1B9JA

Oligo-peptide binding protein (oppa) complexed with klk
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
517
structure length
517
Chain Sequence
b'ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
total genus 190
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b9jA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b9jA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b9jA02
5ICQA 4IO7A 5JEIA 3A3CA 3TYHA 4RK9A 3W9WA 4XKRA 2UVJA 1MXUA 4HCYA 3THIA 1LAHE 5DEXA 1A54A 1MY3A 4NWCA 2O7UA 3U1OA 1XHYA 1FTOA 4P0GA 1B51A 3CFXA 2QS3A 1LBCA 2Y7PA 3O66A 1Y3QA 1MXXA 2I0BA 4R2FA 4LZ8A 4XKNA 4XXUA 2QS4A 3FVOA 4EXKA 3FTOA 2I0CA 5FTHA 3PGFA 3KN3A 3ZSFA 2X7QA 5I58A 5TP9A 2Q8JA 3GXAA 2DXRA 3CSBA 1MPDA 5KZTA 2V3UA 4GQOA 3S9LC 1LCTA 2Z8FA 4XKPA 5AA2B 4ZECA 3T66A 4ZEIA 3IORA 4ZE9A 1I69A 3FUZA 3DELB 2Q9TA 4DDDA 1MDP1 5KDTB 4HTGA 1BLFA 3G3GA 4JXIA 4LP2B 4IB2A 1RKMA 4R9FA 4R6HA 3SEYA 1NKXA 1Q1KA 4IO4A 2GRVA 2NWJA 4KHZE 3MP6A 3KEIA 1XT8A 3FJGA 5FHNA 5ITPA 1VFEA 4M4GA 2F36A 2XD3A 4JWYA 4QHQA 3K1PA 3KJ7A 2Z23A 4FECA 4H6DA 2DP8A 4DXCA 1FTJA 3KJTA 2PVUA 5I2NB 1JQFA 1P1OA 2H98A 3SEUA 5I59A 4KYSA 2B4LA 3SEXA 1MDQA 1P1WA 4PP0A 4RY1A 1AIVA 1NNFA 2OCUA 1B9JA 3DRIA 4OEVA 1IXHA 3VFJA 3B6QA 4PFUA 2DVCA 3USDA 3QYTA 2W7YA 3KOTA 4OENA 5FHOA 1PDAA 2XXHA 1O7TA 2RKMA 3C35A 1YPNA 5AE4A 3DRKA 3Q28A 1Z7NE 2NUVA 3MZ1A 3MUQA 2ONKE 4R72A 2OLBA 5L9MA 2H25A 1DTGA 3H4ZA 3A3UA 3H6VA 4H5FA 3PUWE 1PEBA 3L6HA 1MPBA 4H65A 2E0SA 3IOVA 1ZBMA 4GOTA 3FVGA 1Y3PA 4U2RA 5F1QA 5DVJA 1WDNA 3AXFA 3U93A 5KDTA 4JWXA 3K6UA 1ZLQA 3KOSA 4IO2A 3U94A 4YKIA 4O3AA 3RQTA 2RINA 3OEKA 4EF2A 4G8HA 4QF9A 2H4IA 2GH9A 2LAOA 5EYFA 2XXYA 3MP1A 3K0VA 1LGBC 1XC1A 4TQUQ 3B7DA 2DWIA 3MVWA 5DTBA 3VLWA 4NF8B 1LFGA 2ZNSA 2D3IA 2YPNA 1I6QA 2H99A 2V3TA 3P7IA 3GBBA 5A5XB 3TDJA 1B5IA 4C1UA 1OLAA 4F1VA 4OZ9A 2AL4A 4BDNA 3PUVE 1GV8A 3OMBA 4OYVA 4OQOA 2XXRA 5CBSA 2WOPA 3K4UA 1LB9A 3DRGA 1WVJA 3UK4A 3RY3A 5FHMA 3T9UA 4F22A 4ZEBA 1PC3A 4DXBA 4F19A 3N6TA 4GFRA 4KCCA 4BLAA 3LR1A 1QJMA 4NTLA 3HCQA 1TT1A 3S9MC 1IXCA 4LQ5A 3M3FA 3K6WA 5LOMA 2DQVA 1TXFA 1B6HA 4I9DA 2XXQA 4MFIA 2ZMBA 4X1DA 2I49A 2Z22A 2B4MA 4PFTA 4JBZA 3T93B 4XIGQ 3LSXA 3MZBA 5TU0A 3I6VA 4QFLA 3CG1A 3GZGA 2I3VA 1Y1MA 2DE3A 4AQ4A 3OXNA 2XXIA 1L5TA 4OMBA 4GL0A 3FASA 2HFBA 2VGQA 2VD3A 3EPEA 5CM6A 4NF8A 3ODBA 3M3LA 3OSRA 3QAXA 1N04A 2B3FA 3G3IA 2WKYA 4RXLA 5AA3A 2DWJA 3DRHA 2HEUA 3DP6A 2ZYOA 1WODA 4U1OA 3IOUA 3H6UA 4NF5B 4R6YA 3K6VA 1JW1A 3KN8A 4NF4B 4OETA 3N5LA 3T9VA 2RCBA 1BIYA 4X48A 3N6UA 4R2BA 4F18A 4F3GA 1PB9A 5IKBA 2VHAA 2A5TB 4BDQA 2BJJX 1GGGA 4F3SA 4KR5A 3RT6B 1JVYA 1VSOA 2O1LA 3KGCA 1D9YA 3UGWA 3C34A 3C31A 4YICA 1IIWA 4R74A 1DOTA 2GHAA 1B32A 3ZKKA 3DRFA 3DM0A 2NVUB 1ZJLA 2PT2A 3CHGA 2ONSA 4DCXA 1SYHA 4OTEA 4F3BA 4ZDMA 1US5A 1FCKA 4DLDA 4KYDA 2XX8A 2QS2A 1D9VA 4IY5A 1B1XA 1H3DA 1HSJA 5ELVA 4LZ7A 1DPEA 3LSWA 5DVIA 4RNSA 3IOTA 1AL3A 1QVSA 2R71A 1B3FA 4G2ZA 3MZ9A 2AYSA 5B7DA 4IGRA 5HBCA 3CIJA 1JVXA 4F2QA 4JB7A 3PUZE 1GTKA 3TCFA 1BP5A 4R73A 5CMCA 1SW1A 5B70A 2O69A 4NF4A 3HPIA 4N07A 2R9JA 3W15C 3TCHA 5JTYB 3F11A 4MBPA 4E0WA 1OMPA 4NF6B 2QMWA 1GR2A 4NEDA 2A5TA 5L8DA 4LUBA 3SERA 1USYE 1HSEA 1LAXA 3MVYA 1AMFA 2F7BA 2DS9A 3MWBA 2F6GA 4FAJA 3PAMA 5HPQA 5CMBA 1B7UA 3C36A 5JK4A 1P1NA 4G68C 3OO6A 1ELJA 3C33A 3PD8A 3N26A 3EHSA 1Z7ME 3TTRA 3TTNA 4JSDA 3PPRA 3BBRA 1MRPA 4DIGA 1JNFA 3H6WA 4U23A 2NXOA 4RA1A 4YB7A 1FQDA 1AH5A 3U8QA 1B58A 2VP1A 5CC2A 2Y7WA 3D4GA 2G93A 3ZS6A 1P1QA 1P1UA 2QSXA 4N13A 2ZYKA 2UVHA 3QIMA 5EHSA 1M5BA 4PETA 2QPQA 4KYEA 5L9OA 2D5WA 2XXWA 1MS7A 1EZ9A 1LAGE 1ZKBA 1JEUA 3FVKA 3WAFA 2F6PA 4P0IA 1B0HA 2RC8A 4EQBA 3FZVA 2F5XA 3HO7A 3QK6A 3K6XA 3T9XB 3H06B 1LSTA 3RTWB 5JTYA 4GIZA 2ZNUA 3O9PA 4NF6A 3Q25A 3BKIB 1QUJA 2O68A 3FV2A 4YB5A 1LB8A 2H5YA 1SW2A 3MJNA 1MQHA 2Y84A 3FXRA 1D3KA 1POTA 2IEEA 3UP9A 2F34A 2CZLA 2WOKA 4G68B 2Y7KA 3OOAA 3DRJA 2HAVA 2I3WA 5AA4B 5TPAB 4OERA 1SYIA 1BTJA 3SEVA 5H8FB 1H45A 1FQEA 4L17A 4I1DA 2O6AA 2XXTA 1B7HA 4U21A 5AA1A 1VE4A 3VLVA 4IO6A 4OVJA 3CFZA 4QSEA 3MBPA 4GVOA 2HCAA 5DVFA 4OESA 3FGSA 4LQ2A 3MAMA 1H76A 1M5CA 1H43A 2FYIA 4QFNA 3PPPA 3VVEA 3RYBA 4LZ5A 4E0XA 5ISUA 2I48A 2ONRA 1PBQA 5AA2A 2HXWA 3MP8A 4R75A 3T9HB 4OWDA 3R6UA 3Q27A 4ND9A 1MY0A 3IAZA 4H0WA 2DE4A 3TUSA 1MH3A 1EH3A 1J1NA 1Y4CA 3GLBA 3KFMA 3C4MA 3L6GA 3V89B 4BDLA 1CE2A 3PU5A 3LBSA 1B5JA 4EXLA 3E3KA 2I6EA 3PMWA 4YKPA 3IO4A 1FTKA 1N7WA 1NMUA 1N3WA 3O97A 3KSJA 5I2KB 4PQJA 1URSA 4X1BA 4I8CA 2D21A 5I2NA 2Z8EA 4Q8RA 3RPWA 4IY6A 1H44A 2DYXA 4GL8A 4YAHX 5L9SA 1FTMA 2RC9A 4G68A 1B3HA 3MC2A 3SDFA 3S9EA 5AA4A 5TPAA 2B65A 1XVYA 1B4HA 5DYHA 4ZZAA 5H8FA 3RNNA 1QUKA 4OHNA 4R6KA 1XOCA 5H8NB 3CRBA 4H5GA 4ZS9A 4FE8A 3H3GA 1MQJA 5ICTA 3QUFA 3GBAA 4ESWA 4MH5A 2GFEA 3S9NC 4KPTA 1US4A 1TWYA 3LC8A 2ZXTA 1DTZA 5KCJB 3ILUB 1R9QA 1I6AA 4LA9A 4DZ1A 3MW0A 1Y1ZA 2OBGA 3K1MA 1JW4A 4BDRA 1FQAA 3U92A 4FEBA 1JW5A 4HCWA 4ELOA 2E1SA 3UORA 3WAEA 4WXJA 4ELRA 3CVGA 1SW5A 3BFUA 3CI8A 3G3KA 1N0TA 1R1NA 4ZE8A 1UTBB 3KG2A 2REGA 2V25A 3VVDA 4HS7A 2P1SA 5I56B 2HAUA 5DT6A 2H9BA 2Q89A 4IO3A 3IO6A 4GRKA 3FIRA 5I2KA 2UVIA 4N6PA 3TTKA 2YJPA 3O28A 2V3QA 1OIBA 2PBWA 2QJEA 4F31B 3B6WA 5A5XA 2OJTA 4ECFA 1MPCA 4LONB 1O64A 3VLUA 3V83A 3IB1A 1PBPA 4LATA 1MY4A 3SKPA 1P99A 3PPQA 2XHDA 4F1YA 1B3LA 5H8NA 3RT8A 3W9VA 2XD2A 3TZAA 3MVXA 1URGA 2F78A 2PT1A 2X26A 4NWDA 3RTFB 3UN6A 3FVNA 4ZEKA 1MXVA 3LUYA 2WOLA 4RYAA 1NL5A 4ZZEA 4OXVA 4GWOA 2DWHA 1Y4TA 4RPOA 2THIA 1ZIUA 2UXAA 2HQ0A 4F39A 3KBRA 1FQCA 4HW8A 3K2DA 4Q30B 1MQDA 2P2AA 3PUXE 1MXZA 1LBBA 1UIVA 3ECRA 2Q2CA 4H8JA 4WKMA 3A09A 3FV1A 2I4BA 3CR9A 3E4RA 1NFTA 1N3XA 3K1NA 3IJXB 3LSFB 5H8HB 1UTBA 1IXIA 3TTLA 3V8XB 1ANFA 1FQBA 2QMXA 2ZYNA 1OQGA 1SBPA 4WEPA 3OSQA 1OQHA 5I56A 4ELQA 1MQGA 2FNCA 3T96B 1LCFA 4POWA 3MVZA 1RYOA 5TP9B 3O29A 1A55A 5I84A 3O2AA 1QULA 4M1VA 4Z7EA 4AB6A 3H7MA 4H8IA 3IL1B 4DXUA 4G4PA 4NF5A 1MM6A 2XX9A 1FQFA 1MY1A 2X7PA 1DSNA 4F3PA 1Q35A 1RYXA 4PE5B 2CMOA 4BDOA 3N94A 4F29A 4MLVA 1QUIA 4EQ7A 1EZOA 3EN3A 3VVFA 1B0LA 3M8UA 4F1UA 1YCJA 2O51A 2F7AA 3FXQA 3KN7A 3G3JA 2XXUA 4U22A 2F97A 3OEMA 2ABHA 1B3GA 4LVQA 4NMYA 1KWHA 4RJZA 4ESXA 1SI1A 4OFJA 4EUOA 5I59B 3CSGA 4IO5A 4GD5A 4GXSB 3G3FA 2M8CA 1MQIA 2O84X 3OO7A 2RC7A 5M2VA 1UTHB 3O6HA 5H8HA 1SVXB 1A8FA 5F7VA 1B46A 2PX1A 3K01A 3PMVA 1N7XA 4TOZA 4UACA 4PFYA 1QW0A 3I3VA 3RN8A 3CFLA 1B52A 3OO9A 1POY1 1IXGA 1HSLA 1YTVA 1LFIA 3FATA 3IB0A 3O6IA 2FA7A 1MM7A 4K3FA 3JV9A 2AL5A 4C0RA 4RPNA 2DVZA 2Q2AA 3C32A 3ILTB 1Y20A 1SDXA 1UQWA 4G8MA 5ITOA 2G29A 1URDA 3HN0A 2OK2A 5CMMA 1Y9UA 4KFQA 1MY2A 2R6GE 3CG3A 3Q26A 1TFAA 2DOJA 1GVCA 3EQ1A 1NH7A 1MH4A 4Z0IA 1LLSA 2Z8DA 3PPOA 1OVBA 4QSDA 3SESA 3MQ9A 2F8DA 2F35A 3TODA 2UYEA 1B2HA 1SQYA 3TQLA 3ONMA 1VR5A 2YLNA 4C1TA 3H03A 3U72A 1SW4A 3EHTA 4THIA 1IQ7A 3M3KA 3IB2A 3FXUA 5BWJA 3TELA 2I58A 4IGTA 1I6BA 4MF3A 3HHFA 1ZTYA 2V84A 3IR1A 1OVTA 1S50A 1DPPA 3RGYA 4F2OA 1M5DA 3SETA 2F7CA 3E13X 1S9TA 4FEDA 1TFDA 1UTHA 1NNKA 4OFLA 1F9BA 3QXMA 3MPKA 3FD3A 1R6ZA 4RK2A 1PB8A 3PMXA 1SD3A 3D4CA 1M5FA 4H1XA 4JDFA 3T22A 2QRYA 2OZZA 5H8QB 4O3BA 3TEPA 4XTCQ 1USYH 3B6TA 4UA8A 3O6GA 2O7IA 3E9XA 3RYAA 2RF1A 1MXYA 3TMGA 4DCYA 4JWOA 2ALUA 4DE8A 2VOZA 5AA2D 4YKKA 5J1DA 1Y3NA 1IITA 2B3BA 5CMKA 2O1MA 1XS5A 1IEJA 1M5EA 1ZU0A 4EF1A 2DE2A 3K02A 4X9TA 3RUMA 1MXWA 3QSLA 1A40A 4ONYA 3VXBA 1D4NA 3VV5A 3TAJA 3DP4A 1N76A 4FORA 1B40A 3G7WA 2ZYMA 4QSCA 4MLQA 1ZMGA 1YAEA 1A7LA 1NNPA 1AOVA 4NE4A 2ANJA 3Q29A 2PMSA 2I4CA 1II5A 3EF7A 1EU8A 2DSFA 4ZEFA 1OLCA 2ESNA 1JEVA 3MPLA 3QUJA 1IUDA 3TPAA 4OEUA 2UVGA 3OENA 3G3HA 4YU0A 3TQWA 3OD7A 4ELPA 3RLFE 3IX1A 4Q0CA 4QFOA 3S2VA 3KZGA 1NNTA 4PFWA 3O6PA 3C9HA 1LFHA 2XXPA 4KI0E 2DWAA 3K00A 3FJ7A 4YMAA 5H8QA 1B5HA 3FJMA 2IA4A 3IOWA 4FJPA 5EHMA 3TKDA 4QRZA 4I62A 4P11A 4QFKA 4H67A 1BKAA 4AB5A 1B7ZA 2HZKA 3I5OA 5BUUA 5CBRA 1ATGA 1B3EA 3PD9A 1N84A 5K2XA 1B05A 3H6TA 3R26A 4GLIA 3LSLA 3PV0E 4TLMB 3DLNA 2AIXA 2Y7RA 4OFOA 2GHBA 3JYRA 3OELA 4U4SA 3IK6B 1PB7A 2PYYA 4WEDA 1B4ZA 2KLFA 1EZPA 5I57B 4YZZA 3HHGA 1IZ1A 4G77A 3UA8A 1A8EA 3HSTA 1FW0A 1S7YA 4XKQA 4R9GA 1LAFE 1R9LA 3S4UA 3VE1B 4GXAA 1SI0A 2P0SA 4ISUA 2UYFA 4KCDA 5CRYA 1O63A 3TCGA 4GF8A 4QFPA 4ZEDA 5HM4B 5DEXB 4EQ9A 3UIFA 5CI5A 2OWSA 4U4XA 4YB6A 3KSXA 4FATA 4Q5TA 3LVUA 2DXYA 4JSOA 5KCJA 3DP8A 2RCAA 4KQPA 3VDFA 4FIMA 2Q88A 3R7XA 4EDPA 4YKJA 1FTLA 1T0KA 1MG1A 4U1ZA 3HV1A 5K2YA 1JETA 4TLLB 2NOOA 1NH8A 3EHUA 5IAIA 3TFLA 2Y7IA 2HZLA 2XX7A 2QS1A 4G8NA 1A99A 1DMBA 3V5AA 1QKBA 2QL3A 2REJA 4O3CA 3VXCA 1VFDA 2XXVA 2XXXA 3IJOB 4KD5A 2VD2A 5H8SA 5I58B 2ZNTA 1B1HA 1XVXA 3ZKLA 5I57A 3TTMA 3BFTA 1QKAA 2OWTA 3PUYE 1UIUA 1CB6A 3PPNA 2A5SA 4YMBA 4BDMA 3OO8A 5FTIA 3SEWA 2V93A 4POXA 3JZJA
chains in the Genus database with same CATH superfamily
5ICQA 4IO7A 5JEIA 3A3CA 3TYHA 4RK9A 3W9WA 4XKRA 2UVJA 1MXUA 4HCYA 3THIA 1LAHE 5DEXA 4FBPA 1A54A 4N81A 1MY3A 4PBQA 4NWCA 2O7UA 4O7IA 3U1OA 1XHYA 1FTOA 4P0GA 1B51A 3CFXA 1IMEA 4HXVA 2QS3A 1LBCA 2Y7PA 1KA1A 3O66A 1Y3QA 1MXXA 2I0BA 4R2FA 4O7MA 4LZ8A 4XKNA 4XXUA 2QS4A 1RDZA 4MNCA 3FVOA 4EXKA 3FTOA 4NAPA 2I0CA 5FTHA 3PGFA 3KN3A 3ZSFA 2X7QA 5I58A 5TP9A 2Q8JA 3GXAA 5T3JA 2DXRA 4O94A 3LUZA 2Y5LA 3CSBA 1MPDA 5KZTA 2V3UA 4GQOA 3S9LC 1LCTA 1DCUA 1NUWA 2Z8FA 4XKPA 5AA2B 4ZECA 3T66A 4ZEIA 2F3DA 3IORA 4ZE9A 4GWWA 1I69A 3FUZA 4OVTA 3DELB 2Q9TA 4DDDA 1MDP1 5KDTB 4HTGA 1BLFA 4AS4A 3G3GA 4JXIA 4LP2B 4IB2A 1RKMA 4N15A 4R9FA 4R6HA 3SEYA 1NKXA 1Q1KA 4IO4A 2GRVA 2NWJA 4GWZA 4KHZE 3MP6A 3KEIA 1XT8A 3FJGA 5FHNA 5ITPA 1VFEA 4M4GA 2F36A 2XD3A 4JWYA 4QHQA 3K1PA 3KJ7A 2Z23A 4FECA 4H6DA 2DP8A 4DXCA 1FTJA 3KJTA 2PVUA 5I2NB 1JQFA 1P1OA 2H98A 3SEUA 5I59A 4KYSA 2B4LA 3IFAA 3B8BA 3SEXA 1MDQA 1P1WA 2ZZWA 4PP0A 1FPLA 1FPBA 3LV0A 4RY1A 1AIVA 1NNFA 2OCUA 1LEVA 1B9JA 3DRIA 4OEVA 1IXHA 3VFJA 3B6QA 4PFUA 2DVCA 3USDA 3QYTA 2W7YA 3KOTA 4OENA 5FHOA 1PDAA 1IMFA 1NUZA 2XXHA 1O7TA 2RKMA 4MIJA 3C35A 1YPNA 5AE4A 3DRKA 2FBPA 3Q28A 1Z7NE 2NUVA 3MZ1A 4XEQA 3MUQA 4X04A 2ONKE 4R72A 2OLBA 5L9MA 2H25A 1DTGA 3H4ZA 3A3UA 3H6VA 4H5FA 3PUWE 1PEBA 3L6HA 1MPBA 4H65A 2E0SA 3IOVA 1ZBMA 4GOTA 4OVQA 3FVGA 1Y3PA 4U2RA 5F1QA 5DVJA 1WDNA 3AXFA 3U93A 5KDTA 4JWXA 3K6UA 1ZLQA 3KOSA 4IO2A 3U94A 5IZ3B 4YKIA 4O3AA 3RQTA 2RINA 3OEKA 4EF2A 4G8HA 4QF9A 2H4IA 2GH9A 2LAOA 5EYFA 5EQAA 2XXYA 3MP1A 3K0VA 1LGBC 1XC1A 4TQUQ 3B7DA 2DWIA 3MVWA 5DTBA 4PC9A 3VLWA 4NF8B 1LFGA 2ZNSA 3QMFA 2D3IA 2YPNA 1I6QA 2H99A 2V3TA 4H45A 2WBBA 3P7IA 2CZKA 1FJ6A 3GBBA 5A5XB 3TDJA 1B5IA 4C1UA 1OLAA 4F1VA 4OZ9A 2AL4A 4BDNA 3PUVE 1GV8A 3OMBA 4OYVA 4OQOA 2XXRA 5CBSA 2WOPA 3K4UA 1LB9A 1FSAA 3DRGA 1WVJA 3UK4A 3RY3A 5FHMA 3T9UA 2PFYA 4F22A 4ZEBA 1PC3A 4DXBA 4F19A 3N6TA 4GFRA 4KCCA 4PTKA 1AWBA 3LR1A 4BLAA 1QJMA 4NTLA 3HCQA 1TT1A 3S9MC 1IXCA 4LQ5A 3M3FA 1NV0A 3K6WA 5LOMA 2DQVA 1TXFA 1B6HA 4I9DA 2XXQA 4O8MA 4MFIA 2ZMBA 4X1DA 2I49A 4P1EA 2Z22A 2B4MA 4PFTA 4JBZA 5I5PA 3T93B 4XIGQ 3LSXA 3MZBA 5TU0A 3I6VA 4LN5A 4QFLA 5IZ3A 3CG1A 3GZGA 2I3VA 1Y1MA 2DE3A 4AQ4A 3OXNA 2XXIA 1L5TA 4OMBA 4GL0A 4I3EA 3FASA 2HFBA 2VGQA 2VD3A 3EPEA 1EYIA 5CM6A 4NF8A 3ODBA 3M3LA 3OSRA 4N6KA 1FPKA 3QAXA 1N04A 2B3FA 3G3IA 2WKYA 4RXLA 5AA3A 2DWJA 3DRHA 2HEUA 2P3NA 5I3SA 3DP6A 2ZYOA 1WODA 4OVPA 4U1OA 4NF0A 3IOUA 3H6UA 4NF5B 4R6YA 3K6VA 1JW1A 3KN8A 4NF4B 4OETA 3N5LA 3T9VA 2RCBA 1BIYA 4X48A 3N6UA 2XWIA 4R2BA 4F18A 4F3GA 1PB9A 5IKBA 4PGPA 2VHAA 2A5TB 4BDQA 2BJJX 3BIHA 4P9KA 1GGGA 4F3SA 4KR5A 3RT6B 1JVYA 1VSOA 2O1LA 3KGCA 1D9YA 3UGWA 3C34A 2R8TA 3C31A 4YICA 1IIWA 4R74A 1DOTA 4MCOA 2GHAA 1B32A 3ZKKA 3DRFA 3DM0A 2NVUB 1ZJLA 2PT2A 3CHGA 2ONSA 4N4UA 4DCXA 1SYHA 1FBCA 4OTEA 1FJ9A 4F3BA 4ZDMA 1US5A 1FCKA 4DLDA 4KYDA 2MKZA 2XX8A 2QS2A 1D9VA 1FBFA 4IY5A 1B1XA 4XF5A 1H3DA 1HSJA 5ELVA 4LZ7A 1DPEA 1FTAA 3LSWA 1JP4A 5DVIA 4RNSA 3IOTA 1AL3A 3NOHA 4X8RA 4MX6A 1QVSA 2R71A 1B3FA 4G2ZA 3MZ9A 2AYSA 5B7DA 2CEXA 4IGRA 5HBCA 3CIJA 2PCRA 1JVXA 4F2QA 4JB7A 3PUZE 1GTKA 3TCFA 1BP5A 1G0IA 4P56A 4R73A 5CMCA 1SW1A 5B70A 2O69A 4NF4A 1FBGA 3HPIA 4N07A 2R9JA 3W15C 3TCHA 5LTCA 5JTYB 3F11A 4MBPA 4PGNA 4E0WA 1OMPA 4NF6B 2QMWA 4GWYA 1GR2A 4NEDA 2A5TA 5L8DA 4LUBA 3SERA 1USYE 1HSEA 1LAXA 3FBPA 3MVYA 1FBHA 1AMFA 2F7BA 2DS9A 4H46A 3MWBA 2F6GA 4FAJA 3PAMA 2QVUA 5HPQA 5CMBA 1B7UA 3C36A 5JK4A 1P1NA 4G68C 3OO6A 2XXKA 1ELJA 3FXBA 3RPLA 3C33A 3PD8A 3N26A 5FBPA 3EHSA 1Z7ME 3TTRA 3TTNA 4JSDA 3PPRA 1CNQA 3BBRA 1MRPA 4DIGA 2GQ1A 1JNFA 3H6WA 4U23A 2NXOA 4RA1A 4GX3A 4YB7A 1NUYA 1FQDA 1AH5A 3U8QA 1B58A 4PCDA 2VP1A 5CC2A 2Y7WA 3D4GA 2G93A 3ZS6A 2CZIA 1P1QA 1P1UA 2QSXA 4N13A 1EYJA 2ZYKA 2UVHA 3QIMA 5EHSA 2FHYA 1M5BA 4PETA 1FPGA 2QPQA 4KYEA 5L9OA 2D5WA 2XXWA 1MS7A 1EZ9A 3MYUA 1LAGE 1ZKBA 1JEUA 4GWXA 1Q9DA 3FVKA 2ZZXA 3WAFA 2F6PA 4P0IA 5EQ9A 1B0HA 2RC8A 3MSTA 4EQBA 3FZVA 1DBZA 2F5XA 3HO7A 3QK6A 3K6XA 3T9XB 3H06B 1LSTA 3RTWB 5JTYA 4GIZA 1NV3A 2ZNUA 3O9PA 4NF6A 3Q25A 3BKIB 1QUJA 2O68A 3FV2A 4YB5A 1LB8A 2H5YA 1SW2A 3MJNA 1MQHA 1XI6A 3U65A 2Y84A 4NG7A 3FXRA 1D3KA 2P3VA 1POTA 2IEEA 3UP9A 2F34A 2CZLA 5F24A 2WOKA 4G68B 2Y7KA 5DW8A 3OOAA 3DRJA 2HAVA 2I3WA 5AA4B 5TPAB 4OERA 2Q8MA 1SYIA 1BTJA 3SEVA 4IR8A 5H8FB 1H45A 1FQEA 4L17A 4I1DA 2O6AA 2XXTA 1B7HA 4U21A 5AA1A 1VE4A 2WYPA 3VLVA 4IO6A 4OVJA 3CFZA 4QSEA 3MBPA 4GVOA 2HCAA 5DVFA 4OESA 3FGSA 4LQ2A 3MAMA 1H76A 1M5CA 1H43A 2FYIA 4QFNA 3PPPA 3ROJA 3VVEA 3RYBA 1YYZA 4LZ5A 4E0XA 5ISUA 2I48A 2ONRA 2KR0A 1PBQA 2V4CA 5AA2A 2HXWA 3MP8A 4R75A 3T9HB 4OWDA 3R6UA 3Q27A 4ND9A 1MY0A 3IAZA 4H0WA 2DE4A 3TUSA 1MH3A 1EH3A 1J1NA 5IGAA 1Y4CA 1LBVA 3GLBA 2WYKA 3KFMA 3C4MA 3L6GA 3V89B 4N6DA 4BDLA 1CE2A 3PU5A 3LBSA 1B5JA 4EXLA 3E3KA 2I6EA 3PMWA 2ZZVA 4YKPA 3IO4A 5J16A 1FTKA 1N7WA 1NMUA 1N3WA 3O97A 3KSJA 5I2KB 4PQJA 2HXRA 1URSA 4X1BA 2XWOA 4I8CA 2D21A 2OX3A 5I2NA 2Z8EA 4Q8RA 3RPWA 4IY6A 1H44A 2DYXA 4GL8A 4YAHX 1EYKA 5L9SA 4PAKA 1FTMA 2RC9A 4G68A 1B3HA 3MC2A 3SDFA 3S9EA 5AA4A 5TPAA 2B65A 1XVYA 1B4HA 5DYHA 4ZZAA 5H8FA 3RNNA 1QUKA 4OHNA 4R6KA 1XOCA 3D1RA 5H8NB 4XFEA 3CRBA 4H5GA 4ZS9A 4GX6A 4FE8A 3H3GA 1MQJA 5ICTA 3QUFA 3GBAA 4MH5A 2GFEA 4ESWA 1YZ0A 3S9NC 4KPTA 1US4A 1TWYA 4HE1A 4PE3A 3LC8A 2ZXTA 1DTZA 1FBEA 5KCJB 3ILUB 1R9QA 1I6AA 4LA9A 4DZ1A 3MW0A 1Y1ZA 2FIXA 2OBGA 3K1MA 1JW4A 4P1LA 4BDRA 5IZZA 1FQAA 3U92A 4FEBA 1JW5A 4HCWA 2OWZA 4ELOA 2E1SA 3EKIA 3UORA 3WAEA 4WXJA 4ELRA 3CVGA 1SW5A 3IFCA 3BFUA 3CI8A 3G3KA 4OVSA 1N0TA 1R1NA 4ZE8A 2HPGA 1UTBB 3KG2A 2REGA 2V25A 3VVDA 5EQ8A 4HS7A 2P1SA 4KXPA 5I56B 4N91A 2HAUA 5DT6A 2H9BA 2Q89A 4IO3A 3IO6A 4GRKA 2QFLA 3FIRA 5I2KA 1FBPA 3HFUA 2UVIA 4N6PA 3TTKA 2YJPA 3O28A 2V3QA 1OIBA 2PBWA 2QJEA 4F31B 3B6WA 5A5XA 1YXIA 2OJTA 4ECFA 1MPCA 4LONB 1O64A 4DI3D 3VLUA 3KBZA 2XA5A 1NV5A 3V83A 2FVZA 3IB1A 1PBPA 4LATA 4DI4B 3T1BA 1MY4A 3SKPA 1P99A 3PPQA 2XHDA 4F1YA 4UABA 1B3LA 4OANA 5H8NA 2XWVA 3RT8A 3W9VA 2XD2A 3A29A 3TZAA 3MVXA 1URGA 2F78A 2PT1A 2X26A 4NWDA 4PFRA 3RTFB 3UN6A 3FVNA 4ZEKA 1MXVA 3LUYA 2WOLA 4RYAA 1NL5A 4ZZEA 4OXVA 3E79A 4GWOA 2DWHA 2VPOA 1Y4TA 4RPOA 1NV7A 4GBVA 2THIA 1ZIUA 2UXAA 2HQ0A 4F39A 3KBRA 1FQCA 4PAIA 4NN3A 4HW8A 3K2DA 4Q30B 1MQDA 4PFBA 2P2AA 3PUXE 1MXZA 1LBBA 1UIVA 3ECRA 4HE2A 2Q2CA 4H8JA 4WKMA 3A09A 3FV1A 2I4BA 3CR9A 3E4RA 1NFTA 1N3XA 3K1NA 3IJXB 4MAGA 1FPIA 3LSFB 5H8HB 1UTBA 1IXIA 3TTLA 3V8XB 1ANFA 1INPA 1FQBA 2QMXA 2ZYNA 1OQGA 1SBPA 4WEPA 3OSQA 1OQHA 5I56A 4ELQA 1MQGA 2FNCA 3T96B 1LCFA 4PF6A 4POWA 3MVZA 1RYOA 5A5LA 5TP9B 3O29A 1A55A 5I84A 3O2AA 1QULA 4M1VA 4Z7EA 1IMBA 4AB6A 3H7MA 4H8IA 3IL1B 4DXUA 4G4PA 4NF5A 1VDWA 1MM6A 2XX9A 4GWSA 1FQFA 1MY1A 2X7PA 1DSNA 4F3PA 1Q35A 1RYXA 4PE5B 1IMDA 2CMOA 4BDOA 3N94A 4F29A 1RDXA 4I3YA 4MLVA 1QUIA 4EQ7A 4JVIA 1EZOA 3EN3A 3VVFA 1B0LA 3M8UA 4F1UA 1YCJA 2O51A 2F7AA 4MNPA 3FXQA 3KN7A 2QVVA 3G3JA 2XXUA 4U22A 5EYGA 2F97A 3OEMA 2ABHA 1B3GA 4LVQA 4NMYA 1KWHA 4RJZA 4ESXA 1SI1A 4OFJA 4EUOA 1FBDA 1NUXA 3KC0A 5I59B 3CSGA 4IO5A 4GD5A 4GXSB 4PDDA 3G3FA 2M8CA 1MQIA 2O84X 3OO7A 2RC7A 5M2VA 1UTHB 3O6HA 5H8HA 1SVXB 1A8FA 5F7VA 1B46A 2PX1A 3K01A 4P47A 3PMVA 1N7XA 4TOZA 2BJIA 4UACA 4PFYA 1QW0A 1RDYA 3I3VA 3RN8A 3CFLA 1B52A 2XWKA 3OO9A 5IM2A 1POY1 1IXGA 1HSLA 1YTVA 1LFIA 4MNIA 3FATA 3IB0A 3O6IA 2WEFA 2FA7A 2WBDA 1MM7A 4PBHA 4K3FA 2L5VA 3JV9A 2AL5A 4C0RA 4RPNA 2DVZA 2Q2AA 3C32A 3ILTB 1Y20A 1SDXA 1UQWA 4MHFA 2KQZA 4G8MA 5ITOA 2VT5A 2G29A 4GX4A 1URDA 3HN0A 1IMAA 2OK2A 1FPDA 4HE0A 5CMMA 1Y9UA 5I7IA 4KFQA 1MY2A 2R6GE 3CG3A 3Q26A 4MEVA 1TFAA 2DOJA 2DDKA 1GVCA 3EQ1A 1NH7A 1MH4A 4Z0IA 1LLSA 2Z8DA 3PPOA 1OVBA 4QSDA 3SESA 1LBZA 3MQ9A 2F8DA 4N8YA 2F35A 3TODA 2UYEA 1B2HA 1SQYA 3TQLA 3ONMA 1VR5A 2YLNA 1FPEA 4C1TA 3RYDA 3H03A 3U72A 1SW4A 3EHTA 4THIA 1IQ7A 3M3KA 3IB2A 1NV4A 3FXUA 5IZ1A 4MJOA 5BWJA 3TELA 2I58A 4IGTA 1I6BA 4MF3A 3HHFA 1ZTYA 2V84A 3IR1A 1OVTA 1S50A 1DPPA 3RGYA 4F2OA 1M5DA 3SETA 2F7CA 1D9QA 3E13X 3PTYA 1S9TA 4GWUA 4FEDA 1TFDA 1UTHA 2PFZA 5ESYA 1NNKA 4OFLA 1F9BA 3QXMA 4NHBA 3MPKA 3FD3A 1R6ZA 4N8GA 4RK2A 1PB8A 1NV2A 4NQ8A 3PMXA 1SD3A 2Q74A 4OA4A 3D4CA 1M5FA 4H1XA 4JDFA 3T22A 2QRYA 2OZZA 5H8QB 4MMPA 4O3BA 3TEPA 4XTCQ 1USYH 3B6TA 4UA8A 3O6GA 2O7IA 3E9XA 3RYAA 2RF1A 5LDZA 1MXYA 3TMGA 4DCYA 4JWOA 2ALUA 4DE8A 2VOZA 3BIGA 5AA2D 4YKKA 5J1DA 1Y3NA 1IITA 2B3BA 5CMKA 2O1MA 1XS5A 1IEJA 1M5EA 1ZU0A 4EF1A 2DE2A 3K02A 4X9TA 1QGXA 5ET8A 3RUMA 1MXWA 3QSLA 4N17A 1A40A 4ONYA 1LBXA 5EQ7A 3VXBA 1D4NA 3VV5A 2CZHA 3TAJA 3DP4A 4GBWA 3B50A 1N76A 4FORA 1B40A 3G7WA 2ZYMA 4QSCA 4MLQA 1ZMGA 3T0JA 1YAEA 1BK4A 4PF8A 1A7LA 3SZPA 1NNPA 1AOVA 4NE4A 2ANJA 3Q29A 2PMSA 2I4CA 1II5A 3EF7A 1EU8A 2DSFA 4ZEFA 1OLCA 2ESNA 1JEVA 3MPLA 3QUJA 1IUDA 3TPAA 4OEUA 2FIEA 2UVGA 3OENA 3G3HA 4YU0A 3TQWA 3OD7A 4ELPA 3RLFE 3IX1A 4Q0CA 4QFOA 3S2VA 4QXDA 3KZGA 1NNTA 4PFWA 3O6PA 2Y5KA 3C9HA 2WX9A 4PAFA 1LFHA 4G61A 2XXPA 4KI0E 2DWAA 3K00A 1FPFA 3FJ7A 4YMAA 5H8QA 2VPNA 1B5HA 4PDHA 3FJMA 1FPJA 1FRPA 2IA4A 3IOWA 4FJPA 5EHMA 3TKDA 4QRZA 4I62A 4P11A 1NV1A 4QFKA 4H67A 1BKAA 4AB5A 1B7ZA 2HZKA 3I5OA 1LBYA 5BUUA 5CBRA 1ATGA 1B3EA 3PD9A 1N84A 5K2XA 1B05A 3H6TA 3R26A 4GLIA 3LSLA 3PV0E 4TLMB 3DLNA 2AIXA 2Y7RA 4OFOA 2GHBA 3JYRA 3OELA 4U4SA 3IK6B 1PB7A 2PYYA 4WEDA 3GYYA 1B4ZA 2KLFA 1EZPA 5I57B 4YZZA 3HHGA 1IZ1A 1NV6A 1K9YA 4G77A 5EYHA 3UA8A 1A8EA 3HSTA 2HHMA 4P3LA 1FW0A 4PFIA 1S7YA 4XKQA 1LBWA 4R9GA 1LAFE 1R9LA 3S4UA 3ISPA 3VE1B 4GXAA 1SI0A 2P0SA 4ISUA 1G0HA 1IMCA 2UYFA 4KCDA 5CRYA 1O63A 3E78A 3TCGA 4GF8A 4QFPA 4ZEDA 5HM4B 5DEXB 4EQ9A 3UIFA 5CI5A 4JVCA 2OWSA 4U4XA 4YB6A 5ET5A 3KSXA 4OVRA 4FATA 4Q5TA 1KZ8A 3LVUA 2DXYA 4JSOA 5KCJA 3DP8A 2RCAA 4KQPA 3VDFA 4FIMA 2Q88A 3R7XA 4AS5A 5ET7A 4EDPA 4YKJA 2JJKA 1FTLA 4P8BA 1T0KA 1MG1A 4U1ZA 1K9ZA 3HV1A 5K2YA 5ET6A 2CEYA 1JETA 4TLLB 4NX1A 3KC1A 2NOOA 1NH8A 3EHUA 5IAIA 3TFLA 2Y7IA 4JVDA 2HZLA 1NI9A 3RPLB 2XX7A 1SPIA 2QS1A 4G8NA 1A99A 1DMBA 3V5AA 1QKBA 2QL3A 2F3BA 2REJA 4O3CA 3VXCA 1VFDA 2XXVA 2XXXA 3IJOB 4KD5A 4NGUA 2VD2A 5H8SA 5I58B 2ZNTA 1B1HA 1XVXA 3ZKLA 5I57A 3TTMA 1DK4A 3BFTA 1QKAA 2OWTA 3PUYE 4I40A 1UIUA 1CB6A 3PPNA 2QVRA 2A5SA 1KA0A 4YMBA 4BDMA 3OO8A 5FTIA 3SEWA 4QBAA 2V93A 4POXA 3JZJA
chains in the Genus database with same CATH topology
5ICQA 4IO7A 5JEIA 3A3CA 3TYHA 4RK9A 3W9WA 4XKRA 2UVJA 1MXUA 4HCYA 3THIA 1LAHE 5DEXA 1A54A 1MY3A 4NWCA 2O7UA 3U1OA 1XHYA 1FTOA 4P0GA 1B51A 3CFXA 2QS3A 1LBCA 2Y7PA 3O66A 1Y3QA 1MXXA 2I0BA 4R2FA 4LZ8A 4XKNA 4XXUA 2QS4A 3FVOA 4EXKA 3FTOA 2I0CA 5FTHA 3PGFA 3KN3A 3ZSFA 2X7QA 5I58A 5TP9A 2Q8JA 3GXAA 2DXRA 3CSBA 1MPDA 5KZTA 2V3UA 4GQOA 3S9LC 1LCTA 2Z8FA 4XKPA 5AA2B 4ZECA 3T66A 4ZEIA 3IORA 4ZE9A 1I69A 3FUZA 3DELB 2Q9TA 4DDDA 1MDP1 5KDTB 4HTGA 1BLFA 3G3GA 4JXIA 4LP2B 4IB2A 1RKMA 4R9FA 4R6HA 3SEYA 1NKXA 1Q1KA 4IO4A 2GRVA 2NWJA 4KHZE 3MP6A 3KEIA 1XT8A 3FJGA 5FHNA 5ITPA 1VFEA 4M4GA 2F36A 2XD3A 4JWYA 4QHQA 3K1PA 3KJ7A 2Z23A 4FECA 4H6DA 2DP8A 4DXCA 1FTJA 3KJTA 2PVUA 5I2NB 1JQFA 1P1OA 2H98A 3SEUA 5I59A 4KYSA 2B4LA 3SEXA 1MDQA 1P1WA 4PP0A 4RY1A 1AIVA 1NNFA 2OCUA 1B9JA 3DRIA 4OEVA 1IXHA 3VFJA 3B6QA 4PFUA 2DVCA 3USDA 3QYTA 2W7YA 3KOTA 4OENA 5FHOA 1PDAA 2XXHA 1O7TA 2RKMA 3C35A 1YPNA 5AE4A 3DRKA 3Q28A 1Z7NE 2NUVA 3MZ1A 3MUQA 2ONKE 4R72A 2OLBA 5L9MA 2H25A 1DTGA 3H4ZA 3A3UA 3H6VA 4H5FA 3PUWE 1PEBA 3L6HA 1MPBA 4H65A 2E0SA 3IOVA 1ZBMA 4GOTA 3FVGA 1Y3PA 4U2RA 5F1QA 5DVJA 1WDNA 3AXFA 3U93A 5KDTA 4JWXA 3K6UA 1ZLQA 3KOSA 4IO2A 3U94A 4YKIA 4O3AA 3RQTA 2RINA 3OEKA 4EF2A 4G8HA 4QF9A 2H4IA 2GH9A 2LAOA 5EYFA 2XXYA 3MP1A 3K0VA 1LGBC 1XC1A 4TQUQ 3B7DA 2DWIA 3MVWA 5DTBA 3VLWA 4NF8B 1LFGA 2ZNSA 2D3IA 2YPNA 1I6QA 2H99A 2V3TA 3P7IA 3GBBA 5A5XB 3TDJA 1B5IA 4C1UA 1OLAA 4F1VA 4OZ9A 2AL4A 4BDNA 3PUVE 1GV8A 3OMBA 4OYVA 4OQOA 2XXRA 5CBSA 2WOPA 3K4UA 1LB9A 3DRGA 1WVJA 3UK4A 3RY3A 5FHMA 3T9UA 4F22A 4ZEBA 1PC3A 4DXBA 4F19A 3N6TA 4GFRA 4KCCA 4BLAA 3LR1A 1QJMA 4NTLA 3HCQA 1TT1A 3S9MC 1IXCA 4LQ5A 3M3FA 3K6WA 5LOMA 2DQVA 1TXFA 1B6HA 4I9DA 2XXQA 4MFIA 2ZMBA 4X1DA 2I49A 2Z22A 2B4MA 4PFTA 4JBZA 3T93B 4XIGQ 3LSXA 3MZBA 5TU0A 3I6VA 4QFLA 3CG1A 3GZGA 2I3VA 1Y1MA 2DE3A 4AQ4A 3OXNA 2XXIA 1L5TA 4OMBA 4GL0A 3FASA 2HFBA 2VGQA 2VD3A 3EPEA 5CM6A 4NF8A 3ODBA 3M3LA 3OSRA 3QAXA 1N04A 2B3FA 3G3IA 2WKYA 4RXLA 5AA3A 2DWJA 3DRHA 2HEUA 3DP6A 2ZYOA 1WODA 4U1OA 3IOUA 3H6UA 4NF5B 4R6YA 3K6VA 1JW1A 3KN8A 4NF4B 4OETA 3N5LA 3T9VA 2RCBA 1BIYA 4X48A 3N6UA 4R2BA 4F18A 4F3GA 1PB9A 5IKBA 2VHAA 2A5TB 4BDQA 2BJJX 1GGGA 4F3SA 4KR5A 3RT6B 1JVYA 1VSOA 2O1LA 3KGCA 1D9YA 3UGWA 3C34A 3C31A 4YICA 1IIWA 4R74A 1DOTA 2GHAA 1B32A 3ZKKA 3DRFA 3DM0A 2NVUB 1ZJLA 2PT2A 3CHGA 2ONSA 4DCXA 1SYHA 4OTEA 4F3BA 4ZDMA 1US5A 1FCKA 4DLDA 4KYDA 2XX8A 2QS2A 1D9VA 4IY5A 1B1XA 1H3DA 1HSJA 5ELVA 4LZ7A 1DPEA 3LSWA 5DVIA 4RNSA 3IOTA 1AL3A 1QVSA 2R71A 1B3FA 4G2ZA 3MZ9A 2AYSA 5B7DA 4IGRA 5HBCA 3CIJA 1JVXA 4F2QA 4JB7A 3PUZE 1GTKA 3TCFA 1BP5A 4R73A 5CMCA 1SW1A 5B70A 2O69A 4NF4A 3HPIA 4N07A 2R9JA 3W15C 3TCHA 5JTYB 3F11A 4MBPA 4E0WA 1OMPA 4NF6B 2QMWA 1GR2A 4NEDA 2A5TA 5L8DA 4LUBA 3SERA 1USYE 1HSEA 1LAXA 3MVYA 1AMFA 2F7BA 2DS9A 3MWBA 2F6GA 4FAJA 3PAMA 5HPQA 5CMBA 1B7UA 3C36A 5JK4A 1P1NA 4G68C 3OO6A 1ELJA 3C33A 3PD8A 3N26A 3EHSA 1Z7ME 3TTRA 3TTNA 4JSDA 3PPRA 3BBRA 1MRPA 4DIGA 1JNFA 3H6WA 4U23A 2NXOA 4RA1A 4YB7A 1FQDA 1AH5A 3U8QA 1B58A 2VP1A 5CC2A 2Y7WA 3D4GA 2G93A 3ZS6A 1P1QA 1P1UA 2QSXA 4N13A 2ZYKA 2UVHA 3QIMA 5EHSA 1M5BA 4PETA 2QPQA 4KYEA 5L9OA 2D5WA 2XXWA 1MS7A 1EZ9A 1LAGE 1ZKBA 1JEUA 3FVKA 3WAFA 2F6PA 4P0IA 1B0HA 2RC8A 4EQBA 3FZVA 2F5XA 3HO7A 3QK6A 3K6XA 3T9XB 3H06B 1LSTA 3RTWB 5JTYA 4GIZA 2ZNUA 3O9PA 4NF6A 3Q25A 3BKIB 1QUJA 2O68A 3FV2A 4YB5A 1LB8A 2H5YA 1SW2A 3MJNA 1MQHA 2Y84A 3FXRA 1D3KA 1POTA 2IEEA 3UP9A 2F34A 2CZLA 2WOKA 4G68B 2Y7KA 3OOAA 3DRJA 2HAVA 2I3WA 5AA4B 5TPAB 4OERA 1SYIA 1BTJA 3SEVA 5H8FB 1H45A 1FQEA 4L17A 4I1DA 2O6AA 2XXTA 1B7HA 4U21A 5AA1A 1VE4A 3VLVA 4IO6A 4OVJA 3CFZA 4QSEA 3MBPA 4GVOA 2HCAA 5DVFA 4OESA 3FGSA 4LQ2A 3MAMA 1H76A 1M5CA 1H43A 2FYIA 4QFNA 3PPPA 3VVEA 3RYBA 4LZ5A 4E0XA 5ISUA 2I48A 2ONRA 1PBQA 5AA2A 2HXWA 3MP8A 4R75A 3T9HB 4OWDA 3R6UA 3Q27A 4ND9A 1MY0A 3IAZA 4H0WA 2DE4A 3TUSA 1MH3A 1EH3A 1J1NA 1Y4CA 3GLBA 3KFMA 3C4MA 3L6GA 3V89B 4BDLA 1CE2A 3PU5A 3LBSA 1B5JA 4EXLA 3E3KA 2I6EA 3PMWA 4YKPA 3IO4A 1FTKA 1N7WA 1NMUA 1N3WA 3O97A 3KSJA 5I2KB 4PQJA 1URSA 4X1BA 4I8CA 2D21A 5I2NA 2Z8EA 4Q8RA 3RPWA 4IY6A 1H44A 2DYXA 4GL8A 4YAHX 5L9SA 1FTMA 2RC9A 4G68A 1B3HA 3MC2A 3SDFA 3S9EA 5AA4A 5TPAA 2B65A 1XVYA 1B4HA 5DYHA 4ZZAA 5H8FA 3RNNA 1QUKA 4OHNA 4R6KA 1XOCA 5H8NB 3CRBA 4H5GA 4ZS9A 4FE8A 3H3GA 1MQJA 5ICTA 3QUFA 3GBAA 4ESWA 4MH5A 2GFEA 3S9NC 4KPTA 1US4A 1TWYA 3LC8A 2ZXTA 1DTZA 5KCJB 3ILUB 1R9QA 1I6AA 4LA9A 4DZ1A 3MW0A 1Y1ZA 2OBGA 3K1MA 1JW4A 4BDRA 1FQAA 3U92A 4FEBA 1JW5A 4HCWA 4ELOA 2E1SA 3UORA 3WAEA 4WXJA 4ELRA 3CVGA 1SW5A 3BFUA 3CI8A 3G3KA 1N0TA 1R1NA 4ZE8A 1UTBB 3KG2A 2REGA 2V25A 3VVDA 4HS7A 2P1SA 5I56B 2HAUA 5DT6A 2H9BA 2Q89A 4IO3A 3IO6A 4GRKA 3FIRA 5I2KA 2UVIA 4N6PA 3TTKA 2YJPA 3O28A 2V3QA 1OIBA 2PBWA 2QJEA 4F31B 3B6WA 5A5XA 2OJTA 4ECFA 1MPCA 4LONB 1O64A 3VLUA 3V83A 3IB1A 1PBPA 4LATA 1MY4A 3SKPA 1P99A 3PPQA 2XHDA 4F1YA 1B3LA 5H8NA 3RT8A 3W9VA 2XD2A 3TZAA 3MVXA 1URGA 2F78A 2PT1A 2X26A 4NWDA 3RTFB 3UN6A 3FVNA 4ZEKA 1MXVA 3LUYA 2WOLA 4RYAA 1NL5A 4ZZEA 4OXVA 4GWOA 2DWHA 1Y4TA 4RPOA 2THIA 1ZIUA 2UXAA 2HQ0A 4F39A 3KBRA 1FQCA 4HW8A 3K2DA 4Q30B 1MQDA 2P2AA 3PUXE 1MXZA 1LBBA 1UIVA 3ECRA 2Q2CA 4H8JA 4WKMA 3A09A 3FV1A 2I4BA 3CR9A 3E4RA 1NFTA 1N3XA 3K1NA 3IJXB 3LSFB 5H8HB 1UTBA 1IXIA 3TTLA 3V8XB 1ANFA 1FQBA 2QMXA 2ZYNA 1OQGA 1SBPA 4WEPA 3OSQA 1OQHA 5I56A 4ELQA 1MQGA 2FNCA 3T96B 1LCFA 4POWA 3MVZA 1RYOA 5TP9B 3O29A 1A55A 5I84A 3O2AA 1QULA 4M1VA 4Z7EA 4AB6A 3H7MA 4H8IA 3IL1B 4DXUA 4G4PA 4NF5A 1MM6A 2XX9A 1FQFA 1MY1A 2X7PA 1DSNA 4F3PA 1Q35A 1RYXA 4PE5B 2CMOA 4BDOA 3N94A 4F29A 4MLVA 1QUIA 4EQ7A 1EZOA 3EN3A 3VVFA 1B0LA 3M8UA 4F1UA 1YCJA 2O51A 2F7AA 3FXQA 3KN7A 3G3JA 2XXUA 4U22A 2F97A 3OEMA 2ABHA 1B3GA 4LVQA 4NMYA 1KWHA 4RJZA 4ESXA 1SI1A 4OFJA 4EUOA 5I59B 3CSGA 4IO5A 4GD5A 4GXSB 3G3FA 2M8CA 1MQIA 2O84X 3OO7A 2RC7A 5M2VA 1UTHB 3O6HA 5H8HA 1SVXB 1A8FA 5F7VA 1B46A 2PX1A 3K01A 3PMVA 1N7XA 4TOZA 4UACA 4PFYA 1QW0A 3I3VA 3RN8A 3CFLA 1B52A 3OO9A 1POY1 1IXGA 1HSLA 1YTVA 1LFIA 3FATA 3IB0A 3O6IA 2FA7A 1MM7A 4K3FA 3JV9A 2AL5A 4C0RA 4RPNA 2DVZA 2Q2AA 3C32A 3ILTB 1Y20A 1SDXA 1UQWA 4G8MA 5ITOA 2G29A 1URDA 3HN0A 2OK2A 5CMMA 1Y9UA 4KFQA 1MY2A 2R6GE 3CG3A 3Q26A 1TFAA 2DOJA 1GVCA 3EQ1A 1NH7A 1MH4A 4Z0IA 1LLSA 2Z8DA 3PPOA 1OVBA 4QSDA 3SESA 3MQ9A 2F8DA 2F35A 3TODA 2UYEA 1B2HA 1SQYA 3TQLA 3ONMA 1VR5A 2YLNA 4C1TA 3H03A 3U72A 1SW4A 3EHTA 4THIA 1IQ7A 3M3KA 3IB2A 3FXUA 5BWJA 3TELA 2I58A 4IGTA 1I6BA 4MF3A 3HHFA 1ZTYA 2V84A 3IR1A 1OVTA 1S50A 1DPPA 3RGYA 4F2OA 1M5DA 3SETA 2F7CA 3E13X 1S9TA 4FEDA 1TFDA 1UTHA 1NNKA 4OFLA 1F9BA 3QXMA 3MPKA 3FD3A 1R6ZA 4RK2A 1PB8A 3PMXA 1SD3A 3D4CA 1M5FA 4H1XA 4JDFA 3T22A 2QRYA 2OZZA 5H8QB 4O3BA 3TEPA 4XTCQ 1USYH 3B6TA 4UA8A 3O6GA 2O7IA 3E9XA 3RYAA 2RF1A 1MXYA 3TMGA 4DCYA 4JWOA 2ALUA 4DE8A 2VOZA 5AA2D 4YKKA 5J1DA 1Y3NA 1IITA 2B3BA 5CMKA 2O1MA 1XS5A 1IEJA 1M5EA 1ZU0A 4EF1A 2DE2A 3K02A 4X9TA 3RUMA 1MXWA 3QSLA 1A40A 4ONYA 3VXBA 1D4NA 3VV5A 3TAJA 3DP4A 1N76A 4FORA 1B40A 3G7WA 2ZYMA 4QSCA 4MLQA 1ZMGA 1YAEA 1A7LA 1NNPA 1AOVA 4NE4A 2ANJA 3Q29A 2PMSA 2I4CA 1II5A 3EF7A 1EU8A 2DSFA 4ZEFA 1OLCA 2ESNA 1JEVA 3MPLA 3QUJA 1IUDA 3TPAA 4OEUA 2UVGA 3OENA 3G3HA 4YU0A 3TQWA 3OD7A 4ELPA 3RLFE 3IX1A 4Q0CA 4QFOA 3S2VA 3KZGA 1NNTA 4PFWA 3O6PA 3C9HA 1LFHA 2XXPA 4KI0E 2DWAA 3K00A 3FJ7A 4YMAA 5H8QA 1B5HA 3FJMA 2IA4A 3IOWA 4FJPA 5EHMA 3TKDA 4QRZA 4I62A 4P11A 4QFKA 4H67A 1BKAA 4AB5A 1B7ZA 2HZKA 3I5OA 5BUUA 5CBRA 1ATGA 1B3EA 3PD9A 1N84A 5K2XA 1B05A 3H6TA 3R26A 4GLIA 3LSLA 3PV0E 4TLMB 3DLNA 2AIXA 2Y7RA 4OFOA 2GHBA 3JYRA 3OELA 4U4SA 3IK6B 1PB7A 2PYYA 4WEDA 1B4ZA 2KLFA 1EZPA 5I57B 4YZZA 3HHGA 1IZ1A 4G77A 3UA8A 1A8EA 3HSTA 1FW0A 1S7YA 4XKQA 4R9GA 1LAFE 1R9LA 3S4UA 3VE1B 4GXAA 1SI0A 2P0SA 4ISUA 2UYFA 4KCDA 5CRYA 1O63A 3TCGA 4GF8A 4QFPA 4ZEDA 5HM4B 5DEXB 4EQ9A 3UIFA 5CI5A 2OWSA 4U4XA 4YB6A 3KSXA 4FATA 4Q5TA 3LVUA 2DXYA 4JSOA 5KCJA 3DP8A 2RCAA 4KQPA 3VDFA 4FIMA 2Q88A 3R7XA 4EDPA 4YKJA 1FTLA 1T0KA 1MG1A 4U1ZA 3HV1A 5K2YA 1JETA 4TLLB 2NOOA 1NH8A 3EHUA 5IAIA 3TFLA 2Y7IA 2HZLA 2XX7A 2QS1A 4G8NA 1A99A 1DMBA 3V5AA 1QKBA 2QL3A 2REJA 4O3CA 3VXCA 1VFDA 2XXVA 2XXXA 3IJOB 4KD5A 2VD2A 5H8SA 5I58B 2ZNTA 1B1HA 1XVXA 3ZKLA 5I57A 3TTMA 3BFTA 1QKAA 2OWTA 3PUYE 1UIUA 1CB6A 3PPNA 2A5SA 4YMBA 4BDMA 3OO8A 5FTIA 3SEWA 2V93A 4POXA 3JZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICQ A;  4IO7 A;  5JEI A;  3A3C A;  3TYH A;  4RK9 A;  3W9W A;  4XKR A;  2UVJ A;  1MXU A;  4HCY A;  3THI A;  1LAH E;  5DEX A;  1A54 A;  1MY3 A;  4NWC A;  2O7U A;  3U1O A;  1XHY A;  1FTO A;  4P0G A;  1B51 A;  3CFX A;  2QS3 A;  1LBC A;  2Y7P A;  3O66 A;  1Y3Q A;  1MXX A;  2I0B A;  4R2F A;  4LZ8 A;  4XKN A;  4XXU A;  2QS4 A;  3FVO A;  4EXK A;  3FTO A;  2I0C A;  5FTH A;  3PGF A;  3KN3 A;  3ZSF A;  2X7Q A;  5I58 A;  5TP9 A;  2Q8J A;  3GXA A;  2DXR A;  3CSB A;  1MPD A;  5KZT A;  2V3U A;  4GQO A;  3S9L C;  1LCT A;  2Z8F A;  4XKP A;  5AA2 B;  4ZEC A;  3T66 A;  4ZEI A;  3IOR A;  4ZE9 A;  1I69 A;  3FUZ A;  3DEL B;  2Q9T A;  4DDD A;  1MDP 1;  5KDT B;  4HTG A;  1BLF A;  3G3G A;  4JXI A;  4LP2 B;  4IB2 A;  1RKM A;  4R9F A;  4R6H A;  3SEY A;  1NKX A;  1Q1K A;  4IO4 A;  2GRV A;  2NWJ A;  4KHZ E;  3MP6 A;  3KEI A;  1XT8 A;  3FJG A;  5FHN A;  5ITP A;  1VFE A;  4M4G A;  2F36 A;  2XD3 A;  4JWY A;  4QHQ A;  3K1P A;  3KJ7 A;  2Z23 A;  4FEC A;  4H6D A;  2DP8 A;  4DXC A;  1FTJ A;  3KJT A;  2PVU A;  5I2N B;  1JQF A;  1P1O A;  2H98 A;  3SEU A;  5I59 A;  4KYS A;  2B4L A;  3SEX A;  1MDQ A;  1P1W A;  4PP0 A;  4RY1 A;  1AIV A;  1NNF A;  2OCU A;  1B9J A;  3DRI A;  4OEV A;  1IXH A;  3VFJ A;  3B6Q A;  4PFU A;  2DVC A;  3USD A;  3QYT A;  2W7Y A;  3KOT A;  4OEN A;  5FHO A;  1PDA A;  2XXH A;  1O7T A;  2RKM A;  3C35 A;  1YPN A;  5AE4 A;  3DRK A;  3Q28 A;  1Z7N E;  2NUV A;  3MZ1 A;  3MUQ A;  2ONK E;  4R72 A;  2OLB A;  5L9M A;  2H25 A;  1DTG A;  3H4Z A;  3A3U A;  3H6V A;  4H5F A;  3PUW E;  1PEB A;  3L6H A;  1MPB A;  4H65 A;  2E0S A;  3IOV A;  1ZBM A;  4GOT A;  3FVG A;  1Y3P A;  4U2R A;  5F1Q A;  5DVJ A;  1WDN A;  3AXF A;  3U93 A;  5KDT A;  4JWX A;  3K6U A;  1ZLQ A;  3KOS A;  4IO2 A;  3U94 A;  4YKI A;  4O3A A;  3RQT A;  2RIN A;  3OEK A;  4EF2 A;  4G8H A;  4QF9 A;  2H4I A;  2GH9 A;  2LAO A;  5EYF A;  2XXY A;  3MP1 A;  3K0V A;  1LGB C;  1XC1 A;  4TQU Q;  3B7D A;  2DWI A;  3MVW A;  5DTB A;  3VLW A;  4NF8 B;  1LFG A;  2ZNS A;  2D3I A;  2YPN A;  1I6Q A;  2H99 A;  2V3T A;  3P7I A;  3GBB A;  5A5X B;  3TDJ A;  1B5I A;  4C1U A;  1OLA A;  4F1V A;  4OZ9 A;  2AL4 A;  4BDN A;  3PUV E;  1GV8 A;  3OMB A;  4OYV A;  4OQO A;  2XXR A;  5CBS A;  2WOP A;  3K4U A;  1LB9 A;  3DRG A;  1WVJ A;  3UK4 A;  3RY3 A;  5FHM A;  3T9U A;  4F22 A;  4ZEB A;  1PC3 A;  4DXB A;  4F19 A;  3N6T A;  4GFR A;  4KCC A;  4BLA A;  3LR1 A;  1QJM A;  4NTL A;  3HCQ A;  1TT1 A;  3S9M C;  1IXC A;  4LQ5 A;  3M3F A;  3K6W A;  5LOM A;  2DQV A;  1TXF A;  1B6H A;  4I9D A;  2XXQ A;  4MFI A;  2ZMB A;  4X1D A;  2I49 A;  2Z22 A;  2B4M A;  4PFT A;  4JBZ A;  3T93 B;  4XIG Q;  3LSX A;  3MZB A;  5TU0 A;  3I6V A;  4QFL A;  3CG1 A;  3GZG A;  2I3V A;  1Y1M A;  2DE3 A;  4AQ4 A;  3OXN A;  2XXI A;  1L5T A;  4OMB A;  4GL0 A;  3FAS A;  2HFB A;  2VGQ A;  2VD3 A;  3EPE A;  5CM6 A;  4NF8 A;  3ODB A;  3M3L A;  3OSR A;  3QAX A;  1N04 A;  2B3F A;  3G3I A;  2WKY A;  4RXL A;  5AA3 A;  2DWJ A;  3DRH A;  2HEU A;  3DP6 A;  2ZYO A;  1WOD A;  4U1O A;  3IOU A;  3H6U A;  4NF5 B;  4R6Y A;  3K6V A;  1JW1 A;  3KN8 A;  4NF4 B;  4OET A;  3N5L A;  3T9V A;  2RCB A;  1BIY A;  4X48 A;  3N6U A;  4R2B A;  4F18 A;  4F3G A;  1PB9 A;  5IKB A;  2VHA A;  2A5T B;  4BDQ A;  2BJJ X;  1GGG A;  4F3S A;  4KR5 A;  3RT6 B;  1JVY A;  1VSO A;  2O1L A;  3KGC A;  1D9Y A;  3UGW A;  3C34 A;  3C31 A;  4YIC A;  1IIW A;  4R74 A;  1DOT A;  2GHA A;  1B32 A;  3ZKK A;  3DRF A;  3DM0 A;  2NVU B;  1ZJL A;  2PT2 A;  3CHG A;  2ONS A;  4DCX A;  1SYH A;  4OTE A;  4F3B A;  4ZDM A;  1US5 A;  1FCK A;  4DLD A;  4KYD A;  2XX8 A;  2QS2 A;  1D9V A;  4IY5 A;  1B1X A;  1H3D A;  1HSJ A;  5ELV A;  4LZ7 A;  1DPE A;  3LSW A;  5DVI A;  4RNS A;  3IOT A;  1AL3 A;  1QVS A;  2R71 A;  1B3F A;  4G2Z A;  3MZ9 A;  2AYS A;  5B7D A;  4IGR A;  5HBC A;  3CIJ A;  1JVX A;  4F2Q A;  4JB7 A;  3PUZ E;  1GTK A;  3TCF A;  1BP5 A;  4R73 A;  5CMC A;  1SW1 A;  5B70 A;  2O69 A;  4NF4 A;  3HPI A;  4N07 A;  2R9J A;  3W15 C;  3TCH A;  5JTY B;  3F11 A;  4MBP A;  4E0W A;  1OMP A;  4NF6 B;  2QMW A;  1GR2 A;  4NED A;  2A5T A;  5L8D A;  4LUB A;  3SER A;  1USY E;  1HSE A;  1LAX A;  3MVY A;  1AMF A;  2F7B A;  2DS9 A;  3MWB A;  2F6G A;  4FAJ A;  3PAM A;  5HPQ A;  5CMB A;  1B7U A;  3C36 A;  5JK4 A;  1P1N A;  4G68 C;  3OO6 A;  1ELJ A;  3C33 A;  3PD8 A;  3N26 A;  3EHS A;  1Z7M E;  3TTR A;  3TTN A;  4JSD A;  3PPR A;  3BBR A;  1MRP A;  4DIG A;  1JNF A;  3H6W A;  4U23 A;  2NXO A;  4RA1 A;  4YB7 A;  1FQD A;  1AH5 A;  3U8Q A;  1B58 A;  2VP1 A;  5CC2 A;  2Y7W A;  3D4G A;  2G93 A;  3ZS6 A;  1P1Q A;  1P1U A;  2QSX A;  4N13 A;  2ZYK A;  2UVH A;  3QIM A;  5EHS A;  1M5B A;  4PET A;  2QPQ A;  4KYE A;  5L9O A;  2D5W A;  2XXW A;  1MS7 A;  1EZ9 A;  1LAG E;  1ZKB A;  1JEU A;  3FVK A;  3WAF A;  2F6P A;  4P0I A;  1B0H A;  2RC8 A;  4EQB A;  3FZV A;  2F5X A;  3HO7 A;  3QK6 A;  3K6X A;  3T9X B;  3H06 B;  1LST A;  3RTW B;  5JTY A;  4GIZ A;  2ZNU A;  3O9P A;  4NF6 A;  3Q25 A;  3BKI B;  1QUJ A;  2O68 A;  3FV2 A;  4YB5 A;  1LB8 A;  2H5Y A;  1SW2 A;  3MJN A;  1MQH A;  2Y84 A;  3FXR A;  1D3K A;  1POT A;  2IEE A;  3UP9 A;  2F34 A;  2CZL A;  2WOK A;  4G68 B;  2Y7K A;  3OOA A;  3DRJ A;  2HAV A;  2I3W A;  5AA4 B;  5TPA B;  4OER A;  1SYI A;  1BTJ A;  3SEV A;  5H8F B;  1H45 A;  1FQE A;  4L17 A;  4I1D A;  2O6A A;  2XXT A;  1B7H A;  4U21 A;  5AA1 A;  1VE4 A;  3VLV A;  4IO6 A;  4OVJ A;  3CFZ A;  4QSE A;  3MBP A;  4GVO A;  2HCA A;  5DVF A;  4OES A;  3FGS A;  4LQ2 A;  3MAM A;  1H76 A;  1M5C A;  1H43 A;  2FYI A;  4QFN A;  3PPP A;  3VVE A;  3RYB A;  4LZ5 A;  4E0X A;  5ISU A;  2I48 A;  2ONR A;  1PBQ A;  5AA2 A;  2HXW A;  3MP8 A;  4R75 A;  3T9H B;  4OWD A;  3R6U A;  3Q27 A;  4ND9 A;  1MY0 A;  3IAZ A;  4H0W A;  2DE4 A;  3TUS A;  1MH3 A;  1EH3 A;  1J1N A;  1Y4C A;  3GLB A;  3KFM A;  3C4M A;  3L6G A;  3V89 B;  4BDL A;  1CE2 A;  3PU5 A;  3LBS A;  1B5J A;  4EXL A;  3E3K A;  2I6E A;  3PMW A;  4YKP A;  3IO4 A;  1FTK A;  1N7W A;  1NMU A;  1N3W A;  3O97 A;  3KSJ A;  5I2K B;  4PQJ A;  1URS A;  4X1B A;  4I8C A;  2D21 A;  5I2N A;  2Z8E A;  4Q8R A;  3RPW A;  4IY6 A;  1H44 A;  2DYX A;  4GL8 A;  4YAH X;  5L9S A;  1FTM A;  2RC9 A;  4G68 A;  1B3H A;  3MC2 A;  3SDF A;  3S9E A;  5AA4 A;  5TPA A;  2B65 A;  1XVY A;  1B4H A;  5DYH A;  4ZZA A;  5H8F A;  3RNN A;  1QUK A;  4OHN A;  4R6K A;  1XOC A;  5H8N B;  3CRB A;  4H5G A;  4ZS9 A;  4FE8 A;  3H3G A;  1MQJ A;  5ICT A;  3QUF A;  3GBA A;  4ESW A;  4MH5 A;  2GFE A;  3S9N C;  4KPT A;  1US4 A;  1TWY A;  3LC8 A;  2ZXT A;  1DTZ A;  5KCJ B;  3ILU B;  1R9Q A;  1I6A A;  4LA9 A;  4DZ1 A;  3MW0 A;  1Y1Z A;  2OBG A;  3K1M A;  1JW4 A;  4BDR A;  1FQA A;  3U92 A;  4FEB A;  1JW5 A;  4HCW A;  4ELO A;  2E1S A;  3UOR A;  3WAE A;  4WXJ A;  4ELR A;  3CVG A;  1SW5 A;  3BFU A;  3CI8 A;  3G3K A;  1N0T A;  1R1N A;  4ZE8 A;  1UTB B;  3KG2 A;  2REG A;  2V25 A;  3VVD A;  4HS7 A;  2P1S A;  5I56 B;  2HAU A;  5DT6 A;  2H9B A;  2Q89 A;  4IO3 A;  3IO6 A;  4GRK A;  3FIR A;  5I2K A;  2UVI A;  4N6P A;  3TTK A;  2YJP A;  3O28 A;  2V3Q A;  1OIB A;  2PBW A;  2QJE A;  4F31 B;  3B6W A;  5A5X A;  2OJT A;  4ECF A;  1MPC A;  4LON B;  1O64 A;  3VLU A;  3V83 A;  3IB1 A;  1PBP A;  4LAT A;  1MY4 A;  3SKP A;  1P99 A;  3PPQ A;  2XHD A;  4F1Y A;  1B3L A;  5H8N A;  3RT8 A;  3W9V A;  2XD2 A;  3TZA A;  3MVX A;  1URG A;  2F78 A;  2PT1 A;  2X26 A;  4NWD A;  3RTF B;  3UN6 A;  3FVN A;  4ZEK A;  1MXV A;  3LUY A;  2WOL A;  4RYA A;  1NL5 A;  4ZZE A;  4OXV A;  4GWO A;  2DWH A;  1Y4T A;  4RPO A;  2THI A;  1ZIU A;  2UXA A;  2HQ0 A;  4F39 A;  3KBR A;  1FQC A;  4HW8 A;  3K2D A;  4Q30 B;  1MQD A;  2P2A A;  3PUX E;  1MXZ A;  1LBB A;  1UIV A;  3ECR A;  2Q2C A;  4H8J A;  4WKM A;  3A09 A;  3FV1 A;  2I4B A;  3CR9 A;  3E4R A;  1NFT A;  1N3X A;  3K1N A;  3IJX B;  3LSF B;  5H8H B;  1UTB A;  1IXI A;  3TTL A;  3V8X B;  1ANF A;  1FQB A;  2QMX A;  2ZYN A;  1OQG A;  1SBP A;  4WEP A;  3OSQ A;  1OQH A;  5I56 A;  4ELQ A;  1MQG A;  2FNC A;  3T96 B;  1LCF A;  4POW A;  3MVZ A;  1RYO A;  5TP9 B;  3O29 A;  1A55 A;  5I84 A;  3O2A A;  1QUL A;  4M1V A;  4Z7E A;  4AB6 A;  3H7M A;  4H8I A;  3IL1 B;  4DXU A;  4G4P A;  4NF5 A;  1MM6 A;  2XX9 A;  1FQF A;  1MY1 A;  2X7P A;  1DSN A;  4F3P A;  1Q35 A;  1RYX A;  4PE5 B;  2CMO A;  4BDO A;  3N94 A;  4F29 A;  4MLV A;  1QUI A;  4EQ7 A;  1EZO A;  3EN3 A;  3VVF A;  1B0L A;  3M8U A;  4F1U A;  1YCJ A;  2O51 A;  2F7A A;  3FXQ A;  3KN7 A;  3G3J A;  2XXU A;  4U22 A;  2F97 A;  3OEM A;  2ABH A;  1B3G A;  4LVQ A;  4NMY A;  1KWH A;  4RJZ A;  4ESX A;  1SI1 A;  4OFJ A;  4EUO A;  5I59 B;  3CSG A;  4IO5 A;  4GD5 A;  4GXS B;  3G3F A;  2M8C A;  1MQI A;  2O84 X;  3OO7 A;  2RC7 A;  5M2V A;  1UTH B;  3O6H A;  5H8H A;  1SVX B;  1A8F A;  5F7V A;  1B46 A;  2PX1 A;  3K01 A;  3PMV A;  1N7X A;  4TOZ A;  4UAC A;  4PFY A;  1QW0 A;  3I3V A;  3RN8 A;  3CFL A;  1B52 A;  3OO9 A;  1POY 1;  1IXG A;  1HSL A;  1YTV A;  1LFI A;  3FAT A;  3IB0 A;  3O6I A;  2FA7 A;  1MM7 A;  4K3F A;  3JV9 A;  2AL5 A;  4C0R A;  4RPN A;  2DVZ A;  2Q2A A;  3C32 A;  3ILT B;  1Y20 A;  1SDX A;  1UQW A;  4G8M A;  5ITO A;  2G29 A;  1URD A;  3HN0 A;  2OK2 A;  5CMM A;  1Y9U A;  4KFQ A;  1MY2 A;  2R6G E;  3CG3 A;  3Q26 A;  1TFA A;  2DOJ A;  1GVC A;  3EQ1 A;  1NH7 A;  1MH4 A;  4Z0I A;  1LLS A;  2Z8D A;  3PPO A;  1OVB A;  4QSD A;  3SES A;  3MQ9 A;  2F8D A;  2F35 A;  3TOD A;  2UYE A;  1B2H A;  1SQY A;  3TQL A;  3ONM A;  1VR5 A;  2YLN A;  4C1T A;  3H03 A;  3U72 A;  1SW4 A;  3EHT A;  4THI A;  1IQ7 A;  3M3K A;  3IB2 A;  3FXU A;  5BWJ A;  3TEL A;  2I58 A;  4IGT A;  1I6B A;  4MF3 A;  3HHF A;  1ZTY A;  2V84 A;  3IR1 A;  1OVT A;  1S50 A;  1DPP A;  3RGY A;  4F2O A;  1M5D A;  3SET A;  2F7C A;  3E13 X;  1S9T A;  4FED A;  1TFD A;  1UTH A;  1NNK A;  4OFL A;  1F9B A;  3QXM A;  3MPK A;  3FD3 A;  1R6Z A;  4RK2 A;  1PB8 A;  3PMX A;  1SD3 A;  3D4C A;  1M5F A;  4H1X A;  4JDF A;  3T22 A;  2QRY A;  2OZZ A;  5H8Q B;  4O3B A;  3TEP A;  4XTC Q;  1USY H;  3B6T A;  4UA8 A;  3O6G A;  2O7I A;  3E9X A;  3RYA A;  2RF1 A;  1MXY A;  3TMG A;  4DCY A;  4JWO A;  2ALU A;  4DE8 A;  2VOZ A;  5AA2 D;  4YKK A;  5J1D A;  1Y3N A;  1IIT A;  2B3B A;  5CMK A;  2O1M A;  1XS5 A;  1IEJ A;  1M5E A;  1ZU0 A;  4EF1 A;  2DE2 A;  3K02 A;  4X9T A;  3RUM A;  1MXW A;  3QSL A;  1A40 A;  4ONY A;  3VXB A;  1D4N A;  3VV5 A;  3TAJ A;  3DP4 A;  1N76 A;  4FOR A;  1B40 A;  3G7W A;  2ZYM A;  4QSC A;  4MLQ A;  1ZMG A;  1YAE A;  1A7L A;  1NNP A;  1AOV A;  4NE4 A;  2ANJ A;  3Q29 A;  2PMS A;  2I4C A;  1II5 A;  3EF7 A;  1EU8 A;  2DSF A;  4ZEF A;  1OLC A;  2ESN A;  1JEV A;  3MPL A;  3QUJ A;  1IUD A;  3TPA A;  4OEU A;  2UVG A;  3OEN A;  3G3H A;  4YU0 A;  3TQW A;  3OD7 A;  4ELP A;  3RLF E;  3IX1 A;  4Q0C A;  4QFO A;  3S2V A;  3KZG A;  1NNT A;  4PFW A;  3O6P A;  3C9H A;  1LFH A;  2XXP A;  4KI0 E;  2DWA A;  3K00 A;  3FJ7 A;  4YMA A;  5H8Q A;  1B5H A;  3FJM A;  2IA4 A;  3IOW A;  4FJP A;  5EHM A;  3TKD A;  4QRZ A;  4I62 A;  4P11 A;  4QFK A;  4H67 A;  1BKA A;  4AB5 A;  1B7Z A;  2HZK A;  3I5O A;  5BUU A;  5CBR A;  1ATG A;  1B3E A;  3PD9 A;  1N84 A;  5K2X A;  1B05 A;  3H6T A;  3R26 A;  4GLI A;  3LSL A;  3PV0 E;  4TLM B;  3DLN A;  2AIX A;  2Y7R A;  4OFO A;  2GHB A;  3JYR A;  3OEL A;  4U4S A;  3IK6 B;  1PB7 A;  2PYY A;  4WED A;  1B4Z A;  2KLF A;  1EZP A;  5I57 B;  4YZZ A;  3HHG A;  1IZ1 A;  4G77 A;  3UA8 A;  1A8E A;  3HST A;  1FW0 A;  1S7Y A;  4XKQ A;  4R9G A;  1LAF E;  1R9L A;  3S4U A;  3VE1 B;  4GXA A;  1SI0 A;  2P0S A;  4ISU A;  2UYF A;  4KCD A;  5CRY A;  1O63 A;  3TCG A;  4GF8 A;  4QFP A;  4ZED A;  5HM4 B;  5DEX B;  4EQ9 A;  3UIF A;  5CI5 A;  2OWS A;  4U4X A;  4YB6 A;  3KSX A;  4FAT A;  4Q5T A;  3LVU A;  2DXY A;  4JSO A;  5KCJ A;  3DP8 A;  2RCA A;  4KQP A;  3VDF A;  4FIM A;  2Q88 A;  3R7X A;  4EDP A;  4YKJ A;  1FTL A;  1T0K A;  1MG1 A;  4U1Z A;  3HV1 A;  5K2Y A;  1JET A;  4TLL B;  2NOO A;  1NH8 A;  3EHU A;  5IAI A;  3TFL A;  2Y7I A;  2HZL A;  2XX7 A;  2QS1 A;  4G8N A;  1A99 A;  1DMB A;  3V5A A;  1QKB A;  2QL3 A;  2REJ A;  4O3C A;  3VXC A;  1VFD A;  2XXV A;  2XXX A;  3IJO B;  4KD5 A;  2VD2 A;  5H8S A;  5I58 B;  2ZNT A;  1B1H A;  1XVX A;  3ZKL A;  5I57 A;  3TTM A;  3BFT A;  1QKA A;  2OWT A;  3PUY E;  1UIU A;  1CB6 A;  3PPN A;  2A5S A;  4YMB A;  4BDM A;  3OO8 A;  5FTI A;  3SEW A;  2V93 A;  4POX A;  3JZJ A; 
#chains in the Genus database with same CATH topology
 5ICQ A;  4IO7 A;  5JEI A;  3A3C A;  3TYH A;  4RK9 A;  3W9W A;  4XKR A;  2UVJ A;  1MXU A;  4HCY A;  3THI A;  1LAH E;  5DEX A;  4FBP A;  1A54 A;  4N81 A;  1MY3 A;  4PBQ A;  4NWC A;  2O7U A;  4O7I A;  3U1O A;  1XHY A;  1FTO A;  4P0G A;  1B51 A;  3CFX A;  1IME A;  4HXV A;  2QS3 A;  1LBC A;  2Y7P A;  1KA1 A;  3O66 A;  1Y3Q A;  1MXX A;  2I0B A;  4R2F A;  4O7M A;  4LZ8 A;  4XKN A;  4XXU A;  2QS4 A;  1RDZ A;  4MNC A;  3FVO A;  4EXK A;  3FTO A;  4NAP A;  2I0C A;  5FTH A;  3PGF A;  3KN3 A;  3ZSF A;  2X7Q A;  5I58 A;  5TP9 A;  2Q8J A;  3GXA A;  5T3J A;  2DXR A;  4O94 A;  3LUZ A;  2Y5L A;  3CSB A;  1MPD A;  5KZT A;  2V3U A;  4GQO A;  3S9L C;  1LCT A;  1DCU A;  1NUW A;  2Z8F A;  4XKP A;  5AA2 B;  4ZEC A;  3T66 A;  4ZEI A;  2F3D A;  3IOR A;  4ZE9 A;  4GWW A;  1I69 A;  3FUZ A;  4OVT A;  3DEL B;  2Q9T A;  4DDD A;  1MDP 1;  5KDT B;  4HTG A;  1BLF A;  4AS4 A;  3G3G A;  4JXI A;  4LP2 B;  4IB2 A;  1RKM A;  4N15 A;  4R9F A;  4R6H A;  3SEY A;  1NKX A;  1Q1K A;  4IO4 A;  2GRV A;  2NWJ A;  4GWZ A;  4KHZ E;  3MP6 A;  3KEI A;  1XT8 A;  3FJG A;  5FHN A;  5ITP A;  1VFE A;  4M4G A;  2F36 A;  2XD3 A;  4JWY A;  4QHQ A;  3K1P A;  3KJ7 A;  2Z23 A;  4FEC A;  4H6D A;  2DP8 A;  4DXC A;  1FTJ A;  3KJT A;  2PVU A;  5I2N B;  1JQF A;  1P1O A;  2H98 A;  3SEU A;  5I59 A;  4KYS A;  2B4L A;  3IFA A;  3B8B A;  3SEX A;  1MDQ A;  1P1W A;  2ZZW A;  4PP0 A;  1FPL A;  1FPB A;  3LV0 A;  4RY1 A;  1AIV A;  1NNF A;  2OCU A;  1LEV A;  1B9J A;  3DRI A;  4OEV A;  1IXH A;  3VFJ A;  3B6Q A;  4PFU A;  2DVC A;  3USD A;  3QYT A;  2W7Y A;  3KOT A;  4OEN A;  5FHO A;  1PDA A;  1IMF A;  1NUZ A;  2XXH A;  1O7T A;  2RKM A;  4MIJ A;  3C35 A;  1YPN A;  5AE4 A;  3DRK A;  2FBP A;  3Q28 A;  1Z7N E;  2NUV A;  3MZ1 A;  4XEQ A;  3MUQ A;  4X04 A;  2ONK E;  4R72 A;  2OLB A;  5L9M A;  2H25 A;  1DTG A;  3H4Z A;  3A3U A;  3H6V A;  4H5F A;  3PUW E;  1PEB A;  3L6H A;  1MPB A;  4H65 A;  2E0S A;  3IOV A;  1ZBM A;  4GOT A;  4OVQ A;  3FVG A;  1Y3P A;  4U2R A;  5F1Q A;  5DVJ A;  1WDN A;  3AXF A;  3U93 A;  5KDT A;  4JWX A;  3K6U A;  1ZLQ A;  3KOS A;  4IO2 A;  3U94 A;  5IZ3 B;  4YKI A;  4O3A A;  3RQT A;  2RIN A;  3OEK A;  4EF2 A;  4G8H A;  4QF9 A;  2H4I A;  2GH9 A;  2LAO A;  5EYF A;  5EQA A;  2XXY A;  3MP1 A;  3K0V A;  1LGB C;  1XC1 A;  4TQU Q;  3B7D A;  2DWI A;  3MVW A;  5DTB A;  4PC9 A;  3VLW A;  4NF8 B;  1LFG A;  2ZNS A;  3QMF A;  2D3I A;  2YPN A;  1I6Q A;  2H99 A;  2V3T A;  4H45 A;  2WBB A;  3P7I A;  2CZK A;  1FJ6 A;  3GBB A;  5A5X B;  3TDJ A;  1B5I A;  4C1U A;  1OLA A;  4F1V A;  4OZ9 A;  2AL4 A;  4BDN A;  3PUV E;  1GV8 A;  3OMB A;  4OYV A;  4OQO A;  2XXR A;  5CBS A;  2WOP A;  3K4U A;  1LB9 A;  1FSA A;  3DRG A;  1WVJ A;  3UK4 A;  3RY3 A;  5FHM A;  3T9U A;  2PFY A;  4F22 A;  4ZEB A;  1PC3 A;  4DXB A;  4F19 A;  3N6T A;  4GFR A;  4KCC A;  4PTK A;  1AWB A;  3LR1 A;  4BLA A;  1QJM A;  4NTL A;  3HCQ A;  1TT1 A;  3S9M C;  1IXC A;  4LQ5 A;  3M3F A;  1NV0 A;  3K6W A;  5LOM A;  2DQV A;  1TXF A;  1B6H A;  4I9D A;  2XXQ A;  4O8M A;  4MFI A;  2ZMB A;  4X1D A;  2I49 A;  4P1E A;  2Z22 A;  2B4M A;  4PFT A;  4JBZ A;  5I5P A;  3T93 B;  4XIG Q;  3LSX A;  3MZB A;  5TU0 A;  3I6V A;  4LN5 A;  4QFL A;  5IZ3 A;  3CG1 A;  3GZG A;  2I3V A;  1Y1M A;  2DE3 A;  4AQ4 A;  3OXN A;  2XXI A;  1L5T A;  4OMB A;  4GL0 A;  4I3E A;  3FAS A;  2HFB A;  2VGQ A;  2VD3 A;  3EPE A;  1EYI A;  5CM6 A;  4NF8 A;  3ODB A;  3M3L A;  3OSR A;  4N6K A;  1FPK A;  3QAX A;  1N04 A;  2B3F A;  3G3I A;  2WKY A;  4RXL A;  5AA3 A;  2DWJ A;  3DRH A;  2HEU A;  2P3N A;  5I3S A;  3DP6 A;  2ZYO A;  1WOD A;  4OVP A;  4U1O A;  4NF0 A;  3IOU A;  3H6U A;  4NF5 B;  4R6Y A;  3K6V A;  1JW1 A;  3KN8 A;  4NF4 B;  4OET A;  3N5L A;  3T9V A;  2RCB A;  1BIY A;  4X48 A;  3N6U A;  2XWI A;  4R2B A;  4F18 A;  4F3G A;  1PB9 A;  5IKB A;  4PGP A;  2VHA A;  2A5T B;  4BDQ A;  2BJJ X;  3BIH A;  4P9K A;  1GGG A;  4F3S A;  4KR5 A;  3RT6 B;  1JVY A;  1VSO A;  2O1L A;  3KGC A;  1D9Y A;  3UGW A;  3C34 A;  2R8T A;  3C31 A;  4YIC A;  1IIW A;  4R74 A;  1DOT A;  4MCO A;  2GHA A;  1B32 A;  3ZKK A;  3DRF A;  3DM0 A;  2NVU B;  1ZJL A;  2PT2 A;  3CHG A;  2ONS A;  4N4U A;  4DCX A;  1SYH A;  1FBC A;  4OTE A;  1FJ9 A;  4F3B A;  4ZDM A;  1US5 A;  1FCK A;  4DLD A;  4KYD A;  2MKZ A;  2XX8 A;  2QS2 A;  1D9V A;  1FBF A;  4IY5 A;  1B1X A;  4XF5 A;  1H3D A;  1HSJ A;  5ELV A;  4LZ7 A;  1DPE A;  1FTA A;  3LSW A;  1JP4 A;  5DVI A;  4RNS A;  3IOT A;  1AL3 A;  3NOH A;  4X8R A;  4MX6 A;  1QVS A;  2R71 A;  1B3F A;  4G2Z A;  3MZ9 A;  2AYS A;  5B7D A;  2CEX A;  4IGR A;  5HBC A;  3CIJ A;  2PCR A;  1JVX A;  4F2Q A;  4JB7 A;  3PUZ E;  1GTK A;  3TCF A;  1BP5 A;  1G0I A;  4P56 A;  4R73 A;  5CMC A;  1SW1 A;  5B70 A;  2O69 A;  4NF4 A;  1FBG A;  3HPI A;  4N07 A;  2R9J A;  3W15 C;  3TCH A;  5LTC A;  5JTY B;  3F11 A;  4MBP A;  4PGN A;  4E0W A;  1OMP A;  4NF6 B;  2QMW A;  4GWY A;  1GR2 A;  4NED A;  2A5T A;  5L8D A;  4LUB A;  3SER A;  1USY E;  1HSE A;  1LAX A;  3FBP A;  3MVY A;  1FBH A;  1AMF A;  2F7B A;  2DS9 A;  4H46 A;  3MWB A;  2F6G A;  4FAJ A;  3PAM A;  2QVU A;  5HPQ A;  5CMB A;  1B7U A;  3C36 A;  5JK4 A;  1P1N A;  4G68 C;  3OO6 A;  2XXK A;  1ELJ A;  3FXB A;  3RPL A;  3C33 A;  3PD8 A;  3N26 A;  5FBP A;  3EHS A;  1Z7M E;  3TTR A;  3TTN A;  4JSD A;  3PPR A;  1CNQ A;  3BBR A;  1MRP A;  4DIG A;  2GQ1 A;  1JNF A;  3H6W A;  4U23 A;  2NXO A;  4RA1 A;  4GX3 A;  4YB7 A;  1NUY A;  1FQD A;  1AH5 A;  3U8Q A;  1B58 A;  4PCD A;  2VP1 A;  5CC2 A;  2Y7W A;  3D4G A;  2G93 A;  3ZS6 A;  2CZI A;  1P1Q A;  1P1U A;  2QSX A;  4N13 A;  1EYJ A;  2ZYK A;  2UVH A;  3QIM A;  5EHS A;  2FHY A;  1M5B A;  4PET A;  1FPG A;  2QPQ A;  4KYE A;  5L9O A;  2D5W A;  2XXW A;  1MS7 A;  1EZ9 A;  3MYU A;  1LAG E;  1ZKB A;  1JEU A;  4GWX A;  1Q9D A;  3FVK A;  2ZZX A;  3WAF A;  2F6P A;  4P0I A;  5EQ9 A;  1B0H A;  2RC8 A;  3MST A;  4EQB A;  3FZV A;  1DBZ A;  2F5X A;  3HO7 A;  3QK6 A;  3K6X A;  3T9X B;  3H06 B;  1LST A;  3RTW B;  5JTY A;  4GIZ A;  1NV3 A;  2ZNU A;  3O9P A;  4NF6 A;  3Q25 A;  3BKI B;  1QUJ A;  2O68 A;  3FV2 A;  4YB5 A;  1LB8 A;  2H5Y A;  1SW2 A;  3MJN A;  1MQH A;  1XI6 A;  3U65 A;  2Y84 A;  4NG7 A;  3FXR A;  1D3K A;  2P3V A;  1POT A;  2IEE A;  3UP9 A;  2F34 A;  2CZL A;  5F24 A;  2WOK A;  4G68 B;  2Y7K A;  5DW8 A;  3OOA A;  3DRJ A;  2HAV A;  2I3W A;  5AA4 B;  5TPA B;  4OER A;  2Q8M A;  1SYI A;  1BTJ A;  3SEV A;  4IR8 A;  5H8F B;  1H45 A;  1FQE A;  4L17 A;  4I1D A;  2O6A A;  2XXT A;  1B7H A;  4U21 A;  5AA1 A;  1VE4 A;  2WYP A;  3VLV A;  4IO6 A;  4OVJ A;  3CFZ A;  4QSE A;  3MBP A;  4GVO A;  2HCA A;  5DVF A;  4OES A;  3FGS A;  4LQ2 A;  3MAM A;  1H76 A;  1M5C A;  1H43 A;  2FYI A;  4QFN A;  3PPP A;  3ROJ A;  3VVE A;  3RYB A;  1YYZ A;  4LZ5 A;  4E0X A;  5ISU A;  2I48 A;  2ONR A;  2KR0 A;  1PBQ A;  2V4C A;  5AA2 A;  2HXW A;  3MP8 A;  4R75 A;  3T9H B;  4OWD A;  3R6U A;  3Q27 A;  4ND9 A;  1MY0 A;  3IAZ A;  4H0W A;  2DE4 A;  3TUS A;  1MH3 A;  1EH3 A;  1J1N A;  5IGA A;  1Y4C A;  1LBV A;  3GLB A;  2WYK A;  3KFM A;  3C4M A;  3L6G A;  3V89 B;  4N6D A;  4BDL A;  1CE2 A;  3PU5 A;  3LBS A;  1B5J A;  4EXL A;  3E3K A;  2I6E A;  3PMW A;  2ZZV A;  4YKP A;  3IO4 A;  5J16 A;  1FTK A;  1N7W A;  1NMU A;  1N3W A;  3O97 A;  3KSJ A;  5I2K B;  4PQJ A;  2HXR A;  1URS A;  4X1B A;  2XWO A;  4I8C A;  2D21 A;  2OX3 A;  5I2N A;  2Z8E A;  4Q8R A;  3RPW A;  4IY6 A;  1H44 A;  2DYX A;  4GL8 A;  4YAH X;  1EYK A;  5L9S A;  4PAK A;  1FTM A;  2RC9 A;  4G68 A;  1B3H A;  3MC2 A;  3SDF A;  3S9E A;  5AA4 A;  5TPA A;  2B65 A;  1XVY A;  1B4H A;  5DYH A;  4ZZA A;  5H8F A;  3RNN A;  1QUK A;  4OHN A;  4R6K A;  1XOC A;  3D1R A;  5H8N B;  4XFE A;  3CRB A;  4H5G A;  4ZS9 A;  4GX6 A;  4FE8 A;  3H3G A;  1MQJ A;  5ICT A;  3QUF A;  3GBA A;  4MH5 A;  2GFE A;  4ESW A;  1YZ0 A;  3S9N C;  4KPT A;  1US4 A;  1TWY A;  4HE1 A;  4PE3 A;  3LC8 A;  2ZXT A;  1DTZ A;  1FBE A;  5KCJ B;  3ILU B;  1R9Q A;  1I6A A;  4LA9 A;  4DZ1 A;  3MW0 A;  1Y1Z A;  2FIX A;  2OBG A;  3K1M A;  1JW4 A;  4P1L A;  4BDR A;  5IZZ A;  1FQA A;  3U92 A;  4FEB A;  1JW5 A;  4HCW A;  2OWZ A;  4ELO A;  2E1S A;  3EKI A;  3UOR A;  3WAE A;  4WXJ A;  4ELR A;  3CVG A;  1SW5 A;  3IFC A;  3BFU A;  3CI8 A;  3G3K A;  4OVS A;  1N0T A;  1R1N A;  4ZE8 A;  2HPG A;  1UTB B;  3KG2 A;  2REG A;  2V25 A;  3VVD A;  5EQ8 A;  4HS7 A;  2P1S A;  4KXP A;  5I56 B;  4N91 A;  2HAU A;  5DT6 A;  2H9B A;  2Q89 A;  4IO3 A;  3IO6 A;  4GRK A;  2QFL A;  3FIR A;  5I2K A;  1FBP A;  3HFU A;  2UVI A;  4N6P A;  3TTK A;  2YJP A;  3O28 A;  2V3Q A;  1OIB A;  2PBW A;  2QJE A;  4F31 B;  3B6W A;  5A5X A;  1YXI A;  2OJT A;  4ECF A;  1MPC A;  4LON B;  1O64 A;  4DI3 D;  3VLU A;  3KBZ A;  2XA5 A;  1NV5 A;  3V83 A;  2FVZ A;  3IB1 A;  1PBP A;  4LAT A;  4DI4 B;  3T1B A;  1MY4 A;  3SKP A;  1P99 A;  3PPQ A;  2XHD A;  4F1Y A;  4UAB A;  1B3L A;  4OAN A;  5H8N A;  2XWV A;  3RT8 A;  3W9V A;  2XD2 A;  3A29 A;  3TZA A;  3MVX A;  1URG A;  2F78 A;  2PT1 A;  2X26 A;  4NWD A;  4PFR A;  3RTF B;  3UN6 A;  3FVN A;  4ZEK A;  1MXV A;  3LUY A;  2WOL A;  4RYA A;  1NL5 A;  4ZZE A;  4OXV A;  3E79 A;  4GWO A;  2DWH A;  2VPO A;  1Y4T A;  4RPO A;  1NV7 A;  4GBV A;  2THI A;  1ZIU A;  2UXA A;  2HQ0 A;  4F39 A;  3KBR A;  1FQC A;  4PAI A;  4NN3 A;  4HW8 A;  3K2D A;  4Q30 B;  1MQD A;  4PFB A;  2P2A A;  3PUX E;  1MXZ A;  1LBB A;  1UIV A;  3ECR A;  4HE2 A;  2Q2C A;  4H8J A;  4WKM A;  3A09 A;  3FV1 A;  2I4B A;  3CR9 A;  3E4R A;  1NFT A;  1N3X A;  3K1N A;  3IJX B;  4MAG A;  1FPI A;  3LSF B;  5H8H B;  1UTB A;  1IXI A;  3TTL A;  3V8X B;  1ANF A;  1INP A;  1FQB A;  2QMX A;  2ZYN A;  1OQG A;  1SBP A;  4WEP A;  3OSQ A;  1OQH A;  5I56 A;  4ELQ A;  1MQG A;  2FNC A;  3T96 B;  1LCF A;  4PF6 A;  4POW A;  3MVZ A;  1RYO A;  5A5L A;  5TP9 B;  3O29 A;  1A55 A;  5I84 A;  3O2A A;  1QUL A;  4M1V A;  4Z7E A;  1IMB A;  4AB6 A;  3H7M A;  4H8I A;  3IL1 B;  4DXU A;  4G4P A;  4NF5 A;  1VDW A;  1MM6 A;  2XX9 A;  4GWS A;  1FQF A;  1MY1 A;  2X7P A;  1DSN A;  4F3P A;  1Q35 A;  1RYX A;  4PE5 B;  1IMD A;  2CMO A;  4BDO A;  3N94 A;  4F29 A;  1RDX A;  4I3Y A;  4MLV A;  1QUI A;  4EQ7 A;  4JVI A;  1EZO A;  3EN3 A;  3VVF A;  1B0L A;  3M8U A;  4F1U A;  1YCJ A;  2O51 A;  2F7A A;  4MNP A;  3FXQ A;  3KN7 A;  2QVV A;  3G3J A;  2XXU A;  4U22 A;  5EYG A;  2F97 A;  3OEM A;  2ABH A;  1B3G A;  4LVQ A;  4NMY A;  1KWH A;  4RJZ A;  4ESX A;  1SI1 A;  4OFJ A;  4EUO A;  1FBD A;  1NUX A;  3KC0 A;  5I59 B;  3CSG A;  4IO5 A;  4GD5 A;  4GXS B;  4PDD A;  3G3F A;  2M8C A;  1MQI A;  2O84 X;  3OO7 A;  2RC7 A;  5M2V A;  1UTH B;  3O6H A;  5H8H A;  1SVX B;  1A8F A;  5F7V A;  1B46 A;  2PX1 A;  3K01 A;  4P47 A;  3PMV A;  1N7X A;  4TOZ A;  2BJI A;  4UAC A;  4PFY A;  1QW0 A;  1RDY A;  3I3V A;  3RN8 A;  3CFL A;  1B52 A;  2XWK A;  3OO9 A;  5IM2 A;  1POY 1;  1IXG A;  1HSL A;  1YTV A;  1LFI A;  4MNI A;  3FAT A;  3IB0 A;  3O6I A;  2WEF A;  2FA7 A;  2WBD A;  1MM7 A;  4PBH A;  4K3F A;  2L5V A;  3JV9 A;  2AL5 A;  4C0R A;  4RPN A;  2DVZ A;  2Q2A A;  3C32 A;  3ILT B;  1Y20 A;  1SDX A;  1UQW A;  4MHF A;  2KQZ A;  4G8M A;  5ITO A;  2VT5 A;  2G29 A;  4GX4 A;  1URD A;  3HN0 A;  1IMA A;  2OK2 A;  1FPD A;  4HE0 A;  5CMM A;  1Y9U A;  5I7I A;  4KFQ A;  1MY2 A;  2R6G E;  3CG3 A;  3Q26 A;  4MEV A;  1TFA A;  2DOJ A;  2DDK A;  1GVC A;  3EQ1 A;  1NH7 A;  1MH4 A;  4Z0I A;  1LLS A;  2Z8D A;  3PPO A;  1OVB A;  4QSD A;  3SES A;  1LBZ A;  3MQ9 A;  2F8D A;  4N8Y A;  2F35 A;  3TOD A;  2UYE A;  1B2H A;  1SQY A;  3TQL A;  3ONM A;  1VR5 A;  2YLN A;  1FPE A;  4C1T A;  3RYD A;  3H03 A;  3U72 A;  1SW4 A;  3EHT A;  4THI A;  1IQ7 A;  3M3K A;  3IB2 A;  1NV4 A;  3FXU A;  5IZ1 A;  4MJO A;  5BWJ A;  3TEL A;  2I58 A;  4IGT A;  1I6B A;  4MF3 A;  3HHF A;  1ZTY A;  2V84 A;  3IR1 A;  1OVT A;  1S50 A;  1DPP A;  3RGY A;  4F2O A;  1M5D A;  3SET A;  2F7C A;  1D9Q A;  3E13 X;  3PTY A;  1S9T A;  4GWU A;  4FED A;  1TFD A;  1UTH A;  2PFZ A;  5ESY A;  1NNK A;  4OFL A;  1F9B A;  3QXM A;  4NHB A;  3MPK A;  3FD3 A;  1R6Z A;  4N8G A;  4RK2 A;  1PB8 A;  1NV2 A;  4NQ8 A;  3PMX A;  1SD3 A;  2Q74 A;  4OA4 A;  3D4C A;  1M5F A;  4H1X A;  4JDF A;  3T22 A;  2QRY A;  2OZZ A;  5H8Q B;  4MMP A;  4O3B A;  3TEP A;  4XTC Q;  1USY H;  3B6T A;  4UA8 A;  3O6G A;  2O7I A;  3E9X A;  3RYA A;  2RF1 A;  5LDZ A;  1MXY A;  3TMG A;  4DCY A;  4JWO A;  2ALU A;  4DE8 A;  2VOZ A;  3BIG A;  5AA2 D;  4YKK A;  5J1D A;  1Y3N A;  1IIT A;  2B3B A;  5CMK A;  2O1M A;  1XS5 A;  1IEJ A;  1M5E A;  1ZU0 A;  4EF1 A;  2DE2 A;  3K02 A;  4X9T A;  1QGX A;  5ET8 A;  3RUM A;  1MXW A;  3QSL A;  4N17 A;  1A40 A;  4ONY A;  1LBX A;  5EQ7 A;  3VXB A;  1D4N A;  3VV5 A;  2CZH A;  3TAJ A;  3DP4 A;  4GBW A;  3B50 A;  1N76 A;  4FOR A;  1B40 A;  3G7W A;  2ZYM A;  4QSC A;  4MLQ A;  1ZMG A;  3T0J A;  1YAE A;  1BK4 A;  4PF8 A;  1A7L A;  3SZP A;  1NNP A;  1AOV A;  4NE4 A;  2ANJ A;  3Q29 A;  2PMS A;  2I4C A;  1II5 A;  3EF7 A;  1EU8 A;  2DSF A;  4ZEF A;  1OLC A;  2ESN A;  1JEV A;  3MPL A;  3QUJ A;  1IUD A;  3TPA A;  4OEU A;  2FIE A;  2UVG A;  3OEN A;  3G3H A;  4YU0 A;  3TQW A;  3OD7 A;  4ELP A;  3RLF E;  3IX1 A;  4Q0C A;  4QFO A;  3S2V A;  4QXD A;  3KZG A;  1NNT A;  4PFW A;  3O6P A;  2Y5K A;  3C9H A;  2WX9 A;  4PAF A;  1LFH A;  4G61 A;  2XXP A;  4KI0 E;  2DWA A;  3K00 A;  1FPF A;  3FJ7 A;  4YMA A;  5H8Q A;  2VPN A;  1B5H A;  4PDH A;  3FJM A;  1FPJ A;  1FRP A;  2IA4 A;  3IOW A;  4FJP A;  5EHM A;  3TKD A;  4QRZ A;  4I62 A;  4P11 A;  1NV1 A;  4QFK A;  4H67 A;  1BKA A;  4AB5 A;  1B7Z A;  2HZK A;  3I5O A;  1LBY A;  5BUU A;  5CBR A;  1ATG A;  1B3E A;  3PD9 A;  1N84 A;  5K2X A;  1B05 A;  3H6T A;  3R26 A;  4GLI A;  3LSL A;  3PV0 E;  4TLM B;  3DLN A;  2AIX A;  2Y7R A;  4OFO A;  2GHB A;  3JYR A;  3OEL A;  4U4S A;  3IK6 B;  1PB7 A;  2PYY A;  4WED A;  3GYY A;  1B4Z A;  2KLF A;  1EZP A;  5I57 B;  4YZZ A;  3HHG A;  1IZ1 A;  1NV6 A;  1K9Y A;  4G77 A;  5EYH A;  3UA8 A;  1A8E A;  3HST A;  2HHM A;  4P3L A;  1FW0 A;  4PFI A;  1S7Y A;  4XKQ A;  1LBW A;  4R9G A;  1LAF E;  1R9L A;  3S4U A;  3ISP A;  3VE1 B;  4GXA A;  1SI0 A;  2P0S A;  4ISU A;  1G0H A;  1IMC A;  2UYF A;  4KCD A;  5CRY A;  1O63 A;  3E78 A;  3TCG A;  4GF8 A;  4QFP A;  4ZED A;  5HM4 B;  5DEX B;  4EQ9 A;  3UIF A;  5CI5 A;  4JVC A;  2OWS A;  4U4X A;  4YB6 A;  5ET5 A;  3KSX A;  4OVR A;  4FAT A;  4Q5T A;  1KZ8 A;  3LVU A;  2DXY A;  4JSO A;  5KCJ A;  3DP8 A;  2RCA A;  4KQP A;  3VDF A;  4FIM A;  2Q88 A;  3R7X A;  4AS5 A;  5ET7 A;  4EDP A;  4YKJ A;  2JJK A;  1FTL A;  4P8B A;  1T0K A;  1MG1 A;  4U1Z A;  1K9Z A;  3HV1 A;  5K2Y A;  5ET6 A;  2CEY A;  1JET A;  4TLL B;  4NX1 A;  3KC1 A;  2NOO A;  1NH8 A;  3EHU A;  5IAI A;  3TFL A;  2Y7I A;  4JVD A;  2HZL A;  1NI9 A;  3RPL B;  2XX7 A;  1SPI A;  2QS1 A;  4G8N A;  1A99 A;  1DMB A;  3V5A A;  1QKB A;  2QL3 A;  2F3B A;  2REJ A;  4O3C A;  3VXC A;  1VFD A;  2XXV A;  2XXX A;  3IJO B;  4KD5 A;  4NGU A;  2VD2 A;  5H8S A;  5I58 B;  2ZNT A;  1B1H A;  1XVX A;  3ZKL A;  5I57 A;  3TTM A;  1DK4 A;  3BFT A;  1QKA A;  2OWT A;  3PUY E;  4I40 A;  1UIU A;  1CB6 A;  3PPN A;  2QVR A;  2A5S A;  1KA0 A;  4YMB A;  4BDM A;  3OO8 A;  5FTI A;  3SEW A;  4QBA A;  2V93 A;  4POX A;  3JZJ A; 
#chains in the Genus database with same CATH homology
 5ICQ A;  4IO7 A;  5JEI A;  3A3C A;  3TYH A;  4RK9 A;  3W9W A;  4XKR A;  2UVJ A;  1MXU A;  4HCY A;  3THI A;  1LAH E;  5DEX A;  1A54 A;  1MY3 A;  4NWC A;  2O7U A;  3U1O A;  1XHY A;  1FTO A;  4P0G A;  1B51 A;  3CFX A;  2QS3 A;  1LBC A;  2Y7P A;  3O66 A;  1Y3Q A;  1MXX A;  2I0B A;  4R2F A;  4LZ8 A;  4XKN A;  4XXU A;  2QS4 A;  3FVO A;  4EXK A;  3FTO A;  2I0C A;  5FTH A;  3PGF A;  3KN3 A;  3ZSF A;  2X7Q A;  5I58 A;  5TP9 A;  2Q8J A;  3GXA A;  2DXR A;  3CSB A;  1MPD A;  5KZT A;  2V3U A;  4GQO A;  3S9L C;  1LCT A;  2Z8F A;  4XKP A;  5AA2 B;  4ZEC A;  3T66 A;  4ZEI A;  3IOR A;  4ZE9 A;  1I69 A;  3FUZ A;  3DEL B;  2Q9T A;  4DDD A;  1MDP 1;  5KDT B;  4HTG A;  1BLF A;  3G3G A;  4JXI A;  4LP2 B;  4IB2 A;  1RKM A;  4R9F A;  4R6H A;  3SEY A;  1NKX A;  1Q1K A;  4IO4 A;  2GRV A;  2NWJ A;  4KHZ E;  3MP6 A;  3KEI A;  1XT8 A;  3FJG A;  5FHN A;  5ITP A;  1VFE A;  4M4G A;  2F36 A;  2XD3 A;  4JWY A;  4QHQ A;  3K1P A;  3KJ7 A;  2Z23 A;  4FEC A;  4H6D A;  2DP8 A;  4DXC A;  1FTJ A;  3KJT A;  2PVU A;  5I2N B;  1JQF A;  1P1O A;  2H98 A;  3SEU A;  5I59 A;  4KYS A;  2B4L A;  3SEX A;  1MDQ A;  1P1W A;  4PP0 A;  4RY1 A;  1AIV A;  1NNF A;  2OCU A;  1B9J A;  3DRI A;  4OEV A;  1IXH A;  3VFJ A;  3B6Q A;  4PFU A;  2DVC A;  3USD A;  3QYT A;  2W7Y A;  3KOT A;  4OEN A;  5FHO A;  1PDA A;  2XXH A;  1O7T A;  2RKM A;  3C35 A;  1YPN A;  5AE4 A;  3DRK A;  3Q28 A;  1Z7N E;  2NUV A;  3MZ1 A;  3MUQ A;  2ONK E;  4R72 A;  2OLB A;  5L9M A;  2H25 A;  1DTG A;  3H4Z A;  3A3U A;  3H6V A;  4H5F A;  3PUW E;  1PEB A;  3L6H A;  1MPB A;  4H65 A;  2E0S A;  3IOV A;  1ZBM A;  4GOT A;  3FVG A;  1Y3P A;  4U2R A;  5F1Q A;  5DVJ A;  1WDN A;  3AXF A;  3U93 A;  5KDT A;  4JWX A;  3K6U A;  1ZLQ A;  3KOS A;  4IO2 A;  3U94 A;  4YKI A;  4O3A A;  3RQT A;  2RIN A;  3OEK A;  4EF2 A;  4G8H A;  4QF9 A;  2H4I A;  2GH9 A;  2LAO A;  5EYF A;  2XXY A;  3MP1 A;  3K0V A;  1LGB C;  1XC1 A;  4TQU Q;  3B7D A;  2DWI A;  3MVW A;  5DTB A;  3VLW A;  4NF8 B;  1LFG A;  2ZNS A;  2D3I A;  2YPN A;  1I6Q A;  2H99 A;  2V3T A;  3P7I A;  3GBB A;  5A5X B;  3TDJ A;  1B5I A;  4C1U A;  1OLA A;  4F1V A;  4OZ9 A;  2AL4 A;  4BDN A;  3PUV E;  1GV8 A;  3OMB A;  4OYV A;  4OQO A;  2XXR A;  5CBS A;  2WOP A;  3K4U A;  1LB9 A;  3DRG A;  1WVJ A;  3UK4 A;  3RY3 A;  5FHM A;  3T9U A;  4F22 A;  4ZEB A;  1PC3 A;  4DXB A;  4F19 A;  3N6T A;  4GFR A;  4KCC A;  4BLA A;  3LR1 A;  1QJM A;  4NTL A;  3HCQ A;  1TT1 A;  3S9M C;  1IXC A;  4LQ5 A;  3M3F A;  3K6W A;  5LOM A;  2DQV A;  1TXF A;  1B6H A;  4I9D A;  2XXQ A;  4MFI A;  2ZMB A;  4X1D A;  2I49 A;  2Z22 A;  2B4M A;  4PFT A;  4JBZ A;  3T93 B;  4XIG Q;  3LSX A;  3MZB A;  5TU0 A;  3I6V A;  4QFL A;  3CG1 A;  3GZG A;  2I3V A;  1Y1M A;  2DE3 A;  4AQ4 A;  3OXN A;  2XXI A;  1L5T A;  4OMB A;  4GL0 A;  3FAS A;  2HFB A;  2VGQ A;  2VD3 A;  3EPE A;  5CM6 A;  4NF8 A;  3ODB A;  3M3L A;  3OSR A;  3QAX A;  1N04 A;  2B3F A;  3G3I A;  2WKY A;  4RXL A;  5AA3 A;  2DWJ A;  3DRH A;  2HEU A;  3DP6 A;  2ZYO A;  1WOD A;  4U1O A;  3IOU A;  3H6U A;  4NF5 B;  4R6Y A;  3K6V A;  1JW1 A;  3KN8 A;  4NF4 B;  4OET A;  3N5L A;  3T9V A;  2RCB A;  1BIY A;  4X48 A;  3N6U A;  4R2B A;  4F18 A;  4F3G A;  1PB9 A;  5IKB A;  2VHA A;  2A5T B;  4BDQ A;  2BJJ X;  1GGG A;  4F3S A;  4KR5 A;  3RT6 B;  1JVY A;  1VSO A;  2O1L A;  3KGC A;  1D9Y A;  3UGW A;  3C34 A;  3C31 A;  4YIC A;  1IIW A;  4R74 A;  1DOT A;  2GHA A;  1B32 A;  3ZKK A;  3DRF A;  3DM0 A;  2NVU B;  1ZJL A;  2PT2 A;  3CHG A;  2ONS A;  4DCX A;  1SYH A;  4OTE A;  4F3B A;  4ZDM A;  1US5 A;  1FCK A;  4DLD A;  4KYD A;  2XX8 A;  2QS2 A;  1D9V A;  4IY5 A;  1B1X A;  1H3D A;  1HSJ A;  5ELV A;  4LZ7 A;  1DPE A;  3LSW A;  5DVI A;  4RNS A;  3IOT A;  1AL3 A;  1QVS A;  2R71 A;  1B3F A;  4G2Z A;  3MZ9 A;  2AYS A;  5B7D A;  4IGR A;  5HBC A;  3CIJ A;  1JVX A;  4F2Q A;  4JB7 A;  3PUZ E;  1GTK A;  3TCF A;  1BP5 A;  4R73 A;  5CMC A;  1SW1 A;  5B70 A;  2O69 A;  4NF4 A;  3HPI A;  4N07 A;  2R9J A;  3W15 C;  3TCH A;  5JTY B;  3F11 A;  4MBP A;  4E0W A;  1OMP A;  4NF6 B;  2QMW A;  1GR2 A;  4NED A;  2A5T A;  5L8D A;  4LUB A;  3SER A;  1USY E;  1HSE A;  1LAX A;  3MVY A;  1AMF A;  2F7B A;  2DS9 A;  3MWB A;  2F6G A;  4FAJ A;  3PAM A;  5HPQ A;  5CMB A;  1B7U A;  3C36 A;  5JK4 A;  1P1N A;  4G68 C;  3OO6 A;  1ELJ A;  3C33 A;  3PD8 A;  3N26 A;  3EHS A;  1Z7M E;  3TTR A;  3TTN A;  4JSD A;  3PPR A;  3BBR A;  1MRP A;  4DIG A;  1JNF A;  3H6W A;  4U23 A;  2NXO A;  4RA1 A;  4YB7 A;  1FQD A;  1AH5 A;  3U8Q A;  1B58 A;  2VP1 A;  5CC2 A;  2Y7W A;  3D4G A;  2G93 A;  3ZS6 A;  1P1Q A;  1P1U A;  2QSX A;  4N13 A;  2ZYK A;  2UVH A;  3QIM A;  5EHS A;  1M5B A;  4PET A;  2QPQ A;  4KYE A;  5L9O A;  2D5W A;  2XXW A;  1MS7 A;  1EZ9 A;  1LAG E;  1ZKB A;  1JEU A;  3FVK A;  3WAF A;  2F6P A;  4P0I A;  1B0H A;  2RC8 A;  4EQB A;  3FZV A;  2F5X A;  3HO7 A;  3QK6 A;  3K6X A;  3T9X B;  3H06 B;  1LST A;  3RTW B;  5JTY A;  4GIZ A;  2ZNU A;  3O9P A;  4NF6 A;  3Q25 A;  3BKI B;  1QUJ A;  2O68 A;  3FV2 A;  4YB5 A;  1LB8 A;  2H5Y A;  1SW2 A;  3MJN A;  1MQH A;  2Y84 A;  3FXR A;  1D3K A;  1POT A;  2IEE A;  3UP9 A;  2F34 A;  2CZL A;  2WOK A;  4G68 B;  2Y7K A;  3OOA A;  3DRJ A;  2HAV A;  2I3W A;  5AA4 B;  5TPA B;  4OER A;  1SYI A;  1BTJ A;  3SEV A;  5H8F B;  1H45 A;  1FQE A;  4L17 A;  4I1D A;  2O6A A;  2XXT A;  1B7H A;  4U21 A;  5AA1 A;  1VE4 A;  3VLV A;  4IO6 A;  4OVJ A;  3CFZ A;  4QSE A;  3MBP A;  4GVO A;  2HCA A;  5DVF A;  4OES A;  3FGS A;  4LQ2 A;  3MAM A;  1H76 A;  1M5C A;  1H43 A;  2FYI A;  4QFN A;  3PPP A;  3VVE A;  3RYB A;  4LZ5 A;  4E0X A;  5ISU A;  2I48 A;  2ONR A;  1PBQ A;  5AA2 A;  2HXW A;  3MP8 A;  4R75 A;  3T9H B;  4OWD A;  3R6U A;  3Q27 A;  4ND9 A;  1MY0 A;  3IAZ A;  4H0W A;  2DE4 A;  3TUS A;  1MH3 A;  1EH3 A;  1J1N A;  1Y4C A;  3GLB A;  3KFM A;  3C4M A;  3L6G A;  3V89 B;  4BDL A;  1CE2 A;  3PU5 A;  3LBS A;  1B5J A;  4EXL A;  3E3K A;  2I6E A;  3PMW A;  4YKP A;  3IO4 A;  1FTK A;  1N7W A;  1NMU A;  1N3W A;  3O97 A;  3KSJ A;  5I2K B;  4PQJ A;  1URS A;  4X1B A;  4I8C A;  2D21 A;  5I2N A;  2Z8E A;  4Q8R A;  3RPW A;  4IY6 A;  1H44 A;  2DYX A;  4GL8 A;  4YAH X;  5L9S A;  1FTM A;  2RC9 A;  4G68 A;  1B3H A;  3MC2 A;  3SDF A;  3S9E A;  5AA4 A;  5TPA A;  2B65 A;  1XVY A;  1B4H A;  5DYH A;  4ZZA A;  5H8F A;  3RNN A;  1QUK A;  4OHN A;  4R6K A;  1XOC A;  5H8N B;  3CRB A;  4H5G A;  4ZS9 A;  4FE8 A;  3H3G A;  1MQJ A;  5ICT A;  3QUF A;  3GBA A;  4ESW A;  4MH5 A;  2GFE A;  3S9N C;  4KPT A;  1US4 A;  1TWY A;  3LC8 A;  2ZXT A;  1DTZ A;  5KCJ B;  3ILU B;  1R9Q A;  1I6A A;  4LA9 A;  4DZ1 A;  3MW0 A;  1Y1Z A;  2OBG A;  3K1M A;  1JW4 A;  4BDR A;  1FQA A;  3U92 A;  4FEB A;  1JW5 A;  4HCW A;  4ELO A;  2E1S A;  3UOR A;  3WAE A;  4WXJ A;  4ELR A;  3CVG A;  1SW5 A;  3BFU A;  3CI8 A;  3G3K A;  1N0T A;  1R1N A;  4ZE8 A;  1UTB B;  3KG2 A;  2REG A;  2V25 A;  3VVD A;  4HS7 A;  2P1S A;  5I56 B;  2HAU A;  5DT6 A;  2H9B A;  2Q89 A;  4IO3 A;  3IO6 A;  4GRK A;  3FIR A;  5I2K A;  2UVI A;  4N6P A;  3TTK A;  2YJP A;  3O28 A;  2V3Q A;  1OIB A;  2PBW A;  2QJE A;  4F31 B;  3B6W A;  5A5X A;  2OJT A;  4ECF A;  1MPC A;  4LON B;  1O64 A;  3VLU A;  3V83 A;  3IB1 A;  1PBP A;  4LAT A;  1MY4 A;  3SKP A;  1P99 A;  3PPQ A;  2XHD A;  4F1Y A;  1B3L A;  5H8N A;  3RT8 A;  3W9V A;  2XD2 A;  3TZA A;  3MVX A;  1URG A;  2F78 A;  2PT1 A;  2X26 A;  4NWD A;  3RTF B;  3UN6 A;  3FVN A;  4ZEK A;  1MXV A;  3LUY A;  2WOL A;  4RYA A;  1NL5 A;  4ZZE A;  4OXV A;  4GWO A;  2DWH A;  1Y4T A;  4RPO A;  2THI A;  1ZIU A;  2UXA A;  2HQ0 A;  4F39 A;  3KBR A;  1FQC A;  4HW8 A;  3K2D A;  4Q30 B;  1MQD A;  2P2A A;  3PUX E;  1MXZ A;  1LBB A;  1UIV A;  3ECR A;  2Q2C A;  4H8J A;  4WKM A;  3A09 A;  3FV1 A;  2I4B A;  3CR9 A;  3E4R A;  1NFT A;  1N3X A;  3K1N A;  3IJX B;  3LSF B;  5H8H B;  1UTB A;  1IXI A;  3TTL A;  3V8X B;  1ANF A;  1FQB A;  2QMX A;  2ZYN A;  1OQG A;  1SBP A;  4WEP A;  3OSQ A;  1OQH A;  5I56 A;  4ELQ A;  1MQG A;  2FNC A;  3T96 B;  1LCF A;  4POW A;  3MVZ A;  1RYO A;  5TP9 B;  3O29 A;  1A55 A;  5I84 A;  3O2A A;  1QUL A;  4M1V A;  4Z7E A;  4AB6 A;  3H7M A;  4H8I A;  3IL1 B;  4DXU A;  4G4P A;  4NF5 A;  1MM6 A;  2XX9 A;  1FQF A;  1MY1 A;  2X7P A;  1DSN A;  4F3P A;  1Q35 A;  1RYX A;  4PE5 B;  2CMO A;  4BDO A;  3N94 A;  4F29 A;  4MLV A;  1QUI A;  4EQ7 A;  1EZO A;  3EN3 A;  3VVF A;  1B0L A;  3M8U A;  4F1U A;  1YCJ A;  2O51 A;  2F7A A;  3FXQ A;  3KN7 A;  3G3J A;  2XXU A;  4U22 A;  2F97 A;  3OEM A;  2ABH A;  1B3G A;  4LVQ A;  4NMY A;  1KWH A;  4RJZ A;  4ESX A;  1SI1 A;  4OFJ A;  4EUO A;  5I59 B;  3CSG A;  4IO5 A;  4GD5 A;  4GXS B;  3G3F A;  2M8C A;  1MQI A;  2O84 X;  3OO7 A;  2RC7 A;  5M2V A;  1UTH B;  3O6H A;  5H8H A;  1SVX B;  1A8F A;  5F7V A;  1B46 A;  2PX1 A;  3K01 A;  3PMV A;  1N7X A;  4TOZ A;  4UAC A;  4PFY A;  1QW0 A;  3I3V A;  3RN8 A;  3CFL A;  1B52 A;  3OO9 A;  1POY 1;  1IXG A;  1HSL A;  1YTV A;  1LFI A;  3FAT A;  3IB0 A;  3O6I A;  2FA7 A;  1MM7 A;  4K3F A;  3JV9 A;  2AL5 A;  4C0R A;  4RPN A;  2DVZ A;  2Q2A A;  3C32 A;  3ILT B;  1Y20 A;  1SDX A;  1UQW A;  4G8M A;  5ITO A;  2G29 A;  1URD A;  3HN0 A;  2OK2 A;  5CMM A;  1Y9U A;  4KFQ A;  1MY2 A;  2R6G E;  3CG3 A;  3Q26 A;  1TFA A;  2DOJ A;  1GVC A;  3EQ1 A;  1NH7 A;  1MH4 A;  4Z0I A;  1LLS A;  2Z8D A;  3PPO A;  1OVB A;  4QSD A;  3SES A;  3MQ9 A;  2F8D A;  2F35 A;  3TOD A;  2UYE A;  1B2H A;  1SQY A;  3TQL A;  3ONM A;  1VR5 A;  2YLN A;  4C1T A;  3H03 A;  3U72 A;  1SW4 A;  3EHT A;  4THI A;  1IQ7 A;  3M3K A;  3IB2 A;  3FXU A;  5BWJ A;  3TEL A;  2I58 A;  4IGT A;  1I6B A;  4MF3 A;  3HHF A;  1ZTY A;  2V84 A;  3IR1 A;  1OVT A;  1S50 A;  1DPP A;  3RGY A;  4F2O A;  1M5D A;  3SET A;  2F7C A;  3E13 X;  1S9T A;  4FED A;  1TFD A;  1UTH A;  1NNK A;  4OFL A;  1F9B A;  3QXM A;  3MPK A;  3FD3 A;  1R6Z A;  4RK2 A;  1PB8 A;  3PMX A;  1SD3 A;  3D4C A;  1M5F A;  4H1X A;  4JDF A;  3T22 A;  2QRY A;  2OZZ A;  5H8Q B;  4O3B A;  3TEP A;  4XTC Q;  1USY H;  3B6T A;  4UA8 A;  3O6G A;  2O7I A;  3E9X A;  3RYA A;  2RF1 A;  1MXY A;  3TMG A;  4DCY A;  4JWO A;  2ALU A;  4DE8 A;  2VOZ A;  5AA2 D;  4YKK A;  5J1D A;  1Y3N A;  1IIT A;  2B3B A;  5CMK A;  2O1M A;  1XS5 A;  1IEJ A;  1M5E A;  1ZU0 A;  4EF1 A;  2DE2 A;  3K02 A;  4X9T A;  3RUM A;  1MXW A;  3QSL A;  1A40 A;  4ONY A;  3VXB A;  1D4N A;  3VV5 A;  3TAJ A;  3DP4 A;  1N76 A;  4FOR A;  1B40 A;  3G7W A;  2ZYM A;  4QSC A;  4MLQ A;  1ZMG A;  1YAE A;  1A7L A;  1NNP A;  1AOV A;  4NE4 A;  2ANJ A;  3Q29 A;  2PMS A;  2I4C A;  1II5 A;  3EF7 A;  1EU8 A;  2DSF A;  4ZEF A;  1OLC A;  2ESN A;  1JEV A;  3MPL A;  3QUJ A;  1IUD A;  3TPA A;  4OEU A;  2UVG A;  3OEN A;  3G3H A;  4YU0 A;  3TQW A;  3OD7 A;  4ELP A;  3RLF E;  3IX1 A;  4Q0C A;  4QFO A;  3S2V A;  3KZG A;  1NNT A;  4PFW A;  3O6P A;  3C9H A;  1LFH A;  2XXP A;  4KI0 E;  2DWA A;  3K00 A;  3FJ7 A;  4YMA A;  5H8Q A;  1B5H A;  3FJM A;  2IA4 A;  3IOW A;  4FJP A;  5EHM A;  3TKD A;  4QRZ A;  4I62 A;  4P11 A;  4QFK A;  4H67 A;  1BKA A;  4AB5 A;  1B7Z A;  2HZK A;  3I5O A;  5BUU A;  5CBR A;  1ATG A;  1B3E A;  3PD9 A;  1N84 A;  5K2X A;  1B05 A;  3H6T A;  3R26 A;  4GLI A;  3LSL A;  3PV0 E;  4TLM B;  3DLN A;  2AIX A;  2Y7R A;  4OFO A;  2GHB A;  3JYR A;  3OEL A;  4U4S A;  3IK6 B;  1PB7 A;  2PYY A;  4WED A;  1B4Z A;  2KLF A;  1EZP A;  5I57 B;  4YZZ A;  3HHG A;  1IZ1 A;  4G77 A;  3UA8 A;  1A8E A;  3HST A;  1FW0 A;  1S7Y A;  4XKQ A;  4R9G A;  1LAF E;  1R9L A;  3S4U A;  3VE1 B;  4GXA A;  1SI0 A;  2P0S A;  4ISU A;  2UYF A;  4KCD A;  5CRY A;  1O63 A;  3TCG A;  4GF8 A;  4QFP A;  4ZED A;  5HM4 B;  5DEX B;  4EQ9 A;  3UIF A;  5CI5 A;  2OWS A;  4U4X A;  4YB6 A;  3KSX A;  4FAT A;  4Q5T A;  3LVU A;  2DXY A;  4JSO A;  5KCJ A;  3DP8 A;  2RCA A;  4KQP A;  3VDF A;  4FIM A;  2Q88 A;  3R7X A;  4EDP A;  4YKJ A;  1FTL A;  1T0K A;  1MG1 A;  4U1Z A;  3HV1 A;  5K2Y A;  1JET A;  4TLL B;  2NOO A;  1NH8 A;  3EHU A;  5IAI A;  3TFL A;  2Y7I A;  2HZL A;  2XX7 A;  2QS1 A;  4G8N A;  1A99 A;  1DMB A;  3V5A A;  1QKB A;  2QL3 A;  2REJ A;  4O3C A;  3VXC A;  1VFD A;  2XXV A;  2XXX A;  3IJO B;  4KD5 A;  2VD2 A;  5H8S A;  5I58 B;  2ZNT A;  1B1H A;  1XVX A;  3ZKL A;  5I57 A;  3TTM A;  3BFT A;  1QKA A;  2OWT A;  3PUY E;  1UIU A;  1CB6 A;  3PPN A;  2A5S A;  4YMB A;  4BDM A;  3OO8 A;  5FTI A;  3SEW A;  2V93 A;  4POX A;  3JZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...