1FJ9 A;  5I3S A;  3HHF A;  4PET A;  2GHA A;  1LST A;  2KLF A;  2O69 A;  4EQ9 A;  5KCJ B;  4U22 A;  2FHY A;  5EQ7 A;  5K2X A;  4EUO A;  3V83 A;  4LQ2 A;  4JWO A;  1TFD A;  3SEV A;  2DS9 A;  4GWO A;  2ESN A;  3R26 A;  4PFY A;  2E0S A;  2Y7I A;  5ITP A;  2WOL A;  3OEN A;  3TOD A;  1M5B A;  2V4C A;  3IJO B;  3D4C A;  1ELJ A;  2QSX A;  2YPN A;  3LUZ A;  1UIU A;  2DDK A;  4HS7 A;  1BLF A;  1NV2 A;  1FQA A;  4MH5 A;  4OFL A;  1IIT A;  1PB8 A;  5I59 B;  4GBV A;  3USD A;  4H67 A;  3HFU A;  2ABH A;  4NG7 A;  4MX6 A;  5H8Q A;  3KC0 A;  3PPO A;  2RCA A;  1N84 A;  3OEM A;  1LFH A;  1K9Z A;  1MQJ A;  1NV6 A;  5CRY A;  2O7I A;  3RYB A;  4OTE A;  1LB8 A;  1RDZ A;  5ELV A;  1MH3 A;  3KN3 A;  3ECR A;  4GLI A;  1B1H A;  4XXU A;  3GBA A;  4HE0 A;  4U1Z A;  2UVI A;  3KJ7 A;  4DI3 D;  1KA0 A;  4NF5 A;  3H06 B;  2I4B A;  1IXI A;  5CBS A;  2PT2 A;  2PFY A;  3TTK A;  4IY6 A;  1US5 A;  2ONK E;  2XWV A;  2ZNS A;  3K00 A;  1LFG A;  3PPP A;  3M3L A;  3KBR A;  4XKP A;  3OXN A;  2DXR A;  2VT5 A;  1JVX A;  1QUK A;  4ZS9 A;  4H6D A;  3CSB A;  1NFT A;  3G3G A;  5LDZ A;  1DTG A;  1H76 A;  2RIN A;  2B65 A;  1LBW A;  1HSL A;  3C33 A;  1M5D A;  3QMF A;  4F19 A;  3OO6 A;  4XKR A;  2XXT A;  4NQ8 A;  4O8M A;  4NF4 A;  3CG3 A;  4ELR A;  1I6Q A;  1YYZ A;  3B50 A;  4R9F A;  1LEV A;  3IR1 A;  3H6W A;  1B2H A;  1OQH A;  2HZK A;  4Q0C A;  5J1D A;  2CZK A;  4OHN A;  1D9Q A;  1B58 A;  3QK6 A;  4NED A;  4FEC A;  4P9K A;  5IGA A;  3LSX A;  1RKM A;  2QVV A;  4YZZ A;  1LBC A;  1UTH B;  3LSW A;  3W15 C;  5I2K A;  1DCU A;  2WOK A;  4IGT A;  1FPD A;  2HAV A;  4BDQ A;  3DP8 A;  3MVZ A;  5KDT B;  4POX A;  4FAT A;  4P1E A;  5K2Y A;  3U65 A;  5AA3 A;  1ANF A;  4RK2 A;  3FTO A;  1MH4 A;  3OO9 A;  5LOM A;  3R6U A;  4YKP A;  3FUZ A;  3RQT A;  5DTB A;  4NWC A;  2UYF A;  3A3C A;  3R7X A;  4GXS B;  3ILT B;  1SW4 A;  1A54 A;  3OO8 A;  4F39 A;  5H8H B;  2OBG A;  3KFM A;  1ZLQ A;  1ATG A;  1T0K A;  3SEU A;  3DEL B;  1MXV A;  2OZZ A;  1IMD A;  1B3G A;  4WEP A;  1B0L A;  2XWO A;  4MLQ A;  1B7U A;  4QFP A;  5H8H A;  1NNF A;  3L6G A;  2XWI A;  3TAJ A;  4F1U A;  2V25 A;  3QXM A;  3RUM A;  1VDW A;  3TTM A;  3N6U A;  3U72 A;  3EHT A;  1II5 A;  4GBW A;  4THI A;  5AA4 A;  1FPI A;  4JSO A;  4N6P A;  1FCK A;  2I49 A;  3G7W A;  4FJP A;  3VV5 A;  4PC9 A;  1MY0 A;  2Q2C A;  1L5T A;  1LFI A;  1MPC A;  2F5X A;  3PUZ E;  2PVU A;  1AOV A;  3O6G A;  3QUF A;  1UTB A;  1B3L A;  4IO6 A;  3VFJ A;  3VXB A;  1N3X A;  4QFL A;  4GL0 A;  1NUY A;  2REG A;  1JW5 A;  3E9X A;  2F3D A;  3M3F A;  3Q27 A;  3U94 A;  4OEU A;  2I0C A;  4Q5T A;  1MQG A;  2D3I A;  1FTM A;  5HBC A;  5I56 B;  2X26 A;  1N7W A;  2DP8 A;  1FQD A;  4X1B A;  3PD9 A;  4GWZ A;  4GVO A;  3A29 A;  4X8R A;  1MM7 A;  1B1X A;  3IOU A;  3H4Z A;  2I3W A;  3KSX A;  2O1L A;  2ZYK A;  4JVI A;  3PD8 A;  4LUB A;  2NOO A;  2JJK A;  1R9L A;  4MJO A;  1SPI A;  2YLN A;  4NTL A;  4DXC A;  5L8D A;  3EPE A;  3V8X B;  2P3N A;  3CHG A;  3KC1 A;  5DYH A;  1FSA A;  5EYH A;  4N13 A;  1MXZ A;  3E79 A;  5EYF A;  2VP1 A;  4NN3 A;  1FPK A;  4PBQ A;  2DWI A;  4N91 A;  3UK4 A;  1A40 A;  3C31 A;  3VDF A;  1NV7 A;  3MC2 A;  2F8D A;  3EQ1 A;  2F78 A;  4QSD A;  5ICT A;  2XX9 A;  3MZB A;  1H45 A;  3H3G A;  4ZZE A;  1FPB A;  5IKB A;  4U2R A;  4KR5 A;  1WVJ A;  5JTY A;  4ZE9 A;  4RPN A;  1PBQ A;  4PAK A;  4XTC Q;  4G2Z A;  2HHM A;  2Y5L A;  3TUS A;  2ZMB A;  3PU5 A;  4H0W A;  1EYK A;  3KGC A;  3KSJ A;  5FTI A;  1DK4 A;  4F3P A;  1FBG A;  1NV0 A;  3MW0 A;  4KYS A;  3PMW A;  1NMU A;  3SZP A;  2I3V A;  1QGX A;  1ZIU A;  3DRI A;  1MS7 A;  3C34 A;  4IO4 A;  4HCY A;  1O64 A;  4ECF A;  1NUW A;  4FAJ A;  1FQB A;  2AYS A;  2QS4 A;  3LUY A;  1M5F A;  4QSE A;  4P0I A;  1D4N A;  1LAX A;  2F7C A;  1ZU0 A;  5I57 B;  3FGS A;  1MPD A;  1Y1M A;  2DWA A;  3SES A;  1NUZ A;  2Z8D A;  1AH5 A;  1B40 A;  2Q88 A;  3MZ9 A;  1SW2 A;  2REJ A;  4JVC A;  3RTW B;  1QVS A;  3KOS A;  4KD5 A;  4MHF A;  3K0V A;  2DVC A;  4GX4 A;  4N15 A;  3G3F A;  5L9M A;  1MXU A;  3IB2 A;  3ZS6 A;  2FIE A;  4EF2 A;  2OX3 A;  5F1Q A;  2E1S A;  3LVU A;  3VVD A;  3RT6 B;  4FIM A;  2WX9 A;  3MYU A;  5H8Q B;  4NF6 A;  2O68 A;  5KDT A;  4LZ7 A;  3MP1 A;  5TU0 A;  4U4S A;  1JW4 A;  5TPA A;  4YKK A;  4XEQ A;  4I3E A;  4NGU A;  3TEL A;  3C36 A;  1B3F A;  2F7A A;  4Z7E A;  5A5L A;  3KZG A;  1LBZ A;  1XVX A;  1OLA A;  4PQJ A;  4Q30 B;  1B6H A;  4LON B;  4HTG A;  3S2V A;  1USY H;  2R71 A;  2IA4 A;  4PE5 B;  4YB6 A;  3TDJ A;  1Y9U A;  5ISU A;  2DYX A;  2H4I A;  3GLB A;  3MQ9 A;  5B7D A;  1LB9 A;  4M4G A;  4OVT A;  4GWX A;  5BUU A;  5ET8 A;  3U92 A;  2XD2 A;  1OLC A;  1SW5 A;  3H03 A;  4LA9 A;  1B4H A;  3C4M A;  5IZ3 A;  2HPG A;  1A7L A;  1SQY A;  4PDH A;  4E0W A;  1VE4 A;  1Y20 A;  1KA1 A;  4BDN A;  4YMB A;  1NI9 A;  4F3S A;  4F18 A;  1JVY A;  1MDQ A;  1SVX B;  3BIG A;  3E3K A;  4I1D A;  3P7I A;  4MLV A;  2R9J A;  4F1V A;  3H6T A;  2DE2 A;  4RXL A;  1GR2 A;  3G3H A;  2I0B A;  3KG2 A;  2F6P A;  4KCD A;  4OEV A;  1IZ1 A;  1USY E;  4XFE A;  1LBV A;  1WOD A;  3PV0 E;  3KN7 A;  4NAP A;  4XKN A;  4PF8 A;  3MZ1 A;  2CZH A;  3IB1 A;  5H8F B;  1WDN A;  4OFO A;  4IR8 A;  3VLW A;  2VPN A;  3IOW A;  4WXJ A;  4I8C A;  1GVC A;  1KZ8 A;  3PMX A;  5DEX A;  2V3U A;  4MF3 A;  4RPO A;  5AA4 B;  4GD5 A;  4DZ1 A;  3T22 A;  3Q26 A;  4N81 A;  3DRF A;  3LSF B;  3V89 B;  4C1U A;  1Y3P A;  4GXA A;  2Z22 A;  3K2D A;  3N5L A;  5ET5 A;  3T1B A;  3C35 A;  4PAF A;  3U8Q A;  4PFW A;  5IZ1 A;  4LZ8 A;  2XXQ A;  3K1P A;  3IAZ A;  1FPF A;  3I3V A;  1NV4 A;  3UP9 A;  2F3B A;  3PMV A;  3RPL A;  1SI1 A;  4OMB A;  1IXH A;  1IMF A;  1JNF A;  4ESW A;  1JQF A;  4R9G A;  4BLA A;  3KJT A;  3SDF A;  4DLD A;  2OWS A;  3HV1 A;  1YTV A;  4G8N A;  1HSE A;  2LAO A;  4F31 B;  1I6A A;  3ZKK A;  2KQZ A;  3MWB A;  5FBP A;  3MUQ A;  2DOJ A;  5KCJ A;  3FXR A;  4DCX A;  4EXL A;  2F34 A;  4ELP A;  1IME A;  2QFL A;  5AA1 A;  1N76 A;  4U23 A;  1P1W A;  4XIG Q;  1N04 A;  4GWY A;  1B46 A;  1H3D A;  3FVN A;  5J16 A;  2R8T A;  3CRB A;  3IOV A;  1UIV A;  2X7Q A;  2QS2 A;  4G8M A;  3QSL A;  4X1D A;  3TTN A;  2XXR A;  2A5T A;  3CR9 A;  1B5H A;  3ZKL A;  1NNP A;  2PX1 A;  5DEX B;  4LN5 A;  1RDY A;  2O1M A;  2AL5 A;  2P3V A;  3H6U A;  2RKM A;  5EHS A;  5CMK A;  3GZG A;  3G3K A;  5F24 A;  5JTY B;  1POT A;  4KYE A;  3EKI A;  4NF8 B;  2XXW A;  1AMF A;  3DP6 A;  1BIY A;  3VLU A;  1CE2 A;  2H98 A;  3WAF A;  4YKI A;  1VR5 A;  3ILU B;  4WKM A;  2WEF A;  1JEV A;  3A09 A;  3FV1 A;  3K1N A;  3LBS A;  1J1N A;  4FOR A;  1ZMG A;  3K02 A;  4P3L A;  1DBZ A;  1TFA A;  3EF7 A;  1B05 A;  4ELQ A;  1LBY A;  4JB7 A;  3JZJ A;  4MNI A;  5FHM A;  5B70 A;  1INP A;  2PMS A;  1RDX A;  1B32 A;  4H45 A;  5I2K B;  2QS1 A;  3B6W A;  1URD A;  3ODB A;  4PGN A;  4P11 A;  4EQ7 A;  1MQH A;  4FED A;  3CSG A;  2XXY A;  4DXU A;  1QW0 A;  4JXI A;  1P1N A;  3ZSF A;  1LCF A;  1JW1 A;  4TLM B;  1EH3 A;  1B52 A;  3SEY A;  3I6V A;  3G3J A;  3O66 A;  4TQU Q;  1DMB A;  4PFR A;  4QF9 A;  1LAG E;  4ZED A;  4Q8R A;  1FBF A;  1IMC A;  5EQ8 A;  3U1O A;  4GOT A;  3K4U A;  5H8N B;  4LP2 B;  2HZL A;  3MJN A;  1H43 A;  2GHB A;  3RT8 A;  4OFJ A;  1LBB A;  3Q29 A;  4NF4 B;  4LZ5 A;  5H8F A;  4GX3 A;  5AE4 A;  3IO4 A;  4N6K A;  2GRV A;  2O84 X;  1DPP A;  1Q1K A;  3B7D A;  4OVP A;  2RCB A;  1PC3 A;  1FTJ A;  4F22 A;  1PB9 A;  5CMB A;  2OWZ A;  1A99 A;  3IO6 A;  5FTH A;  1P1O A;  2CZI A;  4K3F A;  3OEK A;  2ZYO A;  2QVU A;  4U1O A;  1B4Z A;  4OES A;  4GFR A;  1EYI A;  1SD3 A;  2L5V A;  3K6V A;  1FTK A;  1Z7M E;  1IXG A;  3D4G A;  1BTJ A;  4NHB A;  3LV0 A;  3RYD A;  4PTK A;  2QVR A;  3IL1 B;  4QSC A;  4ZDM A;  3MVX A;  1OMP A;  4UA8 A;  3QYT A;  3KOT A;  4PFI A;  4NF6 B;  1AIV A;  1PB7 A;  1FQC A;  2Y7K A;  4PFB A;  3DRK A;  2F97 A;  3E78 A;  3TCG A;  4G68 A;  4N4U A;  1IMB A;  3JYR A;  3T9H B;  4JWX A;  3IJX B;  3B8B A;  1XVY A;  2GFE A;  4PBH A;  4F2Q A;  3SEX A;  4GWS A;  2FVZ A;  3Q25 A;  1B5J A;  1IEJ A;  1PEB A;  3HST A;  5ICQ A;  4F2O A;  4O7M A;  2Q2A A;  3TYH A;  3MP8 A;  3O9P A;  4JSD A;  4DDD A;  4BDR A;  3SER A;  4F3B A;  3RNN A;  2Q89 A;  4O94 A;  4YB7 A;  1NH8 A;  1IMA A;  2IEE A;  3T9X B;  2DQV A;  2NXO A;  5A5X A;  1R1N A;  5IM2 A;  1JEU A;  3NOH A;  3C9H A;  5IAI A;  1YPN A;  1VFD A;  5I59 A;  3TPA A;  4NF0 A;  3DLN A;  2UVH A;  5AA2 D;  4R75 A;  1BK4 A;  3M8U A;  3M3K A;  5EQ9 A;  4OVS A;  3F11 A;  4ZE8 A;  2W7Y A;  3N26 A;  4OAN A;  2D5W A;  3OMB A;  2B3F A;  2G29 A;  2DSF A;  5IZZ A;  3T93 B;  4NE4 A;  4TLL B;  2RF1 A;  2V84 A;  2Z23 A;  3UOR A;  1DPE A;  1K9Y A;  3RPW A;  1VSO A;  2B4L A;  3OD7 A;  1QUL A;  2PYY A;  4H8I A;  1NV3 A;  4E0X A;  3FAT A;  3FVG A;  4N8Y A;  3OO7 A;  4R73 A;  4XF5 A;  3IB0 A;  4H5F A;  1SYH A;  2Q8J A;  4RYA A;  1SDX A;  4P0G A;  3LSL A;  3W9W A;  3FAS A;  1O63 A;  1QKA A;  3CI8 A;  1G0I A;  4ZEI A;  4JVD A;  5DT6 A;  4EF1 A;  2YJP A;  3BFU A;  2DE3 A;  5A5X B;  3MBP A;  1S9T A;  1OVT A;  4I40 A;  1IXC A;  3FV2 A;  3IFA A;  1YXI A;  3O28 A;  3CFZ A;  1FPL A;  5AA2 B;  5H8S A;  5DW8 A;  2ZYM A;  1Y4C A;  4F29 A;  4NWD A;  2O51 A;  1NV1 A;  1N0T A;  1IIW A;  1POY 1;  2ZYN A;  3T9V A;  3HO7 A;  4EXK A;  3ISP A;  1FJ6 A;  3K6W A;  3FJG A;  3T9U A;  3CIJ A;  4I9D A;  4OA4 A;  3FIR A;  4P56 A;  5CC2 A;  4HXV A;  4GQO A;  2HCA A;  1FPG A;  2OJT A;  1B3H A;  4R2F A;  4JWY A;  2MKZ A;  4I3Y A;  1SBP A;  3DRG A;  4GL8 A;  3N94 A;  1M5E A;  3QAX A;  1IUD A;  4AS5 A;  4RK9 A;  4KPT A;  2WKY A;  4HCW A;  1LCT A;  5I5P A;  3O2A A;  4R6Y A;  4H65 A;  2GQ1 A;  4YB5 A;  4R2B A;  3VVF A;  4F1Y A;  1FRP A;  4YIC A;  2KR0 A;  3PTY A;  5M2V A;  2H5Y A;  2ONR A;  2I58 A;  3K6U A;  1FBE A;  4OXV A;  2Y7P A;  3TEP A;  5T3J A;  3VVE A;  4G68 C;  1JP4 A;  4C1T A;  1URS A;  2CEX A;  2ZNU A;  1UTB B;  2HQ0 A;  4QFO A;  5FHO A;  2Q9T A;  1RYO A;  1A8E A;  5EQA A;  1Y4T A;  4F3G A; 
#chains in the Genus database with same CATH homology
 2OZZ A;  1N04 A;  1XOC A;  1B3G A;  2RC9 A;  1B46 A;  1B0L A;  1SI0 A;  1H3D A;  3FVN A;  4IO5 A;  4U21 A;  4WEP A;  4KYD A;  5DVI A;  2QPQ A;  3N6T A;  5BWJ A;  4RA1 A;  1A8F A;  4MLQ A;  3CRB A;  1B7U A;  2Z8E A;  3IOV A;  4XKQ A;  2H9B A;  5EHM A;  1UIV A;  3DRJ A;  4KI0 E;  4M1V A;  4QFP A;  5H8H A;  4ESX A;  2X7Q A;  3O6I A;  1NNF A;  2QS2 A;  3L6G A;  4G8M A;  3TAJ A;  1I69 A;  3QSL A;  4F1U A;  3OSR A;  4X1D A;  4L17 A;  2V25 A;  4C0R A;  3K1M A;  3QXM A;  4JDF A;  4R6H A;  4H1X A;  2XXR A;  2A5T A;  3CR9 A;  5TP9 B;  3RUM A;  3TTN A;  3TTM A;  3TTR A;  1B5H A;  3N6U A;  3ZKL A;  3U72 A;  1NNP A;  2PX1 A;  4OER A;  3EHT A;  1II5 A;  4THI A;  5AA4 A;  1QUJ A;  2ONS A;  5DEX B;  2QMW A;  4JSO A;  3V5A A;  4N6P A;  3RGY A;  2H99 A;  1FCK A;  2O1M A;  1MRP A;  2I49 A;  3G7W A;  4FJP A;  3UIF A;  3RYA A;  2AL5 A;  3VV5 A;  2XXV A;  3H6U A;  3UN6 A;  5DVJ A;  5I84 A;  5JK4 A;  2RKM A;  5HM4 B;  1MY0 A;  4R74 A;  2Q2C A;  5EHS A;  4DIG A;  1L5T A;  5CMK A;  3GZG A;  4KFQ A;  1XHY A;  1FTL A;  3RTF B;  4IO3 A;  3G3K A;  4MFI A;  1LFI A;  5CM6 A;  1MPC A;  3TQL A;  2F5X A;  4OET A;  2I6E A;  5ITO A;  1POT A;  5JTY B;  2VGQ A;  3PUZ E;  2PVU A;  3S9N C;  1AOV A;  2B3B A;  3O6H A;  3O6G A;  4KYE A;  3QUF A;  4OYV A;  3VXC A;  5L9S A;  3CG1 A;  4BDL A;  5TP9 A;  2UXA A;  3TCH A;  2XXW A;  1UTB A;  4NF8 B;  1AMF A;  1B3L A;  1EZ9 A;  4IO6 A;  5AE4 A;  3VFJ A;  1EZP A;  3DP6 A;  3VXB A;  1N3X A;  1BIY A;  3VLU A;  4QFL A;  1CE2 A;  1S7Y A;  1UTH A;  4GL0 A;  4LVQ A;  1IQ7 A;  2H98 A;  2XXH A;  3WAF A;  1B51 A;  3B6T A;  1URG A;  1B7Z A;  1Z7N E;  4ZEB A;  2REG A;  2V3T A;  4OVJ A;  1JW5 A;  2G93 A;  4YKI A;  3E9X A;  1VR5 A;  3ILU B;  3M3F A;  3Q27 A;  4FEB A;  4OEU A;  2I0C A;  4Q5T A;  4U4X A;  1JEV A;  4WKM A;  3U94 A;  4HW8 A;  1Q35 A;  1MQG A;  3A09 A;  3FV1 A;  3K1N A;  3LBS A;  1EZO A;  1J1N A;  2D3I A;  2OLB A;  2CMO A;  4EQB A;  1MY1 A;  1FTM A;  3W9V A;  4QFK A;  5HBC A;  3E13 X;  1MDP 1;  2X26 A;  3PUY E;  4FOR A;  5I56 B;  1N7W A;  1VFE A;  1ZMG A;  2DP8 A;  4H8J A;  1FQD A;  4X1B A;  3HCQ A;  3PD9 A;  3K02 A;  3IOT A;  4GVO A;  2P0S A;  3AXF A;  2I48 A;  5I56 A;  1MM7 A;  4PFU A;  1B1X A;  1TFA A;  2RC8 A;  3EF7 A;  3FJM A;  1B05 A;  1R9Q A;  2ANJ A;  1NH7 A;  2V3Q A;  3QUJ A;  3H4Z A;  4JB7 A;  4ND9 A;  4ELQ A;  3JZJ A;  2I3W A;  3KSX A;  2O1L A;  2ZYK A;  5FHM A;  5B70 A;  3T66 A;  2PMS A;  1MXX A;  3FJ7 A;  3B6Q A;  3FVO A;  3PD8 A;  3PUW E;  4LUB A;  2D21 A;  2NOO A;  4Z0I A;  2GH9 A;  3FVK A;  3VLV A;  3IX1 A;  3C32 A;  1B32 A;  5I2K B;  3DRH A;  1R9L A;  1MG1 A;  2QS1 A;  3B6W A;  3ONM A;  2DE4 A;  1URD A;  2YLN A;  5KZT A;  3TMG A;  3HN0 A;  4NTL A;  1GTK A;  4DXC A;  3SET A;  3ODB A;  1XT8 A;  5L8D A;  2ALU A;  2XXU A;  3EPE A;  3THI A;  4P11 A;  1NL5 A;  1ZBM A;  1YCJ A;  3V8X B;  4EQ7 A;  3S9L C;  3JV9 A;  3CHG A;  1MQH A;  1S50 A;  3CSG A;  1MM6 A;  2XXY A;  3KEI A;  4FED A;  5DYH A;  3LC8 A;  2UVG A;  4DXU A;  1QW0 A;  4JXI A;  3TCF A;  1P1N A;  4N13 A;  1LAH E;  3ZSF A;  1N3W A;  2THI A;  1MXZ A;  3LR1 A;  1MQD A;  4IO7 A;  5EYF A;  1Y3Q A;  2VP1 A;  1LCF A;  1JW1 A;  1B7H A;  4O3C A;  4TLM B;  1TWY A;  3GXA A;  3PPR A;  1EH3 A;  1D9V A;  2DWI A;  2P2A A;  3A3U A;  3UK4 A;  1A40 A;  2VOZ A;  3C31 A;  1B52 A;  3VDF A;  2XX7 A;  3SEY A;  4G8H A;  3MC2 A;  2F8D A;  2QL3 A;  3I6V A;  1BP5 A;  3EQ1 A;  1FQF A;  1MPB A;  1P99 A;  3G3J A;  3O66 A;  4MBP A;  4TQU Q;  3MP6 A;  2F78 A;  1A55 A;  2F36 A;  4QSD A;  1DMB A;  4DXB A;  1ZTY A;  1PDA A;  4QF9 A;  5I2N A;  1B9J A;  2A5T B;  2AL4 A;  2Y84 A;  5ICT A;  1MXY A;  2XX9 A;  3DM0 A;  1LAG E;  3S4U A;  4ZED A;  4Q8R A;  3MZB A;  1H45 A;  3PUV E;  2HEU A;  3S9M C;  2Z8F A;  3U1O A;  2NUV A;  4WED A;  1YAE A;  3H3G A;  4GOT A;  4ZZE A;  3K4U A;  4ZZA A;  5H8N B;  4G77 A;  4LP2 B;  2HZL A;  2QJE A;  4RJZ A;  3MJN A;  2OK2 A;  3PPN A;  2XD3 A;  4YKJ A;  4R72 A;  4O3A A;  4QFN A;  3RY3 A;  1H43 A;  2GHB A;  4NF8 A;  3RT8 A;  1QKB A;  5IKB A;  4U2R A;  4OFJ A;  2Y7W A;  1LBB A;  3FD3 A;  4R6K A;  2XXI A;  3BBR A;  4KR5 A;  4DE8 A;  1XC1 A;  2FA7 A;  3MPK A;  3Q29 A;  1US4 A;  1WVJ A;  4IY5 A;  4LZ5 A;  2DWJ A;  4ZE9 A;  2HAU A;  3FXQ A;  5FHN A;  4RPN A;  1PBQ A;  3MVY A;  1LAF E;  1NNK A;  1Y1Z A;  5AA2 A;  2V93 A;  3CVG A;  2OWT A;  1MY4 A;  2CZL A;  2VD3 A;  2ZXT A;  3IO4 A;  2FNC A;  2GRV A;  4G2Z A;  4XTC Q;  4BDM A;  2O84 X;  1DPP A;  3IOU A;  4JBZ A;  1Q1K A;  3B7D A;  3PGF A;  2ZMB A;  3TUS A;  3PU5 A;  2RCB A;  3OEL A;  1PC3 A;  1Y4T A;  2NWJ A;  5CBR A;  4PFT A;  2F35 A;  4H0W A;  3K01 A;  1FTJ A;  4F22 A;  5JEI A;  3KGC A;  1MY2 A;  3PPQ A;  4LQ5 A;  3KSJ A;  5FTI A;  1FW0 A;  4F3P A;  1PB9 A;  5CMB A;  1DTZ A;  5JTY A;  1FQE A;  4ISU A;  1A99 A;  3IO6 A;  3MW0 A;  1D3K A;  4KYS A;  3PMW A;  3Q28 A;  1ZJL A;  1TT1 A;  2O6A A;  5FTH A;  1NMU A;  1P1O A;  1R6Z A;  4K3F A;  3OEK A;  2I3V A;  4NF5 B;  2ZYO A;  4I62 A;  3H7M A;  3L6H A;  5DVF A;  2DVZ A;  1ZIU A;  4U1O A;  3DRI A;  4IO2 A;  4QRZ A;  1MS7 A;  1B4Z A;  1QUI A;  2M8C A;  1MY3 A;  3C34 A;  4IO4 A;  1B5I A;  4OES A;  4HCY A;  2AIX A;  4GFR A;  1O64 A;  4ECF A;  1QJM A;  5I58 A;  2F6G A;  1SD3 A;  4FAJ A;  1FQB A;  2AYS A;  2QMX A;  3K6V A;  3QIM A;  3OOA A;  3TQW A;  1FTK A;  1Z7M E;  2QS4 A;  3LUY A;  1M5F A;  4POW A;  1IXG A;  3D4G A;  1BTJ A;  3HHG A;  4P0I A;  4ZEK A;  4QSE A;  4BDO A;  2XXX A;  1D4N A;  1LAX A;  2F7C A;  4AB6 A;  2OCU A;  3IL1 B;  4QSC A;  4NMY A;  3TFL A;  4ZDM A;  1ZU0 A;  3MVX A;  4G4P A;  5L9O A;  5I57 B;  1OMP A;  4ZEF A;  1TXF A;  4UA8 A;  3FGS A;  1MPD A;  1Y1M A;  2DWA A;  3SES A;  2Z8D A;  3QYT A;  1RYX A;  1AH5 A;  1B40 A;  2PBW A;  2Q88 A;  3KOT A;  3HHF A;  3MZ9 A;  1SW2 A;  2UYE A;  4PET A;  4NF6 B;  1AIV A;  2REJ A;  3RTW B;  2GHA A;  1LST A;  1UQW A;  1PB7 A;  1QVS A;  2FYI A;  2KLF A;  2O69 A;  3GBB A;  3KOS A;  4KD5 A;  4EQ9 A;  5KCJ B;  1H44 A;  1FQC A;  2Y7K A;  4OQO A;  3DRK A;  3K0V A;  2F97 A;  2DVC A;  3O97 A;  3TCG A;  4G68 A;  4U22 A;  3JYR A;  2BJJ X;  3T9H B;  5K2X A;  3G3F A;  3EHS A;  5L9M A;  1MXU A;  4EDP A;  3IB2 A;  4EUO A;  4JWX A;  3ZS6 A;  3IJX B;  3V83 A;  4LQ2 A;  4JWO A;  1XVY A;  4YU0 A;  1TFD A;  2Y7R A;  2GFE A;  4X9T A;  4EF2 A;  5F1Q A;  2E1S A;  4F2Q A;  3SEX A;  3LVU A;  3VVD A;  3RT6 B;  3SEV A;  2DS9 A;  4GWO A;  2ESN A;  3Q25 A;  3R26 A;  4X48 A;  1B5J A;  1IEJ A;  1PEB A;  4FIM A;  3HST A;  4PFY A;  1BKA A;  5ICQ A;  2E0S A;  2Y7I A;  4KHZ E;  3VE1 B;  4F2O A;  5H8Q B;  5ITP A;  2WOL A;  2Q2A A;  4NF6 A;  2O68 A;  3TYH A;  5KDT A;  3FXU A;  3OEN A;  3MP8 A;  3O9P A;  4LZ7 A;  3TOD A;  3MP1 A;  1M5B A;  5TU0 A;  4JSD A;  3IJO B;  4DDD A;  1XS5 A;  1PBP A;  4BDR A;  3D4C A;  1ELJ A;  3SER A;  4KQP A;  4F3B A;  5I57 A;  4U4S A;  1JW4 A;  2QSX A;  3RNN A;  4YAH X;  5TPA A;  2Q89 A;  2YPN A;  4YB7 A;  1NH8 A;  4YKK A;  1UIU A;  3UA8 A;  3H6V A;  2IEE A;  3T9X B;  2DQV A;  4TOZ A;  3TEL A;  2NXO A;  5A5X A;  4HS7 A;  3UGW A;  1BLF A;  1FQA A;  1R1N A;  1JEU A;  3C9H A;  3C36 A;  1B3F A;  5IAI A;  1YPN A;  1VFD A;  2F7A A;  4MH5 A;  4Z7E A;  4OFL A;  5I59 A;  3TPA A;  3DLN A;  2UVH A;  5AA2 D;  4R75 A;  1IIT A;  1PB8 A;  4H5G A;  3M8U A;  3KZG A;  3M3K A;  5I59 B;  1XVX A;  1P1Q A;  3F11 A;  1OLA A;  4PQJ A;  4ZE8 A;  4Q30 B;  2W7Y A;  1B6H A;  4LON B;  4HTG A;  5I2N B;  3S2V A;  4H67 A;  1USY H;  2R71 A;  3N26 A;  3USD A;  4N07 A;  1I6B A;  2IA4 A;  2ABH A;  4PE5 B;  2D5W A;  3OMB A;  5H8Q A;  2B3F A;  3DP4 A;  2G29 A;  2DSF A;  3MPL A;  4KCC A;  3T93 B;  4YB6 A;  3PPO A;  2RCA A;  3TDJ A;  4NE4 A;  1N84 A;  1Y9U A;  4TLL B;  1SYI A;  2RF1 A;  5ISU A;  3OEM A;  1LFH A;  2DYX A;  2H4I A;  2V84 A;  1MQJ A;  2Z23 A;  3UOR A;  1DPE A;  3GLB A;  5CRY A;  3RPW A;  3SKP A;  2O7I A;  1DOT A;  3MQ9 A;  3RYB A;  1VSO A;  2B4L A;  3OD7 A;  4OTE A;  5B7D A;  1LB9 A;  1LB8 A;  1QUL A;  1EU8 A;  2PYY A;  4M4G A;  4H8I A;  2P1S A;  5ELV A;  5BUU A;  1MH3 A;  5CMM A;  5H8F A;  3U92 A;  3KN3 A;  5I58 B;  2XD2 A;  1OLC A;  3ECR A;  2A5S A;  4GLI A;  3EHU A;  1B1H A;  1SW5 A;  4XXU A;  3MAM A;  3H03 A;  2I4C A;  3GBA A;  4U1Z A;  4LA9 A;  4E0X A;  1B4H A;  3FAT A;  4AQ4 A;  2UVI A;  3C4M A;  5H8N A;  3KJ7 A;  3U93 A;  3FVG A;  5TPA B;  1A7L A;  4NF5 A;  3H06 B;  3OO7 A;  1SQY A;  4R73 A;  4E0W A;  2O7U A;  1VE4 A;  1Y20 A;  2I4B A;  1HSJ A;  1IXI A;  3PUX E;  5CBS A;  2NVU B;  2PT2 A;  3IB0 A;  4H5F A;  4BDN A;  4YMB A;  4F3S A;  4F18 A;  3TTK A;  1Y3N A;  1JVY A;  1SYH A;  1MDQ A;  1US5 A;  3IK6 B;  3PAM A;  4IY6 A;  2Q8J A;  2ONK E;  1ZKB A;  2VD2 A;  1SVX B;  1SDX A;  4GRK A;  2ZNS A;  4RYA A;  5CI5 A;  3K00 A;  3E3K A;  1LFG A;  5HPQ A;  3PPP A;  3G3I A;  4I1D A;  4P0G A;  3S9E A;  3P7I A;  4MLV A;  1FTO A;  3KN8 A;  2R9J A;  3LSL A;  3KBR A;  3M3L A;  4GF8 A;  4XKP A;  2HXW A;  3OXN A;  3W9W A;  3FAS A;  1T0K A;  1O63 A;  1QKA A;  4F1V A;  2DXR A;  4IB2 A;  3CI8 A;  3H6T A;  1JVX A;  1QUK A;  4ZEI A;  4H6D A;  4ZS9 A;  1GV8 A;  4ONY A;  3CSB A;  1O7T A;  2DE2 A;  4RXL A;  1GR2 A;  5DT6 A;  3G3H A;  2XXP A;  3RLF E;  1NFT A;  2I0B A;  2YJP A;  3KG2 A;  4G68 B;  3G3G A;  4EF1 A;  3BFU A;  2DE3 A;  3BFT A;  4IGR A;  3O6P A;  5A5X B;  3MBP A;  1GGG A;  2F6P A;  4OEV A;  1DTG A;  1H76 A;  1S9T A;  1IZ1 A;  1USY E;  3EN3 A;  4KCD A;  3TKD A;  1OVT A;  2RIN A;  3CFX A;  1WOD A;  3PV0 E;  3KN7 A;  4NF4 B;  1IXC A;  3IOR A;  2B65 A;  4XKN A;  3FV2 A;  5H8F B;  1HSL A;  3O28 A;  3CFZ A;  2PT1 A;  3C33 A;  1M5D A;  4UAC A;  4RNS A;  3MZ1 A;  2VHA A;  4OEN A;  4F19 A;  5H8S A;  5AA2 B;  3OO6 A;  1DSN A;  4XKR A;  2XXT A;  2ZYM A;  3IB1 A;  4O3B A;  3K6X A;  1Y4C A;  4F29 A;  4NWD A;  2DXY A;  2O51 A;  1WDN A;  2RC7 A;  4OFO A;  3CG3 A;  4NF4 A;  1I6Q A;  1N0T A;  4ELR A;  1IIW A;  1POY 1;  2R6G E;  2ZYN A;  1NNT A;  3CFL A;  4R9F A;  3T9V A;  3VLW A;  3SEW A;  2H25 A;  3IR1 A;  3H6W A;  3HO7 A;  1B2H A;  1OQH A;  3IOW A;  1OVB A;  2HZK A;  3RN8 A;  4WXJ A;  4RY1 A;  4EXK A;  4I8C A;  4Q0C A;  1GVC A;  1LLS A;  2UVJ A;  5J1D A;  3PMX A;  4OHN A;  2V3U A;  4MF3 A;  4RPO A;  1B58 A;  1F9B A;  3K6W A;  2HFB A;  3FJG A;  5DEX A;  3CIJ A;  3QK6 A;  4GD5 A;  4I9D A;  3T9U A;  3WAE A;  4AB5 A;  5AA4 B;  4DZ1 A;  4ZEC A;  4NED A;  4FEC A;  3T22 A;  5CMC A;  3Q26 A;  1MXW A;  3FIR A;  4LAT A;  5CC2 A;  2F7B A;  1AL3 A;  3DRF A;  3LSX A;  1RKM A;  2HCA A;  3BKI B;  3LSF B;  4GQO A;  4YZZ A;  1LBC A;  2OJT A;  3V89 B;  1B3H A;  4R2F A;  4JWY A;  4C1U A;  1Y3P A;  4GXA A;  1UTH B;  2Z22 A;  3LSW A;  3K2D A;  3N5L A;  1CB6 A;  3OSQ A;  3C35 A;  3TTL A;  1SBP A;  2QS3 A;  3W15 C;  5I2K A;  3U8Q A;  3DRG A;  4GL8 A;  4PFW A;  3T96 B;  2WOK A;  1OQG A;  3N94 A;  4IGT A;  1M5E A;  1MQI A;  2HAV A;  2XXQ A;  3FZV A;  3K1P A;  3MVW A;  3DP8 A;  3HPI A;  3IAZ A;  4LZ8 A;  4OZ9 A;  3QAX A;  4BDQ A;  2B4M A;  1IUD A;  3I3V A;  4RK9 A;  4KPT A;  2X7P A;  3MVZ A;  5KDT B;  2WKY A;  1D9Y A;  4ELO A;  4PP0 A;  4HCW A;  2DWH A;  3UP9 A;  1LGB C;  4POX A;  3PMV A;  1LCT A;  2WOP A;  4FAT A;  1SI1 A;  3O2A A;  4OMB A;  2QRY A;  4DCY A;  5K2Y A;  4R6Y A;  1IXH A;  4H65 A;  4YB5 A;  1JNF A;  4ESW A;  1JQF A;  4FE8 A;  4R2B A;  3VVF A;  4R9G A;  4F1Y A;  5AA3 A;  1ANF A;  4RK2 A;  3FTO A;  1MH4 A;  1B3E A;  3OO9 A;  3KJT A;  4YIC A;  3R6U A;  3SDF A;  4BLA A;  4DLD A;  5M2V A;  5LOM A;  2H5Y A;  2OWS A;  1P1U A;  3FUZ A;  3RQT A;  3HV1 A;  4OWD A;  4YKP A;  2ONR A;  1YTV A;  1M5C A;  4NWC A;  5DTB A;  2I58 A;  4G8N A;  3K6U A;  2UYF A;  1B0H A;  1HSE A;  3A3C A;  4YMA A;  2LAO A;  4F31 B;  1JET A;  1I6A A;  3ZKK A;  3MWB A;  1SW1 A;  3E4R A;  2Y7P A;  4GXS B;  4OXV A;  3R7X A;  3ILT B;  3TEP A;  3MUQ A;  1SW4 A;  2DOJ A;  2ZNT A;  5KCJ A;  3VVE A;  1A54 A;  1OIB A;  3OO8 A;  4G68 C;  4F39 A;  3I5O A;  3FXR A;  4DCX A;  5H8H B;  4C1T A;  4GIZ A;  2OBG A;  1URS A;  2F34 A;  3TZA A;  4ELP A;  4EXL A;  3KFM A;  2ZNU A;  4QHQ A;  1UTB B;  1ZLQ A;  1N7X A;  1ATG A;  2HQ0 A;  2XHD A;  4QFO A;  1N76 A;  4U23 A;  5F7V A;  5FHO A;  5AA1 A;  2Q9T A;  1RYO A;  3O29 A;  3SEU A;  1A8E A;  2XX8 A;  1P1W A;  3DEL B;  1MXV A;  1NKX A;  4XIG Q;  1KWH A;  4F3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...