1B9JA

Oligo-peptide binding protein (oppa) complexed with klk
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and calorimetric analysis of peptide binding to OppA protein.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Peptide binding protein
molecule keywords PROTEIN (OLIGO-PEPTIDE BINDING PROTEIN)
total genus 190
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1b9jA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1b9jA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1b9jA02
3KOTA 4N07A 1B40A 1B46A 3EHSA 1VE4A 2F6GA 4NF6A 2XX7A 4KHZE 1LBCA 2DWIA 4Z0IA 4BDNA 5DYHA 2I3VA 1POTA 3PD8A 5DT6A 2HZKA 3PPOA 4ZECA 4OEUA 3TYHA 4F22A 2DXYA 3OO8A 3DP8A 4KYSA 3KN3A 1NH7A 1MH4A 2F35A 1B7ZA 4HTGA 1H44A 3TTNA 3EHUA 3VE1B 1A7LA 1B4HA 3H4ZA 1SW5A 3HV1A 1PBQA 4YMAA 3K6XA 4FJPA 3DRFA 1B3GA 3EPEA 3H6WA 3H03A 2ONRA 1RYOA 2XX9A 1M5CA 1YAEA 1H76A 1USYE 3FASA 1UIUA 1LFIA 3MAMA 5J1DA 2Y7PA 4JWOA 2NVUB 5I59B 3O66A 4ZZEA 3O6GA 3B6TA 1Y3NA 4XIGQ 5TP9B 4KD5A 1OQGA 5BUUA 5AE4A 3UP9A 3RQTA 5AA2D 1LGBC 3FGSA 5I2NA 2Z22A 1OLAA 1N3XA 1B58A 4Q5TA 1MM7A 5CBSA 1B6HA 1FQAA 4NF8B 3KFMA 1H43A 3S9LC 4NF6B 1JEVA 3KOSA 3OSQA 3ILUB 4F1VA 3LSXA 4R9FA 3LR1A 3FV1A 3FUZA 5ICQA 2FA7A 1EH3A 4ELQA 2OCUA 1N3WA 1XVXA 5H8QB 4ZEDA 2DVZA 1US5A 3VLVA 2XXTA 2OBGA 3KGCA 3LVUA 3O2AA 4H6DA 4OVJA 3KG2A 1NNFA 4X9TA 4C1TA 3TCGA 1AL3A 1JETA 4DCXA 1P1NA 5FHMA 4TOZA 2PMSA 4KCCA 3ZKKA 5A5XB 2DVCA 2H4IA 2X7QA 1B2HA 2XXWA 3K6VA 3OOAA 3KBRA 5CI5A 2D21A 2NWJA 1QKAA 4XKQA 1O63A 1RKMA 1O7TA 3HHGA 5K2YA 1QUIA 3PUWE 1FQEA 2Q89A 1PB7A 3FJ7A 3QAXA 2WKYA 3PMXA 5TP9A 4QSDA 5EHMA 4FECA 4H0WA 2F7CA 1WODA 4RY1A 4U1ZA 3PPPA 4DZ1A 4GFRA 3IB2A 3RYBA 4F3GA 5I56B 2GH9A 3MVXA 2I49A 3KZGA 5DVIA 5H8NB 3BFTA 3LSWA 3IX1A 1D9YA 2H99A 2QRYA 1H3DA 1RYXA 1Y3PA 3E13X 4O3CA 4YB5A 4I8CA 1F9BA 1Z7NE 2ZNSA 1MDQA 1AOVA 3H06B 1J1NA 3IK6B 4MBPA 4IY6A 2O7IA 3IL1B 2PX1A 1WVJA 3CG1A 3IOTA 1NMUA 4LQ2A 4ZEFA 4NEDA 2O69A 1LAHE 5CMMA 3TQLA 4BLAA 3THIA 3TAJA 3TELA 2NXOA 4F39A 4ZDMA 5EYFA 2WOKA 3W9VA 4DXUA 3G3JA 2DXRA 3OO6A 4RA1A 3QUFA 4Q30B 3TODA 4QRZA 5H8HB 1TXFA 3FXRA 1PB8A 3O97A 1NNKA 4G8NA 4RK2A 4WKMA 3IR1A 5I2KB 3C34A 4ZE9A 4LP2B 5I57A 3QUJA 4EXLA 4OQOA 1UTHB 2CMOA 2R6GE 3HPIA 2F5XA 2V3UA 3KJ7A 3PUXE 1R9QA 2FNCA 1SI1A 3HO7A 4OERA 3PUZE 1LCFA 2HAUA 3RN8A 5CM6A 2GHBA 4ZS9A 3VDFA 4E0XA 3TFLA 1SD3A 3GBBA 4QFKA 2QS3A 2V25A 3F11A 3TCHA 4NWCA 3DP4A 1USYH 2XX8A 3MC2A 3TKDA 4NF8A 4ECFA 4HW8A 1SYIA 3H7MA 4XKPA 2ZYMA 1SW1A 2DYXA 4OXVA 4H65A 4G8HA 4H8IA 2UYFA 4H5FA 3OEKA 1URGA 1B1HA 1URDA 2HQ0A 3DLNA 3IO4A 1Y1MA 3UGWA 1VFDA 4M1VA 4ESXA 4OESA 4BDOA 3S4UA 2F7BA 3Q26A 1MY1A 5L9MA 2Z8EA 3G3KA 1R1NA 4LZ8A 4NWDA 1GTKA 1LB8A 1H45A 4G8MA 4LONB 1LLSA 1FQBA 4OHNA 3SDFA 3MPKA 3PUVE 4G68B 2XXPA 1LB9A 4QSEA 2RKMA 3CHGA 1B51A 1SYHA 1UTBB 1VR5A 1EZ9A 2H9BA 4KCDA 5TPAA 3U92A 4C0RA 2PVUA 1DMBA 2XXXA 1GV8A 1MQDA 2X26A 2DE4A 2ZYNA 4OENA 5AA1A 1O64A 1Y9UA 4KI0E 2ONKE 1B0HA 5FHNA 4OYVA 5FHOA 1LFGA 1FTMA 3ILTB 3DRHA 1TFAA 3PMWA 1MY0A 4IGTA 3O6IA 1XOCA 1OVTA 4L17A 1IXCA 1JW4A 1IQ7A 2XXRA 1DPEA 1B9JA 5ITPA 3IJOB 3RGYA 3MPLA 2I58A 2AIXA 4PE5B 4F19A 4DXBA 3LSFB 3TTKA 5KCJA 2DSFA 3N5LA 5EHSA 1POY1 4OFOA 1NH8A 1XC1A 3WAFA 3HSTA 5KZTA 3FXQA 4N6PA 5TPAB 5H8FA 1ANFA 3E9XA 3VLWA 3VXBA 3RT8A 3SEVA 3K01A 4P0GA 1VSOA 4OZ9A 3LC8A 3BKIB 2HZLA 2ZYOA 1VFEA 3G7WA 3OEMA 4JXIA 3VV5A 3EHTA 4KYDA 4I9DA 4DCYA 3RY3A 1OIBA 3JZJA 2QS4A 3GXAA 3IB0A 3K4UA 2YPNA 3RTFB 2IEEA 4F3BA 2UVGA 3PUYE 1BP5A 2HEUA 5I2NB 3QK6A 4H1XA 5JTYB 5KDTB 4WEDA 5HM4B 4KR5A 4PQJA 2HXWA 1NNPA 4NF4A 4EXKA 4F1YA 1P1OA 1P1WA 4G68C 4RPNA 1MPDA 3RLFE 1MXZA 3T96B 4F3SA 1MY3A 4ZEIA 1JW1A 4YZZA 2XXYA 1S9TA 2ZMBA 3B7DA 2ALUA 4R6HA 5CMCA 3T66A 1FTLA 4YKKA 5DVFA 3TEPA 3MQ9A 1IITA 2PT1A 1Y1ZA 4NF4B 3SEYA 3BBRA 3TTRA 4YKIA 4ONYA 4WXJA 5B70A 2QS1A 1N7WA 4H67A 4DDDA 3FVKA 1B3HA 2BJJX 2VGQA 3O9PA 1JNFA 2YLNA 4PFYA 1QVSA 2P0SA 3MVWA 2DWAA 4LUBA 4R2BA 4R2FA 5K2XA 3RUMA 1QKBA 1FTOA 4BDRA 4OETA 3OENA 3C31A 4ZEKA 4HCYA 3CSBA 3U93A 4F31B 3OD7A 3OMBA 3WAEA 3MW0A 1UQWA 4FAJA 4P11A 2I48A 3FATA 4JWYA 1EU8A 4NF5B 1Y4TA 5CMBA 3R7XA 1DTZA 3H3GA 4ND9A 2V3TA 1ATGA 3IO6A 2PT2A 4XXUA 4F2OA 1SQYA 3IB1A 3IOVA 1YTVA 4IB2A 4N13A 3V89B 2O1LA 1HSLA 1A99A 1A54A 3EF7A 4YMBA 1FQCA 2A5SA 3S2VA 1B5IA 3DRKA 1SVXB 2NUVA 4KFQA 4GVOA 4Q0CA 3ZSFA 3ECRA 4I1DA 3GLBA 3FVNA 2XXUA 2XXIA 3K6WA 1I6BA 2OLBA 1ZBMA 2V84A 3R26A 5L9OA 1B5JA 5CBRA 3V83A 3PAMA 1FTJA 2QMWA 4DXCA 4FEDA 4YB6A 3V8XB 1JVYA 1LAFE 2O84X 1I69A 2Z8FA 3S9NC 4U22A 3HCQA 3A09A 3S9EA 5JK4A 1Q35A 3W9WA 4JSOA 1S7YA 1N7XA 3K02A 3U1OA 3G3IA 3UA8A 2Y7WA 3O29A 1LCTA 3K00A 2V3QA 1KWHA 5I58B 4GD5A 2OWTA 3OO7A 4M4GA 2F78A 2D3IA 2FYIA 3ODBA 5DTBA 1L5TA 1B7UA 2XD3A 4NF5A 4TLMB 3VVEA 1LAGE 2R71A 2F7AA 3MWBA 4R6YA 2G93A 2B3BA 5DEXA 4THIA 5AA2B 2XXHA 1Q1KA 4GL0A 3TTMA 1IEJA 1PDAA 1QW0A 1ZMGA 3U72A 1B3FA 4BDMA 5JTYA 3TPAA 5LOMA 1FW0A 4FE8A 3I5OA 4GLIA 2Z8DA 1Y20A 2UYEA 1IUDA 3C33A 4YICA 2E0SA 2CZLA 2ZNTA 4QSCA 1ZTYA 1AMFA 3DRJA 5JEIA 3FV2A 4HS7A 3G3GA 4DE8A 3W15C 3MP1A 3BFUA 1PC3A 3B6WA 3CRBA 2ZYKA 4JB7A 1SBPA 2RCAA 2GHAA 5HPQA 5KCJB 4LVQA 3G3HA 2PBWA 1II5A 2LAOA 5ELVA 3G3FA 1IXGA 2F8DA 4POXA 4TQUQ 5BWJA 4G2ZA 2QL3A 2Y7KA 1R6ZA 5FTIA 2GFEA 4DIGA 2AL5A 5I58A 3K2DA 2WOPA 4QHQA 4FATA 4YKJA 4ZZAA 3KN8A 3E3KA 1OLCA 2KLFA 2B4MA 4NMYA 3SERA 3MZBA 2QMXA 4I62A 1I6QA 1MQGA 1FQDA 4RJZA 1M5EA 5I56A 1FCKA 1MXWA 3AXFA 3H6TA 3O28A 1URSA 4WEPA 3VVDA 3OXNA 4PFUA 3FTOA 4U21A 1A40A 2VOZA 4QFPA 5I2KA 4R75A 1JEUA 1FTKA 5F7VA 2Y7IA 4LQ5A 3UORA 1MXYA 1MRPA 2UVJA 2UXAA 1B05A 2UVHA 1MQIA 1XT8A 2RF1A 2X7PA 3C36A 3V5AA 1HSEA 4R73A 4DLDA 2O68A 4F2QA 3T9UA 3MBPA 1IXIA 2F97A 4UA8A 4X1BA 4OTEA 4RNSA 3TQWA 4U2RA 1M5BA 3LUYA 3MP6A 1B3EA 4GOTA 3M3LA 3UN6A 1DOTA 3SETA 1ZU0A 3OO9A 4PETA 4XKNA 2Q8JA 2O7UA 3K1PA 3QYTA 4ELRA 3A3CA 4EUOA 3SEUA 1OVBA 1MXUA 3JYRA 3FJMA 4JSDA 4Q8RA 1LBBA 2H98A 4PP0A 4E0WA 2XD2A 1MXXA 2A5TB 1B1XA 1IIWA 1I6AA 2VD2A 5A5XA 3N6TA 3MVZA 3TCFA 1YPNA 5ITOA 3T93B 1B32A 2ANJA 4HCWA 5M2VA 1ZKBA 1OQHA 4R6KA 1UTHA 3UK4A 1AH5A 3EQ1A 3T22A 3CI8A 1CB6A 2I3WA 2RINA 4MF3A 3U8QA 1JW5A 4O3AA 3A3UA 3Q25A 3VXCA 1AIVA 3I6VA 3C4MA 1BTJA 3D4CA 1MY2A 4NTLA 5CC2A 1IZ1A 3PPNA 2OK2A 4ZE8A 5H8SA 4C1UA 2RC9A 2AYSA 1MPBA 1SW4A 5TU0A 1UIVA 1LFHA 3HHFA 2E1SA 1LAXA 4P0IA 4NE4A 4MLVA 3JV9A 4GIZA 2QPQA 1JVXA 4EF1A 3KN7A 5AA3A 2YJPA 4GXAA 1B52A 4R72A 4U4XA 2W7YA 3M3KA 2DOJA 2I4BA 4YB7A 3TMGA 2F6PA 4Z7EA 4JDFA 1B0LA 1SW2A 2DS9A 4RPOA 3CFXA 2DWHA 1P1UA 4MFIA 4QFNA 1QUJA 4EDPA 2NOOA 4QFOA 3LBSA 4ZEBA 2UVIA 4IO4A 4ISUA 5CMKA 3TTLA 5AA4B 3N26A 5IKBA 3C9HA 4MLQA 4GXSB 3FJGA 3MP8A 4LZ5A 1OMPA 3K0VA 1XHYA 3FD3A 1N84A 1FQFA 2VD3A 4EQBA 1NFTA 3CFLA 3GZGA 3ZS6A 4FEBA 3QSLA 3M3FA 1BIYA 1MY4A 2HCAA 4GF8A 3B6QA 2REJA 2AL4A 3DELB 3CR9A 1BKAA 4H5GA 4EQ9A 4GWOA 3R6UA 1A8FA 3QXMA 4QFLA 2H25A 3TUSA 1DSNA 2ESNA 2XXVA 1TT1A 4K3FA 5L8DA 1XVYA 2VHAA 2F34A 3E4RA 2QJEA 3LSLA 2QSXA 1N04A 2ABHA 2RC7A 3CIJA 4KPTA 2D5WA 5I84A 1P99A 1B5HA 1MH3A 1NL5A 3DRGA 4OMBA 2Q2CA 4O3BA 4G77A 5H8QA 1CE2A 1IXHA 2HAVA 3N6UA 3PD9A 3VVFA 4AQ4A 5L9SA 4GL8A 3PMVA 2O1MA 2V93A 3KEIA 5DVJA 4EF2A 4OFLA 3Q28A 3O6HA 1GR2A 1NNTA 3K1MA 2I4CA 1DPPA 3MVYA 2PYYA 3FVOA 4U4SA 5DEXB 1WDNA 1Y3QA 2IA4A 1EZOA 4F3PA 2DP8A 2VP1A 3OELA 4PFWA 2OJTA 4LATA 4ESWA 5KDTA 1B4ZA 4R9GA 1ZIUA 3DM0A 4XTCQ 3FIRA 3S9MC 1Y4CA 4IO5A 3RNNA 2ONSA 3TDJA 1GVCA 3SESA 1MM6A 2H5YA 4AB5A 1UTBA 2B3FA 2M8CA 3CG3A 3KSJA 3K1NA 5H8FB 5I59A 4OWDA 1GGGA 3IJXB 4ELPA 4X1DA 3C35A 3CVGA 4FIMA 1HSJA 4U23A 5CRYA 1MPCA 3CSGA 5ICTA 1QJMA 1TFDA 4RXLA 4IO2A 3ZKLA 3QIMA 3T9HB 2REGA 1LSTA 2P2AA 3T9XB 2HFBA 3O6PA 2I0CA 4KYEA 4IGRA 4GQOA 3EN3A 3IORA 2B4LA 1TWYA 4RK9A 1N0TA 1PB9A 4OEVA 2Q9TA 4FORA 3Q29A 1R9LA 2Z23A 2OZZA 2THIA 2ZXTA 1PBPA 1Z7ME 2R9JA 3UIFA 2O6AA 1MS7A 3FXUA 3MZ1A 1QUKA 1MQJA 3IAZA 4LA9A 3VLUA 5F1QA 1D9VA 2WOLA 2B65A 2Q2AA 3L6GA 3U94A 5AA4A 1YCJA 1MDP1 1MQHA 3PPQA 2P1SA 4IO6A 3N94A 4BDQA 1PEBA 4RYAA 2QS2A 5I57B 1T0KA 1MG1A 3PV0E 4PFTA 1P1QA 4JWXA 4U1OA 1XS5A 3PGFA 2Y84A 2RCBA 3H6UA 1US4A 4IO7A 4R74A 3ONMA 1ELJA 3MZ9A 3D4GA 3FVGA 2GRVA 2ZNUA 1DTGA 2G29A 2XXQA 4X48A 4YAHX 3MJNA 4YU0A 2Q88A 3RTWB 3SEXA 5B7DA 4OFJA 4BDLA 3IOUA 1QULA 1JQFA 1SDXA 3C32A 1B3LA 2OWSA 3PPRA 4IY5A 3RPWA 1S50A 2DE2A 2DQVA 4F18A 4AB6A 4JBZA 4QF9A 3SEWA 3OSRA 2DWJA 1MXVA 3RYAA 5IAIA 1ZLQA 1N76A 2O51A 3DP6A 1SI0A 1M5FA 2RC8A 3H6VA 3L6HA 4G68A 4GRKA 3KSXA 1ZJLA 3K6UA 4TLLB 1D4NA 1B7HA 4KQPA 3SKPA 1M5DA 1D3KA 3MUQA 4POWA 4IO3A 3HN0A 4YKPA 3VFJA 4MH5A 3I3VA 3T9VA 2Y7RA 2DE3A 4F29A 3USDA 1NKXA 2XHDA 2I0BA 4LZ7A 2A5TA 5AA2A 2F36A 1EZPA 3M8UA 3IOWA 3FZVA 5H8NA 3PU5A 4EQ7A 1BLFA 3KJTA 4H8JA 3DRIA 1A55A 5FTHA 3CFZA 3TZAA 4XKRA 5ISUA 3Q27A 4UACA 4G4PA 5HBCA 3GBAA 3P7IA 5H8HA 1A8EA 4F1UA 3RT6B 2I6EA 4ELOA
chains in the Genus database with same CATH superfamily
1B46A 2XX7A 1LBCA 2DWIA 5DT6A 2HZKA 2KQZA 3TYHA 4F22A 2DXYA 1A7LA 1FBFA 2QVRA 1PBQA 2ZZWA 1USYE 2NVUB 3O66A 5TP9B 1OQGA 1LGBC 1N3XA 1MM7A 1FQAA 2VPNA 4NF8B 3KFMA 3S9LC 4NF6B 1JEVA 3OSQA 3FUZA 5ICQA 2FA7A 2OCUA 1N3WA 1XVXA 5H8QB 2XXTA 4IR8A 3LVUA 3O2AA 1NNFA 1JETA 2PMSA 3ZKKA 5A5XB 4GWUA 2FVZA 2XXWA 1B2HA 3K6VA 3NOHA 3HHGA 1RDYA 3BIHA 4DZ1A 2QVVA 4F3GA 2GH9A 3MVXA 2I49A 3KZGA 5DVIA 3LSWA 1Y3PA 4YB5A 2ZNSA 2O7IA 2CZKA 1WVJA 4NEDA 3TAJA 3TELA 4MJOA 1NI9A 4F39A 4ZDMA 4OVRA 5EYFA 3W9VA 3QUFA 5H8HB 4G8NA 4OQOA 2CMOA 4OERA 5CM6A 2GHBA 2QS3A 4NWCA 3MC2A 4NF8A 1SYIA 4H65A 4G8HA 2P3NA 1URGA 2HQ0A 3DLNA 1VFDA 3Q26A 4NWDA 4G8MA 2XXPA 3KC1A 5IZ3B 1UTBB 1SYHA 3U92A 1GV8A 4UABA 5AA1A 1Y9UA 3DRHA 1TFAA 1MY0A 3O6IA 1JW4A 3RPLB 3IJOB 3RGYA 2AIXA 4PE5B 5KCJA 1POY1 4I3YA 5TPAB 3E9XA 3VXBA 1INPA 3K01A 3G7WA 3OEMA 4I9DA 4DCYA 3RY3A 3JZJA 3IB0A 2UVGA 4P9KA 4KR5A 4EXKA 1MXZA 4F3SA 4ZEIA 4GWSA 1JW1A 2XXYA 1D9QA 3B7DA 3T66A 5DVFA 3PTYA 3MQ9A 4O8MA 3BBRA 3TTRA 3U65A 1FPGA 5B70A 4DDDA 1JNFA 2P0SA 3MVWA 4BDRA 2OWZA 3OENA 3U93A 1UQWA 4FAJA 4P11A 3FATA 3TTNA 1EU8A 4NF5B 1ATGA 3IO6A 4F2OA 1YTVA 3HFUA 3V89B 3ROJA 1HSLA 4YMBA 3GYYA 3DRKA 4Q0CA 4AS5A 3ECRA 2XXUA 2OLBA 5CBRA 1FTJA 4O7MA 4FEDA 1FPKA 4U22A 3W9WA 1S7YA 1N7XA 2WX9A 3G3IA 3O29A 1LCTA 1RDZA 5I58B 2F78A 2XD3A 3VVEA 4JVIA 1FPIA 2B3BA 2XXHA 4BDMA 1B3FA 3TPAA 1FW0A 4N8YA 5LTCA 3I5OA 2ZNTA 3MP1A 1PC3A 2GHAA 5HPQA 3G3HA 2PBWA 1II5A 5BWJA 4G2ZA 2QL3A 4PF6A 4DIGA 4ZZAA 2OX3A 1OLCA 3SERA 4I62A 1I6QA 4RJZA 1M5EA 5I56A 3O28A 3AXFA 1FPEA 4PFUA 4R75A 1JEUA 4P56A 1FTKA 2UXAA 2WYPA 2RF1A 4OANA 1HSEA 2O68A 3T9UA 3D1RA 4ELRA 2O7UA 3QYTA 4EUOA 3SEUA 1OVBA 4PP0A 2XD2A 1MXXA 2A5TB 5A5XA 3N6TA 3MVZA 1YPNA 2P3VA 4MEVA 1OQHA 4R6KA 1UTHA 1FJ9A 3EQ1A 3T22A 1CB6A 3U8QA 1AIVA 3C4MA 1LEVA 4ZE8A 1SW4A 1LFHA 4EF1A 2YJPA 1B52A 4R72A 4U4XA 2W7YA 2DOJA 4YB7A 1B0LA 4MFIA 4QFNA 4PFRA 4HE1A 3LBSA 4IO4A 3TTLA 1IMAA 2GQ1A 3LUZA 4MLQA 5I5PA 3CFLA 4FEBA 5EQ8A 3B6QA 1LBVA 1A8FA 4QFLA 1TT1A 5EQ9A 4G61A 2QJEA 2QSXA 4KPTA 2RC7A 5I84A 4O3BA 4G77A 3PD9A 3N6UA 3PMVA 5DW8A 2V93A 3LV0A 5EYHA 3O6HA 1GR2A 3K1MA 2I4CA 2PYYA 3MVYA 1WDNA 3OELA 2OJTA 1FPFA 4O94A 2QVUA 2XWOA 3DM0A 4XTCQ 3FIRA 1GVCA 1MM6A 2B3FA 2M8CA 3KSJA 5I59A 3IJXB 4X1DA 1HSJA 1MPCA 1QJMA 1TFDA 3QIMA 2P2AA 4PFBA 4RK9A 1TWYA 1N0TA 1PB9A 2THIA 4HE2A 2R9JA 2O6AA 1MS7A 3MZ1A 1MQJA 5F1QA 2WOLA 1YCJA 3PPQA 4IO6A 4RYAA 1MG1A 1AWBA 2RCBA 5ITOA 4YAHX 4GX6A 2XXQA 2Q88A 4X04A 4OFJA 1SDXA 3C32A 2DQVA 4JBZA 4QF9A 1N76A 4GRKA 3L6HA 2CEXA 1D4NA 1FPDA 3VFJA 4YKPA 3HN0A 4MH5A 2Y7RA 1NKXA 4MHFA 1EZPA 2F36A 5H8NA 3DRIA 1A55A 4XKRA 5HBCA 4F1UA 4N15A 2I3VA 4ZECA 3OO8A 1NH7A 2VPOA 1B7ZA 4YMAA 3K6XA 3EKIA 3EPEA 3H6WA 2XX9A 1YAEA 1H76A 1UIUA 2Y7PA 5I59B 3O6GA 2XWKA 4KD5A 3UP9A 5I3SA 4Q5TA 1BK4A 4MNIA 3ILUB 4N6DA 3LR1A 1NV3A 4ELQA 4ZEDA 2DVZA 1CNQA 1FJ6A 3FBPA 2OBGA 3KGCA 3KG2A 3TCGA 4TOZA 1NUYA 2DVCA 5CI5A 1QKAA 4XKQA 1O7TA 1QUIA 3PUWE 1K9YA 5FBPA 1PB7A 5ET7A 5TP9A 3PPPA 3IB2A 4H45A 5H8NB 3IX1A 1RYXA 4I8CA 1F9BA 3IK6B 5F24A 3CG1A 3IOTA 4BLAA 2NXOA 4DXUA 3G3JA 4Q30B 3TODA 4RA1A 1PB8A 1NNKA 4RK2A 4WKMA 5I2KB 4LP2B 4EXLA 2R6GE 3KJ7A 2V3UA 3HO7A 1YZ0A 4E0XA 3F11A 4ECFA 3DP4A 4N81A 4XKPA 3OEKA 1B1HA 1URDA 3UGWA 4M1VA 2F7BA 2Z8EA 4LZ8A 1GTKA 3B8BA 2WBDA 4LONB 1FQBA 5IGAA 4G68B 3CHGA 2H9BA 5TPAA 1EZ9A 4C0RA 2X26A 5FHNA 4OYVA 1XOCA 1OVTA 1IQ7A 1G0HA 1DPEA 5EHSA 4OFOA 5A5LA 3KBZA 3HSTA 2F3BA 1ANFA 3RT8A 3SEVA 4P0GA 1VSOA 4PCDA 3VV5A 4KYDA 1OIBA 3K4UA 2QS4A 2YPNA 2IEEA 1DCUA 2HEUA 5I2NB 5JTYB 5KDTB 2FIEA 4NF4A 4KXPA 1P1WA 4G68C 4RPNA 3T96B 1S9TA 4YKKA 1LBWA 2ALUA 4QBAA 1IITA 4PC9A 3SEYA 4YKIA 4H67A 2BJJX 3TMGA 4R2BA 3RUMA 1QKBA 1FTOA 4HCYA 3C31A 4ZEKA 3OMBA 2I48A 2WBBA 4JWYA 4ND9A 2V3TA 3IB1A 4IB2A 3T1BA 3EF7A 5LDZA 4N91A 1B5IA 2NUVA 2ZZXA 4GVOA 4PAIA 4I1DA 3FVNA 4NGUA 1I6BA 1ZBMA 5L9OA 2QMWA 4DXCA 2O84X 4P1LA 3HCQA 3A09A 3S9EA 1FBCA 3UA8A 1KWHA 4GD5A 2OWTA 1B7UA 4TLMB 1FPBA 2F7AA 4THIA 1Q1KA 4FE8A 3QMFA 4YICA 4NF0A 3FV2A 4HS7A 3G3GA 3BFUA 3CRBA 3B6WA 2RCAA 5J16A 4TQUQ 2F8DA 1R6ZA 2GFEA 2AL5A 2WOPA 3E3KA 2KLFA 4NMYA 4MNCA 1MXWA 3H6TA 3OXNA 2VOZA 1NUWA 3UORA 2X7PA 1MRPA 1NV7A 2UVHA 1MQIA 4R73A 4OVSA 1IXIA 4NX1A 4GX3A 4RNSA 1M5BA 3LUYA 4OVTA 1DOTA 4XKNA 3JYRA 4Q8RA 3FJMA 4E0WA 1B1XA 4XF5A 1I6AA 2FHYA 1AH5A 3CI8A 1JW5A 4QXDA 3D4CA 5H8SA 2RC9A 2AYSA 1UIVA 2E1SA 1LAXA 3JV9A 2Q74A 4Z7EA 4JDFA 2NOOA 4QFOA 4ZEBA 1FTAA 3KC0A 1NUZA 1N84A 4N4UA 3QSLA 4MNPA 1BIYA 2HCAA 4GF8A 2AL4A 1BKAA 4EQ9A 3R6UA 1DSNA 5L8DA 2F34A 1N04A 2ABHA 1B5HA 1P99A 5H8QA 1IMDA 2HAVA 1EYKA 3VVFA 4AQ4A 3KEIA 3Q28A 1DPPA 4U4SA 2VT5A 5DEXB 5EYGA 1Y3QA 2IA4A 4F3PA 2DP8A 1ZIUA 1Y4CA 4PAKA 4AB5A 5H8FB 4OWDA 1GGGA 4ELPA 1SPIA 4FIMA 5IZZA 3E78A 1FBHA 4RXLA 3T9XB 3O6PA 4IGRA 2Q9TA 4PFIA 2OZZA 1PBPA 3FXUA 3L6GA 2Q2AA 1MDP1 1MQHA 4BDQA 2V4CA 4N17A 1P1QA 2CZHA 4U1OA 2Y84A 1US4A 4X48A 2GRVA 3MJNA 4MAGA 1B3LA 2R8TA 1S50A 5IM2A 3DP6A 2F3DA 1SI0A 4TLLB 3H6VA 1ZJLA 1B7HA 4KQPA 1M5DA 4IO3A 4AS4A 4LZ7A 2I0BA 2A5TA 5IZ3A 3CFZA 3Q27A 4G4PA 3GBAA 2I6EA 4XFEA 4N07A 4NF6A 4KHZE 4Z0IA 5DYHA 4DI4B 3PD8A 4MX6A 4KYSA 3KN3A 3VE1B 1B4HA 3H4ZA 2WEFA 3DRFA 1B3GA 2Y5LA 2ONRA 1M5CA 3FASA 1LFIA 4JWOA 4ZZEA 2L5VA 3B6TA 1NV6A 3RQTA 4NN3A 5I2NA 2Z22A 1B58A 5CBSA 1B6HA 1H43A 3LSXA 4O7IA 3FV1A 3VLVA 2DDKA 1KA1A 1AL3A 4DCXA 1P1NA 4PDDA 2H4IA 2X7QA 3OOAA 2NWJA 2D21A 1O63A 1RKMA 1NUXA 3QAXA 2WKYA 3PMXA 4FECA 4RY1A 1NV1A 4GFRA 3RYBA 1VDWA 3BFTA 2H99A 3E13X 4O3CA 1AOVA 3H06B 4MBPA 2FBPA 4ZEFA 2O69A 1LAHE 5CMMA 3OO6A 2HPGA 2XWIA 4QRZA 3O97A 1KZ8A 3IR1A 5I57A 1R9QA 2FNCA 2HAUA 3RN8A 1FBDA 1SD3A 3GBBA 2V25A 3TCHA 4HW8A 4H8IA 2UYFA 1DK4A 3BIGA 3IO4A 1Y1MA 4OESA 4BDOA 3S4UA 1LLSA 3SDFA 4PDHA 3PUVE 1LB9A 1B51A 1VR5A 4MCOA 2PVUA 1DMBA 2ZYNA 1LFGA 3PMWA 1IXCA 2XXRA 1B9JA 1RDXA 2I58A 4F19A 3TTKA 1FRPA 4DI3D 1NH8A 1XC1A 5KZTA 3FXQA 4N6PA 2PFZA 4JVCA 4LN5A 4P47A 3EHTA 3GXAA 4F3BA 3PUYE 1BP5A 4GWXA 4H1XA 4WEDA 5HM4B 4GWYA 4F1YA 1MPDA 3RLFE 1MY3A 4YZZA 2ZMBA 4R6HA 1FTLA 3TEPA 4NF4B 1Y1ZA 1NV0A 4ONYA 2QS1A 4PGNA 3FVKA 1B3HA 3FD3A 3O9PA 4PFYA 1QVSA 2DWAA 4F31B 3OD7A 3WAEA 3MW0A 1Y4TA 3H3GA 4XXUA 2O1LA 4PBHA 1A99A 1IMFA 1FQCA 1SVXB 3ZSFA 3K6WA 3V83A 3PAMA 4YB6A 3V8XB 1JVYA 1LAFE 4PTKA 4PAFA 5EQAA 1Q35A 4JSOA 3K02A 5ESYA 3K00A 2V3QA 2KR0A 3ODBA 2R71A 4R6YA 5DEXA 2G93A 4GL0A 1PDAA 5LOMA 4GLIA 4HXVA 2Z8DA 1Y20A 2UYEA 1IUDA 3C33A 2E0SA 3RYDA 1ZTYA 3DRJA 3W15C 1QGXA 1IMEA 1SBPA 5KCJB 2LAOA 5ELVA 4POXA 1IXGA 4OA4A 2Y7KA 1NV4A 4FATA 4QHQA 3KN8A 2B4MA 1FQDA 4U21A 4QFPA 5I2KA 5F7VA 2Y7IA 4LQ5A 1MXYA 2XWVA 2UVJA 3V5AA 4PGPA 2BJIA 4F2QA 2F97A 4UA8A 4OVQA 4OTEA 3TQWA 4U2RA 3UN6A 1B3EA 3M3LA 3SETA 3OO9A 2H98A 3TCFA 3T93B 2ANJA 4HCWA 1ZKBA 3UK4A 4O3AA 3I6VA 1BTJA 3PPNA 1MPBA 5TU0A 4P0IA 4MLVA 4GIZA 2QPQA 1JVXA 4GXAA 3M3KA 2F6PA 2DS9A 4RPOA 4FBPA 2UVIA 5AA4B 3N26A 3FJGA 3MP8A 4LZ5A 1OMPA 3K0VA 1XHYA 1FQFA 1IMCA 3ZS6A 3M3FA 1MY4A 3DELB 3CR9A 4H5GA 3TUSA 3MYUA 4K3FA 1XVYA 2PFYA 3CIJA 2D5WA 1NL5A 2Q2CA 1IXHA 5L9SA 4EF2A 3FVOA 1EZOA 2VP1A 1DBZA 4ESWA 5KDTA 1B4ZA 4R9GA 3S9MC 2ONSA 2H5YA 1UTBA 3CG3A 4I40A 4NAPA 3C35A 3CSGA 4NG7A 1JP4A 2PCRA 1LSTA 2HFBA 3EN3A 3IORA 4OEVA 5T3JA 3Q29A 1Z7ME 1QUKA 3IAZA 3VLUA 1D9VA 2B65A 5AA4A 3FXBA 2P1SA 3PV0E 3H6UA 4EDPA 4IO7A 3ONMA 1DTGA 4YU0A 3RTWB 5B7DA 4BDLA 3IOUA 1QULA 1JQFA 3RPWA 4F18A 4AB6A 1EYJA 3OSRA 2DWJA 1MXVA 3RYAA 5IAIA 5AA2B 2O51A 4LA9A 5I7IA 2RC8A 3K6UA 1K9ZA 3ISPA 4JVDA 3I3VA 4F29A 2DE3A 3USDA 2XHDA 3IOWA 3FZVA 1BLFA 3KJTA 4H8JA 5FTHA 5ISUA 3P7IA 1A8EA 3RT6B 3RPLA 3KOTA 1B40A 3EHSA 1VE4A 2F6GA 4BDNA 1POTA 3PPOA 4OEUA 3DP8A 1MH4A 2F35A 4HTGA 1H44A 3EHUA 5ET5A 1SW5A 3HV1A 4FJPA 1LBXA 3H03A 1RYOA 5J1DA 2CZIA 3MAMA 1Y3NA 4XIGQ 5AE4A 5AA2D 2MKZA 3FGSA 1OLAA 3KOSA 5EQ7A 4F1VA 4R9FA 1EH3A 1US5A 4PE3A 4H6DA 4OVJA 4X9TA 1YYZA 4C1TA 5FHMA 4KCCA 4DXBA 5AA3A 3KBRA 5K2YA 3T0JA 1FQEA 2Q89A 3FJ7A 4QSDA 5EHMA 4H0WA 2F7CA 1WODA 4U1ZA 5I56B 1D9YA 2QRYA 1H3DA 1Z7NE 4MMPA 1MDQA 1J1NA 4IY6A 3IL1B 2PX1A 1NMUA 4LQ2A 3TQLA 2Q8MA 3THIA 2WOKA 2DXRA 4N8GA 1TXFA 3FXRA 3C34A 4ZE9A 3QUJA 4MIJA 1UTHB 3HPIA 3PUXE 2F5XA 1YXIA 1SI1A 3PUZE 1LCFA 4ZS9A 3VDFA 2HXRA 3TFLA 4QFKA 3TKDA 1KA0A 1USYH 2XX8A 4GBWA 3H7MA 2ZYMA 1SW1A 2DYXA 4OXVA 2JJKA 4H5FA 4ESXA 4GX4A 1MY1A 5L9MA 3G3KA 1R1NA 1LB8A 5IZ1A 1H45A 4OHNA 3MPKA 4OVPA 4QSEA 2RKMA 5H8FA 4KCDA 1IMBA 2XXXA 1MQDA 2DE4A 4OENA 1O64A 4KI0E 2ONKE 1B0HA 5FHOA 1FTMA 3ILTB 4IGTA 4L17A 5ITPA 3MPLA 3LSFB 2DSFA 3N5LA 1XI6A 3A29A 3WAFA 3VLWA 4OZ9A 3LC8A 3BKIB 2HZLA 2ZYOA 1VFEA 4JXIA 4NHBA 4PBQA 3RTFB 1FPLA 3QK6A 4PQJA 2HXWA 1NNPA 1P1OA 5BUUA 5CMCA 2PT1A 1EYIA 4WXJA 1N7WA 4X8RA 2VGQA 2YLNA 4LUBA 4R2FA 5K2XA 4OETA 3CSBA 5CMBA 3R7XA 1DTZA 2PT2A 1SQYA 3IOVA 4N13A 4HE0A 1A54A 2A5SA 3S2VA 4KFQA 2XXKA 3GLBA 3R26A 2XXIA 2V84A 1B5JA 3S9NC 2Z8FA 1I69A 2WYKA 5JK4A 3IFCA 3U1OA 2Y7WA 3OO7A 4M4GA 2FYIA 2D3IA 5DTBA 1L5TA 4NF5A 1LAGE 3MWBA 5JTYA 1IEJA 1QW0A 1ZMGA 1FBGA 4GWZA 2CZLA 4QSCA 1AMFA 5JEIA 2ZYKA 4JB7A 1FBEA 4LVQA 3G3FA 5FTIA 5I58A 4P8BA 3K2DA 4YKJA 3MZBA 2QMXA 1MQGA 1FCKA 4WEPA 1URSA 3VVDA 3FTOA 1A40A 2FIXA 1B05A 1XT8A 3C36A 4DLDA 3B50A 3MBPA 4X1BA 3MP6A 4GOTA 1ZU0A 4PETA 2Q8JA 3K1PA 3A3CA 1MXUA 4JSDA 1LBBA 2CEYA 1IIWA 2VD2A 1B32A 5M2VA 2I3WA 2RINA 4MF3A 3A3UA 3Q25A 4GWWA 3VXCA 1MY2A 2ZZVA 4NTLA 1IZ1A 5CC2A 2OK2A 4C1UA 3HHFA 4NE4A 3KN7A 4P1EA 2I4BA 1SW2A 3CFXA 2DWHA 1P1UA 1QUJA 4ISUA 5CMKA 5IKBA 3C9HA 4GXSB 2VD3A 4EQBA 4N6KA 1NFTA 3GZGA 3IFAA 2REJA 4GWOA 2QFLA 3QXMA 2H25A 1LBZA 2Y5KA 2ESNA 2XXVA 2VHAA 3E4RA 3LSLA 1MH3A 3DRGA 4OMBA 1G0IA 1CE2A 4GL8A 2O1MA 4PF8A 5DVJA 4OFLA 1NNTA 4DE8A 1FPJA 4P3LA 4PFWA 4LATA 1NV2A 4IO5A 1FSAA 1Q9DA 3RNNA 3TDJA 1LBYA 3SESA 3SZPA 3K1NA 3CVGA 4U23A 5CRYA 5ICTA 3ZKLA 4IO2A 3T9HB 2REGA 2XA5A 2I0CA 4KYEA 5ET8A 4GQOA 2B4LA 4FORA 1R9LA 2Z23A 2ZXTA 2HHMA 3UIFA 3U94A 3N94A 1PEBA 5I57B 2QS2A 1NV5A 3MSTA 1T0KA 4GBVA 4PFTA 4JWXA 1XS5A 3PGFA 4R74A 5ET6A 1ELJA 3MZ9A 3D4GA 3FVGA 2ZNUA 3TTMA 2G29A 3U72A 3SEXA 3E79A 2OWSA 3PPRA 4IY5A 2DE2A 3SEWA 4NQ8A 1FBPA 1ZLQA 1M5FA 4G68A 3KSXA 4I3EA 3SKPA 1D3KA 3MUQA 4POWA 3T9VA 4H46A 5AA2A 3M8UA 4EQ7A 3PU5A 3TZAA 4UACA 5H8HA 4XEQA 4ELOA
chains in the Genus database with same CATH topology
3KOTA 4N07A 1B40A 1B46A 3EHSA 1VE4A 2F6GA 4NF6A 2XX7A 4KHZE 1LBCA 2DWIA 4Z0IA 4BDNA 5DYHA 2I3VA 1POTA 3PD8A 5DT6A 2HZKA 3PPOA 4ZECA 4OEUA 3TYHA 4F22A 2DXYA 3OO8A 3DP8A 4KYSA 3KN3A 1NH7A 1MH4A 2F35A 1B7ZA 4HTGA 1H44A 3TTNA 3EHUA 3VE1B 1A7LA 1B4HA 3H4ZA 1SW5A 3HV1A 1PBQA 4YMAA 3K6XA 4FJPA 3DRFA 1B3GA 3EPEA 3H6WA 3H03A 2ONRA 1RYOA 2XX9A 1M5CA 1YAEA 1H76A 1USYE 3FASA 1UIUA 1LFIA 3MAMA 5J1DA 2Y7PA 4JWOA 2NVUB 5I59B 3O66A 4ZZEA 3O6GA 3B6TA 1Y3NA 4XIGQ 5TP9B 4KD5A 1OQGA 5BUUA 5AE4A 3UP9A 3RQTA 5AA2D 1LGBC 3FGSA 5I2NA 2Z22A 1OLAA 1N3XA 1B58A 4Q5TA 1MM7A 5CBSA 1B6HA 1FQAA 4NF8B 3KFMA 1H43A 3S9LC 4NF6B 1JEVA 3KOSA 3OSQA 3ILUB 4F1VA 3LSXA 4R9FA 3LR1A 3FV1A 3FUZA 5ICQA 2FA7A 1EH3A 4ELQA 2OCUA 1N3WA 1XVXA 5H8QB 4ZEDA 2DVZA 1US5A 3VLVA 2XXTA 2OBGA 3KGCA 3LVUA 3O2AA 4H6DA 4OVJA 3KG2A 1NNFA 4X9TA 4C1TA 3TCGA 1AL3A 1JETA 4DCXA 1P1NA 5FHMA 4TOZA 2PMSA 4KCCA 3ZKKA 5A5XB 2DVCA 2H4IA 2X7QA 1B2HA 2XXWA 3K6VA 3OOAA 3KBRA 5CI5A 2D21A 2NWJA 1QKAA 4XKQA 1O63A 1RKMA 1O7TA 3HHGA 5K2YA 1QUIA 3PUWE 1FQEA 2Q89A 1PB7A 3FJ7A 3QAXA 2WKYA 3PMXA 5TP9A 4QSDA 5EHMA 4FECA 4H0WA 2F7CA 1WODA 4RY1A 4U1ZA 3PPPA 4DZ1A 4GFRA 3IB2A 3RYBA 4F3GA 5I56B 2GH9A 3MVXA 2I49A 3KZGA 5DVIA 5H8NB 3BFTA 3LSWA 3IX1A 1D9YA 2H99A 2QRYA 1H3DA 1RYXA 1Y3PA 3E13X 4O3CA 4YB5A 4I8CA 1F9BA 1Z7NE 2ZNSA 1MDQA 1AOVA 3H06B 1J1NA 3IK6B 4MBPA 4IY6A 2O7IA 3IL1B 2PX1A 1WVJA 3CG1A 3IOTA 1NMUA 4LQ2A 4ZEFA 4NEDA 2O69A 1LAHE 5CMMA 3TQLA 4BLAA 3THIA 3TAJA 3TELA 2NXOA 4F39A 4ZDMA 5EYFA 2WOKA 3W9VA 4DXUA 3G3JA 2DXRA 3OO6A 4RA1A 3QUFA 4Q30B 3TODA 4QRZA 5H8HB 1TXFA 3FXRA 1PB8A 3O97A 1NNKA 4G8NA 4RK2A 4WKMA 3IR1A 5I2KB 3C34A 4ZE9A 4LP2B 5I57A 3QUJA 4EXLA 4OQOA 1UTHB 2CMOA 2R6GE 3HPIA 2F5XA 2V3UA 3KJ7A 3PUXE 1R9QA 2FNCA 1SI1A 3HO7A 4OERA 3PUZE 1LCFA 2HAUA 3RN8A 5CM6A 2GHBA 4ZS9A 3VDFA 4E0XA 3TFLA 1SD3A 3GBBA 4QFKA 2QS3A 2V25A 3F11A 3TCHA 4NWCA 3DP4A 1USYH 2XX8A 3MC2A 3TKDA 4NF8A 4ECFA 4HW8A 1SYIA 3H7MA 4XKPA 2ZYMA 1SW1A 2DYXA 4OXVA 4H65A 4G8HA 4H8IA 2UYFA 4H5FA 3OEKA 1URGA 1B1HA 1URDA 2HQ0A 3DLNA 3IO4A 1Y1MA 3UGWA 1VFDA 4M1VA 4ESXA 4OESA 4BDOA 3S4UA 2F7BA 3Q26A 1MY1A 5L9MA 2Z8EA 3G3KA 1R1NA 4LZ8A 4NWDA 1GTKA 1LB8A 1H45A 4G8MA 4LONB 1LLSA 1FQBA 4OHNA 3SDFA 3MPKA 3PUVE 4G68B 2XXPA 1LB9A 4QSEA 2RKMA 3CHGA 1B51A 1SYHA 1UTBB 1VR5A 1EZ9A 2H9BA 4KCDA 5TPAA 3U92A 4C0RA 2PVUA 1DMBA 2XXXA 1GV8A 1MQDA 2X26A 2DE4A 2ZYNA 4OENA 5AA1A 1O64A 1Y9UA 4KI0E 2ONKE 1B0HA 5FHNA 4OYVA 5FHOA 1LFGA 1FTMA 3ILTB 3DRHA 1TFAA 3PMWA 1MY0A 4IGTA 3O6IA 1XOCA 1OVTA 4L17A 1IXCA 1JW4A 1IQ7A 2XXRA 1DPEA 1B9JA 5ITPA 3IJOB 3RGYA 3MPLA 2I58A 2AIXA 4PE5B 4F19A 4DXBA 3LSFB 3TTKA 5KCJA 2DSFA 3N5LA 5EHSA 1POY1 4OFOA 1NH8A 1XC1A 3WAFA 3HSTA 5KZTA 3FXQA 4N6PA 5TPAB 5H8FA 1ANFA 3E9XA 3VLWA 3VXBA 3RT8A 3SEVA 3K01A 4P0GA 1VSOA 4OZ9A 3LC8A 3BKIB 2HZLA 2ZYOA 1VFEA 3G7WA 3OEMA 4JXIA 3VV5A 3EHTA 4KYDA 4I9DA 4DCYA 3RY3A 1OIBA 3JZJA 2QS4A 3GXAA 3IB0A 3K4UA 2YPNA 3RTFB 2IEEA 4F3BA 2UVGA 3PUYE 1BP5A 2HEUA 5I2NB 3QK6A 4H1XA 5JTYB 5KDTB 4WEDA 5HM4B 4KR5A 4PQJA 2HXWA 1NNPA 4NF4A 4EXKA 4F1YA 1P1OA 1P1WA 4G68C 4RPNA 1MPDA 3RLFE 1MXZA 3T96B 4F3SA 1MY3A 4ZEIA 1JW1A 4YZZA 2XXYA 1S9TA 2ZMBA 3B7DA 2ALUA 4R6HA 5CMCA 3T66A 1FTLA 4YKKA 5DVFA 3TEPA 3MQ9A 1IITA 2PT1A 1Y1ZA 4NF4B 3SEYA 3BBRA 3TTRA 4YKIA 4ONYA 4WXJA 5B70A 2QS1A 1N7WA 4H67A 4DDDA 3FVKA 1B3HA 2BJJX 2VGQA 3O9PA 1JNFA 2YLNA 4PFYA 1QVSA 2P0SA 3MVWA 2DWAA 4LUBA 4R2BA 4R2FA 5K2XA 3RUMA 1QKBA 1FTOA 4BDRA 4OETA 3OENA 3C31A 4ZEKA 4HCYA 3CSBA 3U93A 4F31B 3OD7A 3OMBA 3WAEA 3MW0A 1UQWA 4FAJA 4P11A 2I48A 3FATA 4JWYA 1EU8A 4NF5B 1Y4TA 5CMBA 3R7XA 1DTZA 3H3GA 4ND9A 2V3TA 1ATGA 3IO6A 2PT2A 4XXUA 4F2OA 1SQYA 3IB1A 3IOVA 1YTVA 4IB2A 4N13A 3V89B 2O1LA 1HSLA 1A99A 1A54A 3EF7A 4YMBA 1FQCA 2A5SA 3S2VA 1B5IA 3DRKA 1SVXB 2NUVA 4KFQA 4GVOA 4Q0CA 3ZSFA 3ECRA 4I1DA 3GLBA 3FVNA 2XXUA 2XXIA 3K6WA 1I6BA 2OLBA 1ZBMA 2V84A 3R26A 5L9OA 1B5JA 5CBRA 3V83A 3PAMA 1FTJA 2QMWA 4DXCA 4FEDA 4YB6A 3V8XB 1JVYA 1LAFE 2O84X 1I69A 2Z8FA 3S9NC 4U22A 3HCQA 3A09A 3S9EA 5JK4A 1Q35A 3W9WA 4JSOA 1S7YA 1N7XA 3K02A 3U1OA 3G3IA 3UA8A 2Y7WA 3O29A 1LCTA 3K00A 2V3QA 1KWHA 5I58B 4GD5A 2OWTA 3OO7A 4M4GA 2F78A 2D3IA 2FYIA 3ODBA 5DTBA 1L5TA 1B7UA 2XD3A 4NF5A 4TLMB 3VVEA 1LAGE 2R71A 2F7AA 3MWBA 4R6YA 2G93A 2B3BA 5DEXA 4THIA 5AA2B 2XXHA 1Q1KA 4GL0A 3TTMA 1IEJA 1PDAA 1QW0A 1ZMGA 3U72A 1B3FA 4BDMA 5JTYA 3TPAA 5LOMA 1FW0A 4FE8A 3I5OA 4GLIA 2Z8DA 1Y20A 2UYEA 1IUDA 3C33A 4YICA 2E0SA 2CZLA 2ZNTA 4QSCA 1ZTYA 1AMFA 3DRJA 5JEIA 3FV2A 4HS7A 3G3GA 4DE8A 3W15C 3MP1A 3BFUA 1PC3A 3B6WA 3CRBA 2ZYKA 4JB7A 1SBPA 2RCAA 2GHAA 5HPQA 5KCJB 4LVQA 3G3HA 2PBWA 1II5A 2LAOA 5ELVA 3G3FA 1IXGA 2F8DA 4POXA 4TQUQ 5BWJA 4G2ZA 2QL3A 2Y7KA 1R6ZA 5FTIA 2GFEA 4DIGA 2AL5A 5I58A 3K2DA 2WOPA 4QHQA 4FATA 4YKJA 4ZZAA 3KN8A 3E3KA 1OLCA 2KLFA 2B4MA 4NMYA 3SERA 3MZBA 2QMXA 4I62A 1I6QA 1MQGA 1FQDA 4RJZA 1M5EA 5I56A 1FCKA 1MXWA 3AXFA 3H6TA 3O28A 1URSA 4WEPA 3VVDA 3OXNA 4PFUA 3FTOA 4U21A 1A40A 2VOZA 4QFPA 5I2KA 4R75A 1JEUA 1FTKA 5F7VA 2Y7IA 4LQ5A 3UORA 1MXYA 1MRPA 2UVJA 2UXAA 1B05A 2UVHA 1MQIA 1XT8A 2RF1A 2X7PA 3C36A 3V5AA 1HSEA 4R73A 4DLDA 2O68A 4F2QA 3T9UA 3MBPA 1IXIA 2F97A 4UA8A 4X1BA 4OTEA 4RNSA 3TQWA 4U2RA 1M5BA 3LUYA 3MP6A 1B3EA 4GOTA 3M3LA 3UN6A 1DOTA 3SETA 1ZU0A 3OO9A 4PETA 4XKNA 2Q8JA 2O7UA 3K1PA 3QYTA 4ELRA 3A3CA 4EUOA 3SEUA 1OVBA 1MXUA 3JYRA 3FJMA 4JSDA 4Q8RA 1LBBA 2H98A 4PP0A 4E0WA 2XD2A 1MXXA 2A5TB 1B1XA 1IIWA 1I6AA 2VD2A 5A5XA 3N6TA 3MVZA 3TCFA 1YPNA 5ITOA 3T93B 1B32A 2ANJA 4HCWA 5M2VA 1ZKBA 1OQHA 4R6KA 1UTHA 3UK4A 1AH5A 3EQ1A 3T22A 3CI8A 1CB6A 2I3WA 2RINA 4MF3A 3U8QA 1JW5A 4O3AA 3A3UA 3Q25A 3VXCA 1AIVA 3I6VA 3C4MA 1BTJA 3D4CA 1MY2A 4NTLA 5CC2A 1IZ1A 3PPNA 2OK2A 4ZE8A 5H8SA 4C1UA 2RC9A 2AYSA 1MPBA 1SW4A 5TU0A 1UIVA 1LFHA 3HHFA 2E1SA 1LAXA 4P0IA 4NE4A 4MLVA 3JV9A 4GIZA 2QPQA 1JVXA 4EF1A 3KN7A 5AA3A 2YJPA 4GXAA 1B52A 4R72A 4U4XA 2W7YA 3M3KA 2DOJA 2I4BA 4YB7A 3TMGA 2F6PA 4Z7EA 4JDFA 1B0LA 1SW2A 2DS9A 4RPOA 3CFXA 2DWHA 1P1UA 4MFIA 4QFNA 1QUJA 4EDPA 2NOOA 4QFOA 3LBSA 4ZEBA 2UVIA 4IO4A 4ISUA 5CMKA 3TTLA 5AA4B 3N26A 5IKBA 3C9HA 4MLQA 4GXSB 3FJGA 3MP8A 4LZ5A 1OMPA 3K0VA 1XHYA 3FD3A 1N84A 1FQFA 2VD3A 4EQBA 1NFTA 3CFLA 3GZGA 3ZS6A 4FEBA 3QSLA 3M3FA 1BIYA 1MY4A 2HCAA 4GF8A 3B6QA 2REJA 2AL4A 3DELB 3CR9A 1BKAA 4H5GA 4EQ9A 4GWOA 3R6UA 1A8FA 3QXMA 4QFLA 2H25A 3TUSA 1DSNA 2ESNA 2XXVA 1TT1A 4K3FA 5L8DA 1XVYA 2VHAA 2F34A 3E4RA 2QJEA 3LSLA 2QSXA 1N04A 2ABHA 2RC7A 3CIJA 4KPTA 2D5WA 5I84A 1P99A 1B5HA 1MH3A 1NL5A 3DRGA 4OMBA 2Q2CA 4O3BA 4G77A 5H8QA 1CE2A 1IXHA 2HAVA 3N6UA 3PD9A 3VVFA 4AQ4A 5L9SA 4GL8A 3PMVA 2O1MA 2V93A 3KEIA 5DVJA 4EF2A 4OFLA 3Q28A 3O6HA 1GR2A 1NNTA 3K1MA 2I4CA 1DPPA 3MVYA 2PYYA 3FVOA 4U4SA 5DEXB 1WDNA 1Y3QA 2IA4A 1EZOA 4F3PA 2DP8A 2VP1A 3OELA 4PFWA 2OJTA 4LATA 4ESWA 5KDTA 1B4ZA 4R9GA 1ZIUA 3DM0A 4XTCQ 3FIRA 3S9MC 1Y4CA 4IO5A 3RNNA 2ONSA 3TDJA 1GVCA 3SESA 1MM6A 2H5YA 4AB5A 1UTBA 2B3FA 2M8CA 3CG3A 3KSJA 3K1NA 5H8FB 5I59A 4OWDA 1GGGA 3IJXB 4ELPA 4X1DA 3C35A 3CVGA 4FIMA 1HSJA 4U23A 5CRYA 1MPCA 3CSGA 5ICTA 1QJMA 1TFDA 4RXLA 4IO2A 3ZKLA 3QIMA 3T9HB 2REGA 1LSTA 2P2AA 3T9XB 2HFBA 3O6PA 2I0CA 4KYEA 4IGRA 4GQOA 3EN3A 3IORA 2B4LA 1TWYA 4RK9A 1N0TA 1PB9A 4OEVA 2Q9TA 4FORA 3Q29A 1R9LA 2Z23A 2OZZA 2THIA 2ZXTA 1PBPA 1Z7ME 2R9JA 3UIFA 2O6AA 1MS7A 3FXUA 3MZ1A 1QUKA 1MQJA 3IAZA 4LA9A 3VLUA 5F1QA 1D9VA 2WOLA 2B65A 2Q2AA 3L6GA 3U94A 5AA4A 1YCJA 1MDP1 1MQHA 3PPQA 2P1SA 4IO6A 3N94A 4BDQA 1PEBA 4RYAA 2QS2A 5I57B 1T0KA 1MG1A 3PV0E 4PFTA 1P1QA 4JWXA 4U1OA 1XS5A 3PGFA 2Y84A 2RCBA 3H6UA 1US4A 4IO7A 4R74A 3ONMA 1ELJA 3MZ9A 3D4GA 3FVGA 2GRVA 2ZNUA 1DTGA 2G29A 2XXQA 4X48A 4YAHX 3MJNA 4YU0A 2Q88A 3RTWB 3SEXA 5B7DA 4OFJA 4BDLA 3IOUA 1QULA 1JQFA 1SDXA 3C32A 1B3LA 2OWSA 3PPRA 4IY5A 3RPWA 1S50A 2DE2A 2DQVA 4F18A 4AB6A 4JBZA 4QF9A 3SEWA 3OSRA 2DWJA 1MXVA 3RYAA 5IAIA 1ZLQA 1N76A 2O51A 3DP6A 1SI0A 1M5FA 2RC8A 3H6VA 3L6HA 4G68A 4GRKA 3KSXA 1ZJLA 3K6UA 4TLLB 1D4NA 1B7HA 4KQPA 3SKPA 1M5DA 1D3KA 3MUQA 4POWA 4IO3A 3HN0A 4YKPA 3VFJA 4MH5A 3I3VA 3T9VA 2Y7RA 2DE3A 4F29A 3USDA 1NKXA 2XHDA 2I0BA 4LZ7A 2A5TA 5AA2A 2F36A 1EZPA 3M8UA 3IOWA 3FZVA 5H8NA 3PU5A 4EQ7A 1BLFA 3KJTA 4H8JA 3DRIA 1A55A 5FTHA 3CFZA 3TZAA 4XKRA 5ISUA 3Q27A 4UACA 4G4PA 5HBCA 3GBAA 3P7IA 5H8HA 1A8EA 4F1UA 3RT6B 2I6EA 4ELOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KOT A;  4N07 A;  1B40 A;  1B46 A;  3EHS A;  1VE4 A;  2F6G A;  4NF6 A;  2XX7 A;  4KHZ E;  1LBC A;  2DWI A;  4Z0I A;  4BDN A;  5DYH A;  2I3V A;  1POT A;  3PD8 A;  5DT6 A;  2HZK A;  3PPO A;  4ZEC A;  4OEU A;  3TYH A;  4F22 A;  2DXY A;  3OO8 A;  3DP8 A;  4KYS A;  3KN3 A;  1NH7 A;  1MH4 A;  2F35 A;  1B7Z A;  4HTG A;  1H44 A;  3TTN A;  3EHU A;  3VE1 B;  1A7L A;  1B4H A;  3H4Z A;  1SW5 A;  3HV1 A;  1PBQ A;  4YMA A;  3K6X A;  4FJP A;  3DRF A;  1B3G A;  3EPE A;  3H6W A;  3H03 A;  2ONR A;  1RYO A;  2XX9 A;  1M5C A;  1YAE A;  1H76 A;  1USY E;  3FAS A;  1UIU A;  1LFI A;  3MAM A;  5J1D A;  2Y7P A;  4JWO A;  2NVU B;  5I59 B;  3O66 A;  4ZZE A;  3O6G A;  3B6T A;  1Y3N A;  4XIG Q;  5TP9 B;  4KD5 A;  1OQG A;  5BUU A;  5AE4 A;  3UP9 A;  3RQT A;  5AA2 D;  1LGB C;  3FGS A;  5I2N A;  2Z22 A;  1OLA A;  1N3X A;  1B58 A;  4Q5T A;  1MM7 A;  5CBS A;  1B6H A;  1FQA A;  4NF8 B;  3KFM A;  1H43 A;  3S9L C;  4NF6 B;  1JEV A;  3KOS A;  3OSQ A;  3ILU B;  4F1V A;  3LSX A;  4R9F A;  3LR1 A;  3FV1 A;  3FUZ A;  5ICQ A;  2FA7 A;  1EH3 A;  4ELQ A;  2OCU A;  1N3W A;  1XVX A;  5H8Q B;  4ZED A;  2DVZ A;  1US5 A;  3VLV A;  2XXT A;  2OBG A;  3KGC A;  3LVU A;  3O2A A;  4H6D A;  4OVJ A;  3KG2 A;  1NNF A;  4X9T A;  4C1T A;  3TCG A;  1AL3 A;  1JET A;  4DCX A;  1P1N A;  5FHM A;  4TOZ A;  2PMS A;  4KCC A;  3ZKK A;  5A5X B;  2DVC A;  2H4I A;  2X7Q A;  1B2H A;  2XXW A;  3K6V A;  3OOA A;  3KBR A;  5CI5 A;  2D21 A;  2NWJ A;  1QKA A;  4XKQ A;  1O63 A;  1RKM A;  1O7T A;  3HHG A;  5K2Y A;  1QUI A;  3PUW E;  1FQE A;  2Q89 A;  1PB7 A;  3FJ7 A;  3QAX A;  2WKY A;  3PMX A;  5TP9 A;  4QSD A;  5EHM A;  4FEC A;  4H0W A;  2F7C A;  1WOD A;  4RY1 A;  4U1Z A;  3PPP A;  4DZ1 A;  4GFR A;  3IB2 A;  3RYB A;  4F3G A;  5I56 B;  2GH9 A;  3MVX A;  2I49 A;  3KZG A;  5DVI A;  5H8N B;  3BFT A;  3LSW A;  3IX1 A;  1D9Y A;  2H99 A;  2QRY A;  1H3D A;  1RYX A;  1Y3P A;  3E13 X;  4O3C A;  4YB5 A;  4I8C A;  1F9B A;  1Z7N E;  2ZNS A;  1MDQ A;  1AOV A;  3H06 B;  1J1N A;  3IK6 B;  4MBP A;  4IY6 A;  2O7I A;  3IL1 B;  2PX1 A;  1WVJ A;  3CG1 A;  3IOT A;  1NMU A;  4LQ2 A;  4ZEF A;  4NED A;  2O69 A;  1LAH E;  5CMM A;  3TQL A;  4BLA A;  3THI A;  3TAJ A;  3TEL A;  2NXO A;  4F39 A;  4ZDM A;  5EYF A;  2WOK A;  3W9V A;  4DXU A;  3G3J A;  2DXR A;  3OO6 A;  4RA1 A;  3QUF A;  4Q30 B;  3TOD A;  4QRZ A;  5H8H B;  1TXF A;  3FXR A;  1PB8 A;  3O97 A;  1NNK A;  4G8N A;  4RK2 A;  4WKM A;  3IR1 A;  5I2K B;  3C34 A;  4ZE9 A;  4LP2 B;  5I57 A;  3QUJ A;  4EXL A;  4OQO A;  1UTH B;  2CMO A;  2R6G E;  3HPI A;  2F5X A;  2V3U A;  3KJ7 A;  3PUX E;  1R9Q A;  2FNC A;  1SI1 A;  3HO7 A;  4OER A;  3PUZ E;  1LCF A;  2HAU A;  3RN8 A;  5CM6 A;  2GHB A;  4ZS9 A;  3VDF A;  4E0X A;  3TFL A;  1SD3 A;  3GBB A;  4QFK A;  2QS3 A;  2V25 A;  3F11 A;  3TCH A;  4NWC A;  3DP4 A;  1USY H;  2XX8 A;  3MC2 A;  3TKD A;  4NF8 A;  4ECF A;  4HW8 A;  1SYI A;  3H7M A;  4XKP A;  2ZYM A;  1SW1 A;  2DYX A;  4OXV A;  4H65 A;  4G8H A;  4H8I A;  2UYF A;  4H5F A;  3OEK A;  1URG A;  1B1H A;  1URD A;  2HQ0 A;  3DLN A;  3IO4 A;  1Y1M A;  3UGW A;  1VFD A;  4M1V A;  4ESX A;  4OES A;  4BDO A;  3S4U A;  2F7B A;  3Q26 A;  1MY1 A;  5L9M A;  2Z8E A;  3G3K A;  1R1N A;  4LZ8 A;  4NWD A;  1GTK A;  1LB8 A;  1H45 A;  4G8M A;  4LON B;  1LLS A;  1FQB A;  4OHN A;  3SDF A;  3MPK A;  3PUV E;  4G68 B;  2XXP A;  1LB9 A;  4QSE A;  2RKM A;  3CHG A;  1B51 A;  1SYH A;  1UTB B;  1VR5 A;  1EZ9 A;  2H9B A;  4KCD A;  5TPA A;  3U92 A;  4C0R A;  2PVU A;  1DMB A;  2XXX A;  1GV8 A;  1MQD A;  2X26 A;  2DE4 A;  2ZYN A;  4OEN A;  5AA1 A;  1O64 A;  1Y9U A;  4KI0 E;  2ONK E;  1B0H A;  5FHN A;  4OYV A;  5FHO A;  1LFG A;  1FTM A;  3ILT B;  3DRH A;  1TFA A;  3PMW A;  1MY0 A;  4IGT A;  3O6I A;  1XOC A;  1OVT A;  4L17 A;  1IXC A;  1JW4 A;  1IQ7 A;  2XXR A;  1DPE A;  1B9J A;  5ITP A;  3IJO B;  3RGY A;  3MPL A;  2I58 A;  2AIX A;  4PE5 B;  4F19 A;  4DXB A;  3LSF B;  3TTK A;  5KCJ A;  2DSF A;  3N5L A;  5EHS A;  1POY 1;  4OFO A;  1NH8 A;  1XC1 A;  3WAF A;  3HST A;  5KZT A;  3FXQ A;  4N6P A;  5TPA B;  5H8F A;  1ANF A;  3E9X A;  3VLW A;  3VXB A;  3RT8 A;  3SEV A;  3K01 A;  4P0G A;  1VSO A;  4OZ9 A;  3LC8 A;  3BKI B;  2HZL A;  2ZYO A;  1VFE A;  3G7W A;  3OEM A;  4JXI A;  3VV5 A;  3EHT A;  4KYD A;  4I9D A;  4DCY A;  3RY3 A;  1OIB A;  3JZJ A;  2QS4 A;  3GXA A;  3IB0 A;  3K4U A;  2YPN A;  3RTF B;  2IEE A;  4F3B A;  2UVG A;  3PUY E;  1BP5 A;  2HEU A;  5I2N B;  3QK6 A;  4H1X A;  5JTY B;  5KDT B;  4WED A;  5HM4 B;  4KR5 A;  4PQJ A;  2HXW A;  1NNP A;  4NF4 A;  4EXK A;  4F1Y A;  1P1O A;  1P1W A;  4G68 C;  4RPN A;  1MPD A;  3RLF E;  1MXZ A;  3T96 B;  4F3S A;  1MY3 A;  4ZEI A;  1JW1 A;  4YZZ A;  2XXY A;  1S9T A;  2ZMB A;  3B7D A;  2ALU A;  4R6H A;  5CMC A;  3T66 A;  1FTL A;  4YKK A;  5DVF A;  3TEP A;  3MQ9 A;  1IIT A;  2PT1 A;  1Y1Z A;  4NF4 B;  3SEY A;  3BBR A;  3TTR A;  4YKI A;  4ONY A;  4WXJ A;  5B70 A;  2QS1 A;  1N7W A;  4H67 A;  4DDD A;  3FVK A;  1B3H A;  2BJJ X;  2VGQ A;  3O9P A;  1JNF A;  2YLN A;  4PFY A;  1QVS A;  2P0S A;  3MVW A;  2DWA A;  4LUB A;  4R2B A;  4R2F A;  5K2X A;  3RUM A;  1QKB A;  1FTO A;  4BDR A;  4OET A;  3OEN A;  3C31 A;  4ZEK A;  4HCY A;  3CSB A;  3U93 A;  4F31 B;  3OD7 A;  3OMB A;  3WAE A;  3MW0 A;  1UQW A;  4FAJ A;  4P11 A;  2I48 A;  3FAT A;  4JWY A;  1EU8 A;  4NF5 B;  1Y4T A;  5CMB A;  3R7X A;  1DTZ A;  3H3G A;  4ND9 A;  2V3T A;  1ATG A;  3IO6 A;  2PT2 A;  4XXU A;  4F2O A;  1SQY A;  3IB1 A;  3IOV A;  1YTV A;  4IB2 A;  4N13 A;  3V89 B;  2O1L A;  1HSL A;  1A99 A;  1A54 A;  3EF7 A;  4YMB A;  1FQC A;  2A5S A;  3S2V A;  1B5I A;  3DRK A;  1SVX B;  2NUV A;  4KFQ A;  4GVO A;  4Q0C A;  3ZSF A;  3ECR A;  4I1D A;  3GLB A;  3FVN A;  2XXU A;  2XXI A;  3K6W A;  1I6B A;  2OLB A;  1ZBM A;  2V84 A;  3R26 A;  5L9O A;  1B5J A;  5CBR A;  3V83 A;  3PAM A;  1FTJ A;  2QMW A;  4DXC A;  4FED A;  4YB6 A;  3V8X B;  1JVY A;  1LAF E;  2O84 X;  1I69 A;  2Z8F A;  3S9N C;  4U22 A;  3HCQ A;  3A09 A;  3S9E A;  5JK4 A;  1Q35 A;  3W9W A;  4JSO A;  1S7Y A;  1N7X A;  3K02 A;  3U1O A;  3G3I A;  3UA8 A;  2Y7W A;  3O29 A;  1LCT A;  3K00 A;  2V3Q A;  1KWH A;  5I58 B;  4GD5 A;  2OWT A;  3OO7 A;  4M4G A;  2F78 A;  2D3I A;  2FYI A;  3ODB A;  5DTB A;  1L5T A;  1B7U A;  2XD3 A;  4NF5 A;  4TLM B;  3VVE A;  1LAG E;  2R71 A;  2F7A A;  3MWB A;  4R6Y A;  2G93 A;  2B3B A;  5DEX A;  4THI A;  5AA2 B;  2XXH A;  1Q1K A;  4GL0 A;  3TTM A;  1IEJ A;  1PDA A;  1QW0 A;  1ZMG A;  3U72 A;  1B3F A;  4BDM A;  5JTY A;  3TPA A;  5LOM A;  1FW0 A;  4FE8 A;  3I5O A;  4GLI A;  2Z8D A;  1Y20 A;  2UYE A;  1IUD A;  3C33 A;  4YIC A;  2E0S A;  2CZL A;  2ZNT A;  4QSC A;  1ZTY A;  1AMF A;  3DRJ A;  5JEI A;  3FV2 A;  4HS7 A;  3G3G A;  4DE8 A;  3W15 C;  3MP1 A;  3BFU A;  1PC3 A;  3B6W A;  3CRB A;  2ZYK A;  4JB7 A;  1SBP A;  2RCA A;  2GHA A;  5HPQ A;  5KCJ B;  4LVQ A;  3G3H A;  2PBW A;  1II5 A;  2LAO A;  5ELV A;  3G3F A;  1IXG A;  2F8D A;  4POX A;  4TQU Q;  5BWJ A;  4G2Z A;  2QL3 A;  2Y7K A;  1R6Z A;  5FTI A;  2GFE A;  4DIG A;  2AL5 A;  5I58 A;  3K2D A;  2WOP A;  4QHQ A;  4FAT A;  4YKJ A;  4ZZA A;  3KN8 A;  3E3K A;  1OLC A;  2KLF A;  2B4M A;  4NMY A;  3SER A;  3MZB A;  2QMX A;  4I62 A;  1I6Q A;  1MQG A;  1FQD A;  4RJZ A;  1M5E A;  5I56 A;  1FCK A;  1MXW A;  3AXF A;  3H6T A;  3O28 A;  1URS A;  4WEP A;  3VVD A;  3OXN A;  4PFU A;  3FTO A;  4U21 A;  1A40 A;  2VOZ A;  4QFP A;  5I2K A;  4R75 A;  1JEU A;  1FTK A;  5F7V A;  2Y7I A;  4LQ5 A;  3UOR A;  1MXY A;  1MRP A;  2UVJ A;  2UXA A;  1B05 A;  2UVH A;  1MQI A;  1XT8 A;  2RF1 A;  2X7P A;  3C36 A;  3V5A A;  1HSE A;  4R73 A;  4DLD A;  2O68 A;  4F2Q A;  3T9U A;  3MBP A;  1IXI A;  2F97 A;  4UA8 A;  4X1B A;  4OTE A;  4RNS A;  3TQW A;  4U2R A;  1M5B A;  3LUY A;  3MP6 A;  1B3E A;  4GOT A;  3M3L A;  3UN6 A;  1DOT A;  3SET A;  1ZU0 A;  3OO9 A;  4PET A;  4XKN A;  2Q8J A;  2O7U A;  3K1P A;  3QYT A;  4ELR A;  3A3C A;  4EUO A;  3SEU A;  1OVB A;  1MXU A;  3JYR A;  3FJM A;  4JSD A;  4Q8R A;  1LBB A;  2H98 A;  4PP0 A;  4E0W A;  2XD2 A;  1MXX A;  2A5T B;  1B1X A;  1IIW A;  1I6A A;  2VD2 A;  5A5X A;  3N6T A;  3MVZ A;  3TCF A;  1YPN A;  5ITO A;  3T93 B;  1B32 A;  2ANJ A;  4HCW A;  5M2V A;  1ZKB A;  1OQH A;  4R6K A;  1UTH A;  3UK4 A;  1AH5 A;  3EQ1 A;  3T22 A;  3CI8 A;  1CB6 A;  2I3W A;  2RIN A;  4MF3 A;  3U8Q A;  1JW5 A;  4O3A A;  3A3U A;  3Q25 A;  3VXC A;  1AIV A;  3I6V A;  3C4M A;  1BTJ A;  3D4C A;  1MY2 A;  4NTL A;  5CC2 A;  1IZ1 A;  3PPN A;  2OK2 A;  4ZE8 A;  5H8S A;  4C1U A;  2RC9 A;  2AYS A;  1MPB A;  1SW4 A;  5TU0 A;  1UIV A;  1LFH A;  3HHF A;  2E1S A;  1LAX A;  4P0I A;  4NE4 A;  4MLV A;  3JV9 A;  4GIZ A;  2QPQ A;  1JVX A;  4EF1 A;  3KN7 A;  5AA3 A;  2YJP A;  4GXA A;  1B52 A;  4R72 A;  4U4X A;  2W7Y A;  3M3K A;  2DOJ A;  2I4B A;  4YB7 A;  3TMG A;  2F6P A;  4Z7E A;  4JDF A;  1B0L A;  1SW2 A;  2DS9 A;  4RPO A;  3CFX A;  2DWH A;  1P1U A;  4MFI A;  4QFN A;  1QUJ A;  4EDP A;  2NOO A;  4QFO A;  3LBS A;  4ZEB A;  2UVI A;  4IO4 A;  4ISU A;  5CMK A;  3TTL A;  5AA4 B;  3N26 A;  5IKB A;  3C9H A;  4MLQ A;  4GXS B;  3FJG A;  3MP8 A;  4LZ5 A;  1OMP A;  3K0V A;  1XHY A;  3FD3 A;  1N84 A;  1FQF A;  2VD3 A;  4EQB A;  1NFT A;  3CFL A;  3GZG A;  3ZS6 A;  4FEB A;  3QSL A;  3M3F A;  1BIY A;  1MY4 A;  2HCA A;  4GF8 A;  3B6Q A;  2REJ A;  2AL4 A;  3DEL B;  3CR9 A;  1BKA A;  4H5G A;  4EQ9 A;  4GWO A;  3R6U A;  1A8F A;  3QXM A;  4QFL A;  2H25 A;  3TUS A;  1DSN A;  2ESN A;  2XXV A;  1TT1 A;  4K3F A;  5L8D A;  1XVY A;  2VHA A;  2F34 A;  3E4R A;  2QJE A;  3LSL A;  2QSX A;  1N04 A;  2ABH A;  2RC7 A;  3CIJ A;  4KPT A;  2D5W A;  5I84 A;  1P99 A;  1B5H A;  1MH3 A;  1NL5 A;  3DRG A;  4OMB A;  2Q2C A;  4O3B A;  4G77 A;  5H8Q A;  1CE2 A;  1IXH A;  2HAV A;  3N6U A;  3PD9 A;  3VVF A;  4AQ4 A;  5L9S A;  4GL8 A;  3PMV A;  2O1M A;  2V93 A;  3KEI A;  5DVJ A;  4EF2 A;  4OFL A;  3Q28 A;  3O6H A;  1GR2 A;  1NNT A;  3K1M A;  2I4C A;  1DPP A;  3MVY A;  2PYY A;  3FVO A;  4U4S A;  5DEX B;  1WDN A;  1Y3Q A;  2IA4 A;  1EZO A;  4F3P A;  2DP8 A;  2VP1 A;  3OEL A;  4PFW A;  2OJT A;  4LAT A;  4ESW A;  5KDT A;  1B4Z A;  4R9G A;  1ZIU A;  3DM0 A;  4XTC Q;  3FIR A;  3S9M C;  1Y4C A;  4IO5 A;  3RNN A;  2ONS A;  3TDJ A;  1GVC A;  3SES A;  1MM6 A;  2H5Y A;  4AB5 A;  1UTB A;  2B3F A;  2M8C A;  3CG3 A;  3KSJ A;  3K1N A;  5H8F B;  5I59 A;  4OWD A;  1GGG A;  3IJX B;  4ELP A;  4X1D A;  3C35 A;  3CVG A;  4FIM A;  1HSJ A;  4U23 A;  5CRY A;  1MPC A;  3CSG A;  5ICT A;  1QJM A;  1TFD A;  4RXL A;  4IO2 A;  3ZKL A;  3QIM A;  3T9H B;  2REG A;  1LST A;  2P2A A;  3T9X B;  2HFB A;  3O6P A;  2I0C A;  4KYE A;  4IGR A;  4GQO A;  3EN3 A;  3IOR A;  2B4L A;  1TWY A;  4RK9 A;  1N0T A;  1PB9 A;  4OEV A;  2Q9T A;  4FOR A;  3Q29 A;  1R9L A;  2Z23 A;  2OZZ A;  2THI A;  2ZXT A;  1PBP A;  1Z7M E;  2R9J A;  3UIF A;  2O6A A;  1MS7 A;  3FXU A;  3MZ1 A;  1QUK A;  1MQJ A;  3IAZ A;  4LA9 A;  3VLU A;  5F1Q A;  1D9V A;  2WOL A;  2B65 A;  2Q2A A;  3L6G A;  3U94 A;  5AA4 A;  1YCJ A;  1MDP 1;  1MQH A;  3PPQ A;  2P1S A;  4IO6 A;  3N94 A;  4BDQ A;  1PEB A;  4RYA A;  2QS2 A;  5I57 B;  1T0K A;  1MG1 A;  3PV0 E;  4PFT A;  1P1Q A;  4JWX A;  4U1O A;  1XS5 A;  3PGF A;  2Y84 A;  2RCB A;  3H6U A;  1US4 A;  4IO7 A;  4R74 A;  3ONM A;  1ELJ A;  3MZ9 A;  3D4G A;  3FVG A;  2GRV A;  2ZNU A;  1DTG A;  2G29 A;  2XXQ A;  4X48 A;  4YAH X;  3MJN A;  4YU0 A;  2Q88 A;  3RTW B;  3SEX A;  5B7D A;  4OFJ A;  4BDL A;  3IOU A;  1QUL A;  1JQF A;  1SDX A;  3C32 A;  1B3L A;  2OWS A;  3PPR A;  4IY5 A;  3RPW A;  1S50 A;  2DE2 A;  2DQV A;  4F18 A;  4AB6 A;  4JBZ A;  4QF9 A;  3SEW A;  3OSR A;  2DWJ A;  1MXV A;  3RYA A;  5IAI A;  1ZLQ A;  1N76 A;  2O51 A;  3DP6 A;  1SI0 A;  1M5F A;  2RC8 A;  3H6V A;  3L6H A;  4G68 A;  4GRK A;  3KSX A;  1ZJL A;  3K6U A;  4TLL B;  1D4N A;  1B7H A;  4KQP A;  3SKP A;  1M5D A;  1D3K A;  3MUQ A;  4POW A;  4IO3 A;  3HN0 A;  4YKP A;  3VFJ A;  4MH5 A;  3I3V A;  3T9V A;  2Y7R A;  2DE3 A;  4F29 A;  3USD A;  1NKX A;  2XHD A;  2I0B A;  4LZ7 A;  2A5T A;  5AA2 A;  2F36 A;  1EZP A;  3M8U A;  3IOW A;  3FZV A;  5H8N A;  3PU5 A;  4EQ7 A;  1BLF A;  3KJT A;  4H8J A;  3DRI A;  1A55 A;  5FTH A;  3CFZ A;  3TZA A;  4XKR A;  5ISU A;  3Q27 A;  4UAC A;  4G4P A;  5HBC A;  3GBA A;  3P7I A;  5H8H A;  1A8E A;  4F1U A;  3RT6 B;  2I6E A;  4ELO A; 
#chains in the Genus database with same CATH topology
 1B46 A;  2XX7 A;  1LBC A;  2DWI A;  5DT6 A;  2HZK A;  2KQZ A;  3TYH A;  4F22 A;  2DXY A;  1A7L A;  1FBF A;  2QVR A;  1PBQ A;  2ZZW A;  1USY E;  2NVU B;  3O66 A;  5TP9 B;  1OQG A;  1LGB C;  1N3X A;  1MM7 A;  1FQA A;  2VPN A;  4NF8 B;  3KFM A;  3S9L C;  4NF6 B;  1JEV A;  3OSQ A;  3FUZ A;  5ICQ A;  2FA7 A;  2OCU A;  1N3W A;  1XVX A;  5H8Q B;  2XXT A;  4IR8 A;  3LVU A;  3O2A A;  1NNF A;  1JET A;  2PMS A;  3ZKK A;  5A5X B;  4GWU A;  2FVZ A;  2XXW A;  1B2H A;  3K6V A;  3NOH A;  3HHG A;  1RDY A;  3BIH A;  4DZ1 A;  2QVV A;  4F3G A;  2GH9 A;  3MVX A;  2I49 A;  3KZG A;  5DVI A;  3LSW A;  1Y3P A;  4YB5 A;  2ZNS A;  2O7I A;  2CZK A;  1WVJ A;  4NED A;  3TAJ A;  3TEL A;  4MJO A;  1NI9 A;  4F39 A;  4ZDM A;  4OVR A;  5EYF A;  3W9V A;  3QUF A;  5H8H B;  4G8N A;  4OQO A;  2CMO A;  4OER A;  5CM6 A;  2GHB A;  2QS3 A;  4NWC A;  3MC2 A;  4NF8 A;  1SYI A;  4H65 A;  4G8H A;  2P3N A;  1URG A;  2HQ0 A;  3DLN A;  1VFD A;  3Q26 A;  4NWD A;  4G8M A;  2XXP A;  3KC1 A;  5IZ3 B;  1UTB B;  1SYH A;  3U92 A;  1GV8 A;  4UAB A;  5AA1 A;  1Y9U A;  3DRH A;  1TFA A;  1MY0 A;  3O6I A;  1JW4 A;  3RPL B;  3IJO B;  3RGY A;  2AIX A;  4PE5 B;  5KCJ A;  1POY 1;  4I3Y A;  5TPA B;  3E9X A;  3VXB A;  1INP A;  3K01 A;  3G7W A;  3OEM A;  4I9D A;  4DCY A;  3RY3 A;  3JZJ A;  3IB0 A;  2UVG A;  4P9K A;  4KR5 A;  4EXK A;  1MXZ A;  4F3S A;  4ZEI A;  4GWS A;  1JW1 A;  2XXY A;  1D9Q A;  3B7D A;  3T66 A;  5DVF A;  3PTY A;  3MQ9 A;  4O8M A;  3BBR A;  3TTR A;  3U65 A;  1FPG A;  5B70 A;  4DDD A;  1JNF A;  2P0S A;  3MVW A;  4BDR A;  2OWZ A;  3OEN A;  3U93 A;  1UQW A;  4FAJ A;  4P11 A;  3FAT A;  3TTN A;  1EU8 A;  4NF5 B;  1ATG A;  3IO6 A;  4F2O A;  1YTV A;  3HFU A;  3V89 B;  3ROJ A;  1HSL A;  4YMB A;  3GYY A;  3DRK A;  4Q0C A;  4AS5 A;  3ECR A;  2XXU A;  2OLB A;  5CBR A;  1FTJ A;  4O7M A;  4FED A;  1FPK A;  4U22 A;  3W9W A;  1S7Y A;  1N7X A;  2WX9 A;  3G3I A;  3O29 A;  1LCT A;  1RDZ A;  5I58 B;  2F78 A;  2XD3 A;  3VVE A;  4JVI A;  1FPI A;  2B3B A;  2XXH A;  4BDM A;  1B3F A;  3TPA A;  1FW0 A;  4N8Y A;  5LTC A;  3I5O A;  2ZNT A;  3MP1 A;  1PC3 A;  2GHA A;  5HPQ A;  3G3H A;  2PBW A;  1II5 A;  5BWJ A;  4G2Z A;  2QL3 A;  4PF6 A;  4DIG A;  4ZZA A;  2OX3 A;  1OLC A;  3SER A;  4I62 A;  1I6Q A;  4RJZ A;  1M5E A;  5I56 A;  3O28 A;  3AXF A;  1FPE A;  4PFU A;  4R75 A;  1JEU A;  4P56 A;  1FTK A;  2UXA A;  2WYP A;  2RF1 A;  4OAN A;  1HSE A;  2O68 A;  3T9U A;  3D1R A;  4ELR A;  2O7U A;  3QYT A;  4EUO A;  3SEU A;  1OVB A;  4PP0 A;  2XD2 A;  1MXX A;  2A5T B;  5A5X A;  3N6T A;  3MVZ A;  1YPN A;  2P3V A;  4MEV A;  1OQH A;  4R6K A;  1UTH A;  1FJ9 A;  3EQ1 A;  3T22 A;  1CB6 A;  3U8Q A;  1AIV A;  3C4M A;  1LEV A;  4ZE8 A;  1SW4 A;  1LFH A;  4EF1 A;  2YJP A;  1B52 A;  4R72 A;  4U4X A;  2W7Y A;  2DOJ A;  4YB7 A;  1B0L A;  4MFI A;  4QFN A;  4PFR A;  4HE1 A;  3LBS A;  4IO4 A;  3TTL A;  1IMA A;  2GQ1 A;  3LUZ A;  4MLQ A;  5I5P A;  3CFL A;  4FEB A;  5EQ8 A;  3B6Q A;  1LBV A;  1A8F A;  4QFL A;  1TT1 A;  5EQ9 A;  4G61 A;  2QJE A;  2QSX A;  4KPT A;  2RC7 A;  5I84 A;  4O3B A;  4G77 A;  3PD9 A;  3N6U A;  3PMV A;  5DW8 A;  2V93 A;  3LV0 A;  5EYH A;  3O6H A;  1GR2 A;  3K1M A;  2I4C A;  2PYY A;  3MVY A;  1WDN A;  3OEL A;  2OJT A;  1FPF A;  4O94 A;  2QVU A;  2XWO A;  3DM0 A;  4XTC Q;  3FIR A;  1GVC A;  1MM6 A;  2B3F A;  2M8C A;  3KSJ A;  5I59 A;  3IJX B;  4X1D A;  1HSJ A;  1MPC A;  1QJM A;  1TFD A;  3QIM A;  2P2A A;  4PFB A;  4RK9 A;  1TWY A;  1N0T A;  1PB9 A;  2THI A;  4HE2 A;  2R9J A;  2O6A A;  1MS7 A;  3MZ1 A;  1MQJ A;  5F1Q A;  2WOL A;  1YCJ A;  3PPQ A;  4IO6 A;  4RYA A;  1MG1 A;  1AWB A;  2RCB A;  5ITO A;  4YAH X;  4GX6 A;  2XXQ A;  2Q88 A;  4X04 A;  4OFJ A;  1SDX A;  3C32 A;  2DQV A;  4JBZ A;  4QF9 A;  1N76 A;  4GRK A;  3L6H A;  2CEX A;  1D4N A;  1FPD A;  3VFJ A;  4YKP A;  3HN0 A;  4MH5 A;  2Y7R A;  1NKX A;  4MHF A;  1EZP A;  2F36 A;  5H8N A;  3DRI A;  1A55 A;  4XKR A;  5HBC A;  4F1U A;  4N15 A;  2I3V A;  4ZEC A;  3OO8 A;  1NH7 A;  2VPO A;  1B7Z A;  4YMA A;  3K6X A;  3EKI A;  3EPE A;  3H6W A;  2XX9 A;  1YAE A;  1H76 A;  1UIU A;  2Y7P A;  5I59 B;  3O6G A;  2XWK A;  4KD5 A;  3UP9 A;  5I3S A;  4Q5T A;  1BK4 A;  4MNI A;  3ILU B;  4N6D A;  3LR1 A;  1NV3 A;  4ELQ A;  4ZED A;  2DVZ A;  1CNQ A;  1FJ6 A;  3FBP A;  2OBG A;  3KGC A;  3KG2 A;  3TCG A;  4TOZ A;  1NUY A;  2DVC A;  5CI5 A;  1QKA A;  4XKQ A;  1O7T A;  1QUI A;  3PUW E;  1K9Y A;  5FBP A;  1PB7 A;  5ET7 A;  5TP9 A;  3PPP A;  3IB2 A;  4H45 A;  5H8N B;  3IX1 A;  1RYX A;  4I8C A;  1F9B A;  3IK6 B;  5F24 A;  3CG1 A;  3IOT A;  4BLA A;  2NXO A;  4DXU A;  3G3J A;  4Q30 B;  3TOD A;  4RA1 A;  1PB8 A;  1NNK A;  4RK2 A;  4WKM A;  5I2K B;  4LP2 B;  4EXL A;  2R6G E;  3KJ7 A;  2V3U A;  3HO7 A;  1YZ0 A;  4E0X A;  3F11 A;  4ECF A;  3DP4 A;  4N81 A;  4XKP A;  3OEK A;  1B1H A;  1URD A;  3UGW A;  4M1V A;  2F7B A;  2Z8E A;  4LZ8 A;  1GTK A;  3B8B A;  2WBD A;  4LON B;  1FQB A;  5IGA A;  4G68 B;  3CHG A;  2H9B A;  5TPA A;  1EZ9 A;  4C0R A;  2X26 A;  5FHN A;  4OYV A;  1XOC A;  1OVT A;  1IQ7 A;  1G0H A;  1DPE A;  5EHS A;  4OFO A;  5A5L A;  3KBZ A;  3HST A;  2F3B A;  1ANF A;  3RT8 A;  3SEV A;  4P0G A;  1VSO A;  4PCD A;  3VV5 A;  4KYD A;  1OIB A;  3K4U A;  2QS4 A;  2YPN A;  2IEE A;  1DCU A;  2HEU A;  5I2N B;  5JTY B;  5KDT B;  2FIE A;  4NF4 A;  4KXP A;  1P1W A;  4G68 C;  4RPN A;  3T96 B;  1S9T A;  4YKK A;  1LBW A;  2ALU A;  4QBA A;  1IIT A;  4PC9 A;  3SEY A;  4YKI A;  4H67 A;  2BJJ X;  3TMG A;  4R2B A;  3RUM A;  1QKB A;  1FTO A;  4HCY A;  3C31 A;  4ZEK A;  3OMB A;  2I48 A;  2WBB A;  4JWY A;  4ND9 A;  2V3T A;  3IB1 A;  4IB2 A;  3T1B A;  3EF7 A;  5LDZ A;  4N91 A;  1B5I A;  2NUV A;  2ZZX A;  4GVO A;  4PAI A;  4I1D A;  3FVN A;  4NGU A;  1I6B A;  1ZBM A;  5L9O A;  2QMW A;  4DXC A;  2O84 X;  4P1L A;  3HCQ A;  3A09 A;  3S9E A;  1FBC A;  3UA8 A;  1KWH A;  4GD5 A;  2OWT A;  1B7U A;  4TLM B;  1FPB A;  2F7A A;  4THI A;  1Q1K A;  4FE8 A;  3QMF A;  4YIC A;  4NF0 A;  3FV2 A;  4HS7 A;  3G3G A;  3BFU A;  3CRB A;  3B6W A;  2RCA A;  5J16 A;  4TQU Q;  2F8D A;  1R6Z A;  2GFE A;  2AL5 A;  2WOP A;  3E3K A;  2KLF A;  4NMY A;  4MNC A;  1MXW A;  3H6T A;  3OXN A;  2VOZ A;  1NUW A;  3UOR A;  2X7P A;  1MRP A;  1NV7 A;  2UVH A;  1MQI A;  4R73 A;  4OVS A;  1IXI A;  4NX1 A;  4GX3 A;  4RNS A;  1M5B A;  3LUY A;  4OVT A;  1DOT A;  4XKN A;  3JYR A;  4Q8R A;  3FJM A;  4E0W A;  1B1X A;  4XF5 A;  1I6A A;  2FHY A;  1AH5 A;  3CI8 A;  1JW5 A;  4QXD A;  3D4C A;  5H8S A;  2RC9 A;  2AYS A;  1UIV A;  2E1S A;  1LAX A;  3JV9 A;  2Q74 A;  4Z7E A;  4JDF A;  2NOO A;  4QFO A;  4ZEB A;  1FTA A;  3KC0 A;  1NUZ A;  1N84 A;  4N4U A;  3QSL A;  4MNP A;  1BIY A;  2HCA A;  4GF8 A;  2AL4 A;  1BKA A;  4EQ9 A;  3R6U A;  1DSN A;  5L8D A;  2F34 A;  1N04 A;  2ABH A;  1B5H A;  1P99 A;  5H8Q A;  1IMD A;  2HAV A;  1EYK A;  3VVF A;  4AQ4 A;  3KEI A;  3Q28 A;  1DPP A;  4U4S A;  2VT5 A;  5DEX B;  5EYG A;  1Y3Q A;  2IA4 A;  4F3P A;  2DP8 A;  1ZIU A;  1Y4C A;  4PAK A;  4AB5 A;  5H8F B;  4OWD A;  1GGG A;  4ELP A;  1SPI A;  4FIM A;  5IZZ A;  3E78 A;  1FBH A;  4RXL A;  3T9X B;  3O6P A;  4IGR A;  2Q9T A;  4PFI A;  2OZZ A;  1PBP A;  3FXU A;  3L6G A;  2Q2A A;  1MDP 1;  1MQH A;  4BDQ A;  2V4C A;  4N17 A;  1P1Q A;  2CZH A;  4U1O A;  2Y84 A;  1US4 A;  4X48 A;  2GRV A;  3MJN A;  4MAG A;  1B3L A;  2R8T A;  1S50 A;  5IM2 A;  3DP6 A;  2F3D A;  1SI0 A;  4TLL B;  3H6V A;  1ZJL A;  1B7H A;  4KQP A;  1M5D A;  4IO3 A;  4AS4 A;  4LZ7 A;  2I0B A;  2A5T A;  5IZ3 A;  3CFZ A;  3Q27 A;  4G4P A;  3GBA A;  2I6E A;  4XFE A;  4N07 A;  4NF6 A;  4KHZ E;  4Z0I A;  5DYH A;  4DI4 B;  3PD8 A;  4MX6 A;  4KYS A;  3KN3 A;  3VE1 B;  1B4H A;  3H4Z A;  2WEF A;  3DRF A;  1B3G A;  2Y5L A;  2ONR A;  1M5C A;  3FAS A;  1LFI A;  4JWO A;  4ZZE A;  2L5V A;  3B6T A;  1NV6 A;  3RQT A;  4NN3 A;  5I2N A;  2Z22 A;  1B58 A;  5CBS A;  1B6H A;  1H43 A;  3LSX A;  4O7I A;  3FV1 A;  3VLV A;  2DDK A;  1KA1 A;  1AL3 A;  4DCX A;  1P1N A;  4PDD A;  2H4I A;  2X7Q A;  3OOA A;  2NWJ A;  2D21 A;  1O63 A;  1RKM A;  1NUX A;  3QAX A;  2WKY A;  3PMX A;  4FEC A;  4RY1 A;  1NV1 A;  4GFR A;  3RYB A;  1VDW A;  3BFT A;  2H99 A;  3E13 X;  4O3C A;  1AOV A;  3H06 B;  4MBP A;  2FBP A;  4ZEF A;  2O69 A;  1LAH E;  5CMM A;  3OO6 A;  2HPG A;  2XWI A;  4QRZ A;  3O97 A;  1KZ8 A;  3IR1 A;  5I57 A;  1R9Q A;  2FNC A;  2HAU A;  3RN8 A;  1FBD A;  1SD3 A;  3GBB A;  2V25 A;  3TCH A;  4HW8 A;  4H8I A;  2UYF A;  1DK4 A;  3BIG A;  3IO4 A;  1Y1M A;  4OES A;  4BDO A;  3S4U A;  1LLS A;  3SDF A;  4PDH A;  3PUV E;  1LB9 A;  1B51 A;  1VR5 A;  4MCO A;  2PVU A;  1DMB A;  2ZYN A;  1LFG A;  3PMW A;  1IXC A;  2XXR A;  1B9J A;  1RDX A;  2I58 A;  4F19 A;  3TTK A;  1FRP A;  4DI3 D;  1NH8 A;  1XC1 A;  5KZT A;  3FXQ A;  4N6P A;  2PFZ A;  4JVC A;  4LN5 A;  4P47 A;  3EHT A;  3GXA A;  4F3B A;  3PUY E;  1BP5 A;  4GWX A;  4H1X A;  4WED A;  5HM4 B;  4GWY A;  4F1Y A;  1MPD A;  3RLF E;  1MY3 A;  4YZZ A;  2ZMB A;  4R6H A;  1FTL A;  3TEP A;  4NF4 B;  1Y1Z A;  1NV0 A;  4ONY A;  2QS1 A;  4PGN A;  3FVK A;  1B3H A;  3FD3 A;  3O9P A;  4PFY A;  1QVS A;  2DWA A;  4F31 B;  3OD7 A;  3WAE A;  3MW0 A;  1Y4T A;  3H3G A;  4XXU A;  2O1L A;  4PBH A;  1A99 A;  1IMF A;  1FQC A;  1SVX B;  3ZSF A;  3K6W A;  3V83 A;  3PAM A;  4YB6 A;  3V8X B;  1JVY A;  1LAF E;  4PTK A;  4PAF A;  5EQA A;  1Q35 A;  4JSO A;  3K02 A;  5ESY A;  3K00 A;  2V3Q A;  2KR0 A;  3ODB A;  2R71 A;  4R6Y A;  5DEX A;  2G93 A;  4GL0 A;  1PDA A;  5LOM A;  4GLI A;  4HXV A;  2Z8D A;  1Y20 A;  2UYE A;  1IUD A;  3C33 A;  2E0S A;  3RYD A;  1ZTY A;  3DRJ A;  3W15 C;  1QGX A;  1IME A;  1SBP A;  5KCJ B;  2LAO A;  5ELV A;  4POX A;  1IXG A;  4OA4 A;  2Y7K A;  1NV4 A;  4FAT A;  4QHQ A;  3KN8 A;  2B4M A;  1FQD A;  4U21 A;  4QFP A;  5I2K A;  5F7V A;  2Y7I A;  4LQ5 A;  1MXY A;  2XWV A;  2UVJ A;  3V5A A;  4PGP A;  2BJI A;  4F2Q A;  2F97 A;  4UA8 A;  4OVQ A;  4OTE A;  3TQW A;  4U2R A;  3UN6 A;  1B3E A;  3M3L A;  3SET A;  3OO9 A;  2H98 A;  3TCF A;  3T93 B;  2ANJ A;  4HCW A;  1ZKB A;  3UK4 A;  4O3A A;  3I6V A;  1BTJ A;  3PPN A;  1MPB A;  5TU0 A;  4P0I A;  4MLV A;  4GIZ A;  2QPQ A;  1JVX A;  4GXA A;  3M3K A;  2F6P A;  2DS9 A;  4RPO A;  4FBP A;  2UVI A;  5AA4 B;  3N26 A;  3FJG A;  3MP8 A;  4LZ5 A;  1OMP A;  3K0V A;  1XHY A;  1FQF A;  1IMC A;  3ZS6 A;  3M3F A;  1MY4 A;  3DEL B;  3CR9 A;  4H5G A;  3TUS A;  3MYU A;  4K3F A;  1XVY A;  2PFY A;  3CIJ A;  2D5W A;  1NL5 A;  2Q2C A;  1IXH A;  5L9S A;  4EF2 A;  3FVO A;  1EZO A;  2VP1 A;  1DBZ A;  4ESW A;  5KDT A;  1B4Z A;  4R9G A;  3S9M C;  2ONS A;  2H5Y A;  1UTB A;  3CG3 A;  4I40 A;  4NAP A;  3C35 A;  3CSG A;  4NG7 A;  1JP4 A;  2PCR A;  1LST A;  2HFB A;  3EN3 A;  3IOR A;  4OEV A;  5T3J A;  3Q29 A;  1Z7M E;  1QUK A;  3IAZ A;  3VLU A;  1D9V A;  2B65 A;  5AA4 A;  3FXB A;  2P1S A;  3PV0 E;  3H6U A;  4EDP A;  4IO7 A;  3ONM A;  1DTG A;  4YU0 A;  3RTW B;  5B7D A;  4BDL A;  3IOU A;  1QUL A;  1JQF A;  3RPW A;  4F18 A;  4AB6 A;  1EYJ A;  3OSR A;  2DWJ A;  1MXV A;  3RYA A;  5IAI A;  5AA2 B;  2O51 A;  4LA9 A;  5I7I A;  2RC8 A;  3K6U A;  1K9Z A;  3ISP A;  4JVD A;  3I3V A;  4F29 A;  2DE3 A;  3USD A;  2XHD A;  3IOW A;  3FZV A;  1BLF A;  3KJT A;  4H8J A;  5FTH A;  5ISU A;  3P7I A;  1A8E A;  3RT6 B;  3RPL A;  3KOT A;  1B40 A;  3EHS A;  1VE4 A;  2F6G A;  4BDN A;  1POT A;  3PPO A;  4OEU A;  3DP8 A;  1MH4 A;  2F35 A;  4HTG A;  1H44 A;  3EHU A;  5ET5 A;  1SW5 A;  3HV1 A;  4FJP A;  1LBX A;  3H03 A;  1RYO A;  5J1D A;  2CZI A;  3MAM A;  1Y3N A;  4XIG Q;  5AE4 A;  5AA2 D;  2MKZ A;  3FGS A;  1OLA A;  3KOS A;  5EQ7 A;  4F1V A;  4R9F A;  1EH3 A;  1US5 A;  4PE3 A;  4H6D A;  4OVJ A;  4X9T A;  1YYZ A;  4C1T A;  5FHM A;  4KCC A;  4DXB A;  5AA3 A;  3KBR A;  5K2Y A;  3T0J A;  1FQE A;  2Q89 A;  3FJ7 A;  4QSD A;  5EHM A;  4H0W A;  2F7C A;  1WOD A;  4U1Z A;  5I56 B;  1D9Y A;  2QRY A;  1H3D A;  1Z7N E;  4MMP A;  1MDQ A;  1J1N A;  4IY6 A;  3IL1 B;  2PX1 A;  1NMU A;  4LQ2 A;  3TQL A;  2Q8M A;  3THI A;  2WOK A;  2DXR A;  4N8G A;  1TXF A;  3FXR A;  3C34 A;  4ZE9 A;  3QUJ A;  4MIJ A;  1UTH B;  3HPI A;  3PUX E;  2F5X A;  1YXI A;  1SI1 A;  3PUZ E;  1LCF A;  4ZS9 A;  3VDF A;  2HXR A;  3TFL A;  4QFK A;  3TKD A;  1KA0 A;  1USY H;  2XX8 A;  4GBW A;  3H7M A;  2ZYM A;  1SW1 A;  2DYX A;  4OXV A;  2JJK A;  4H5F A;  4ESX A;  4GX4 A;  1MY1 A;  5L9M A;  3G3K A;  1R1N A;  1LB8 A;  5IZ1 A;  1H45 A;  4OHN A;  3MPK A;  4OVP A;  4QSE A;  2RKM A;  5H8F A;  4KCD A;  1IMB A;  2XXX A;  1MQD A;  2DE4 A;  4OEN A;  1O64 A;  4KI0 E;  2ONK E;  1B0H A;  5FHO A;  1FTM A;  3ILT B;  4IGT A;  4L17 A;  5ITP A;  3MPL A;  3LSF B;  2DSF A;  3N5L A;  1XI6 A;  3A29 A;  3WAF A;  3VLW A;  4OZ9 A;  3LC8 A;  3BKI B;  2HZL A;  2ZYO A;  1VFE A;  4JXI A;  4NHB A;  4PBQ A;  3RTF B;  1FPL A;  3QK6 A;  4PQJ A;  2HXW A;  1NNP A;  1P1O A;  5BUU A;  5CMC A;  2PT1 A;  1EYI A;  4WXJ A;  1N7W A;  4X8R A;  2VGQ A;  2YLN A;  4LUB A;  4R2F A;  5K2X A;  4OET A;  3CSB A;  5CMB A;  3R7X A;  1DTZ A;  2PT2 A;  1SQY A;  3IOV A;  4N13 A;  4HE0 A;  1A54 A;  2A5S A;  3S2V A;  4KFQ A;  2XXK A;  3GLB A;  3R26 A;  2XXI A;  2V84 A;  1B5J A;  3S9N C;  2Z8F A;  1I69 A;  2WYK A;  5JK4 A;  3IFC A;  3U1O A;  2Y7W A;  3OO7 A;  4M4G A;  2FYI A;  2D3I A;  5DTB A;  1L5T A;  4NF5 A;  1LAG E;  3MWB A;  5JTY A;  1IEJ A;  1QW0 A;  1ZMG A;  1FBG A;  4GWZ A;  2CZL A;  4QSC A;  1AMF A;  5JEI A;  2ZYK A;  4JB7 A;  1FBE A;  4LVQ A;  3G3F A;  5FTI A;  5I58 A;  4P8B A;  3K2D A;  4YKJ A;  3MZB A;  2QMX A;  1MQG A;  1FCK A;  4WEP A;  1URS A;  3VVD A;  3FTO A;  1A40 A;  2FIX A;  1B05 A;  1XT8 A;  3C36 A;  4DLD A;  3B50 A;  3MBP A;  4X1B A;  3MP6 A;  4GOT A;  1ZU0 A;  4PET A;  2Q8J A;  3K1P A;  3A3C A;  1MXU A;  4JSD A;  1LBB A;  2CEY A;  1IIW A;  2VD2 A;  1B32 A;  5M2V A;  2I3W A;  2RIN A;  4MF3 A;  3A3U A;  3Q25 A;  4GWW A;  3VXC A;  1MY2 A;  2ZZV A;  4NTL A;  1IZ1 A;  5CC2 A;  2OK2 A;  4C1U A;  3HHF A;  4NE4 A;  3KN7 A;  4P1E A;  2I4B A;  1SW2 A;  3CFX A;  2DWH A;  1P1U A;  1QUJ A;  4ISU A;  5CMK A;  5IKB A;  3C9H A;  4GXS B;  2VD3 A;  4EQB A;  4N6K A;  1NFT A;  3GZG A;  3IFA A;  2REJ A;  4GWO A;  2QFL A;  3QXM A;  2H25 A;  1LBZ A;  2Y5K A;  2ESN A;  2XXV A;  2VHA A;  3E4R A;  3LSL A;  1MH3 A;  3DRG A;  4OMB A;  1G0I A;  1CE2 A;  4GL8 A;  2O1M A;  4PF8 A;  5DVJ A;  4OFL A;  1NNT A;  4DE8 A;  1FPJ A;  4P3L A;  4PFW A;  4LAT A;  1NV2 A;  4IO5 A;  1FSA A;  1Q9D A;  3RNN A;  3TDJ A;  1LBY A;  3SES A;  3SZP A;  3K1N A;  3CVG A;  4U23 A;  5CRY A;  5ICT A;  3ZKL A;  4IO2 A;  3T9H B;  2REG A;  2XA5 A;  2I0C A;  4KYE A;  5ET8 A;  4GQO A;  2B4L A;  4FOR A;  1R9L A;  2Z23 A;  2ZXT A;  2HHM A;  3UIF A;  3U94 A;  3N94 A;  1PEB A;  5I57 B;  2QS2 A;  1NV5 A;  3MST A;  1T0K A;  4GBV A;  4PFT A;  4JWX A;  1XS5 A;  3PGF A;  4R74 A;  5ET6 A;  1ELJ A;  3MZ9 A;  3D4G A;  3FVG A;  2ZNU A;  3TTM A;  2G29 A;  3U72 A;  3SEX A;  3E79 A;  2OWS A;  3PPR A;  4IY5 A;  2DE2 A;  3SEW A;  4NQ8 A;  1FBP A;  1ZLQ A;  1M5F A;  4G68 A;  3KSX A;  4I3E A;  3SKP A;  1D3K A;  3MUQ A;  4POW A;  3T9V A;  4H46 A;  5AA2 A;  3M8U A;  4EQ7 A;  3PU5 A;  3TZA A;  4UAC A;  5H8H A;  4XEQ A;  4ELO A; 
#chains in the Genus database with same CATH homology
 3KOT A;  4N07 A;  1B40 A;  1B46 A;  3EHS A;  1VE4 A;  2F6G A;  4NF6 A;  2XX7 A;  4KHZ E;  1LBC A;  2DWI A;  4Z0I A;  4BDN A;  5DYH A;  2I3V A;  1POT A;  3PD8 A;  5DT6 A;  2HZK A;  3PPO A;  4ZEC A;  4OEU A;  3TYH A;  4F22 A;  2DXY A;  3OO8 A;  3DP8 A;  4KYS A;  3KN3 A;  1NH7 A;  1MH4 A;  2F35 A;  1B7Z A;  4HTG A;  1H44 A;  3TTN A;  3EHU A;  3VE1 B;  1A7L A;  1B4H A;  3H4Z A;  1SW5 A;  3HV1 A;  1PBQ A;  4YMA A;  3K6X A;  4FJP A;  3DRF A;  1B3G A;  3EPE A;  3H6W A;  3H03 A;  2ONR A;  1RYO A;  2XX9 A;  1M5C A;  1YAE A;  1H76 A;  1USY E;  3FAS A;  1UIU A;  1LFI A;  3MAM A;  5J1D A;  2Y7P A;  4JWO A;  2NVU B;  5I59 B;  3O66 A;  4ZZE A;  3O6G A;  3B6T A;  1Y3N A;  4XIG Q;  5TP9 B;  4KD5 A;  1OQG A;  5BUU A;  5AE4 A;  3UP9 A;  3RQT A;  5AA2 D;  1LGB C;  3FGS A;  5I2N A;  2Z22 A;  1OLA A;  1N3X A;  1B58 A;  4Q5T A;  1MM7 A;  5CBS A;  1B6H A;  1FQA A;  4NF8 B;  3KFM A;  1H43 A;  3S9L C;  4NF6 B;  1JEV A;  3KOS A;  3OSQ A;  3ILU B;  4F1V A;  3LSX A;  4R9F A;  3LR1 A;  3FV1 A;  3FUZ A;  5ICQ A;  2FA7 A;  1EH3 A;  4ELQ A;  2OCU A;  1N3W A;  1XVX A;  5H8Q B;  4ZED A;  2DVZ A;  1US5 A;  3VLV A;  2XXT A;  2OBG A;  3KGC A;  3LVU A;  3O2A A;  4H6D A;  4OVJ A;  3KG2 A;  1NNF A;  4X9T A;  4C1T A;  3TCG A;  1AL3 A;  1JET A;  4DCX A;  1P1N A;  5FHM A;  4TOZ A;  2PMS A;  4KCC A;  3ZKK A;  5A5X B;  2DVC A;  2H4I A;  2X7Q A;  1B2H A;  2XXW A;  3K6V A;  3OOA A;  3KBR A;  5CI5 A;  2D21 A;  2NWJ A;  1QKA A;  4XKQ A;  1O63 A;  1RKM A;  1O7T A;  3HHG A;  5K2Y A;  1QUI A;  3PUW E;  1FQE A;  2Q89 A;  1PB7 A;  3FJ7 A;  3QAX A;  2WKY A;  3PMX A;  5TP9 A;  4QSD A;  5EHM A;  4FEC A;  4H0W A;  2F7C A;  1WOD A;  4RY1 A;  4U1Z A;  3PPP A;  4DZ1 A;  4GFR A;  3IB2 A;  3RYB A;  4F3G A;  5I56 B;  2GH9 A;  3MVX A;  2I49 A;  3KZG A;  5DVI A;  5H8N B;  3BFT A;  3LSW A;  3IX1 A;  1D9Y A;  2H99 A;  2QRY A;  1H3D A;  1RYX A;  1Y3P A;  3E13 X;  4O3C A;  4YB5 A;  4I8C A;  1F9B A;  1Z7N E;  2ZNS A;  1MDQ A;  1AOV A;  3H06 B;  1J1N A;  3IK6 B;  4MBP A;  4IY6 A;  2O7I A;  3IL1 B;  2PX1 A;  1WVJ A;  3CG1 A;  3IOT A;  1NMU A;  4LQ2 A;  4ZEF A;  4NED A;  2O69 A;  1LAH E;  5CMM A;  3TQL A;  4BLA A;  3THI A;  3TAJ A;  3TEL A;  2NXO A;  4F39 A;  4ZDM A;  5EYF A;  2WOK A;  3W9V A;  4DXU A;  3G3J A;  2DXR A;  3OO6 A;  4RA1 A;  3QUF A;  4Q30 B;  3TOD A;  4QRZ A;  5H8H B;  1TXF A;  3FXR A;  1PB8 A;  3O97 A;  1NNK A;  4G8N A;  4RK2 A;  4WKM A;  3IR1 A;  5I2K B;  3C34 A;  4ZE9 A;  4LP2 B;  5I57 A;  3QUJ A;  4EXL A;  4OQO A;  1UTH B;  2CMO A;  2R6G E;  3HPI A;  2F5X A;  2V3U A;  3KJ7 A;  3PUX E;  1R9Q A;  2FNC A;  1SI1 A;  3HO7 A;  4OER A;  3PUZ E;  1LCF A;  2HAU A;  3RN8 A;  5CM6 A;  2GHB A;  4ZS9 A;  3VDF A;  4E0X A;  3TFL A;  1SD3 A;  3GBB A;  4QFK A;  2QS3 A;  2V25 A;  3F11 A;  3TCH A;  4NWC A;  3DP4 A;  1USY H;  2XX8 A;  3MC2 A;  3TKD A;  4NF8 A;  4ECF A;  4HW8 A;  1SYI A;  3H7M A;  4XKP A;  2ZYM A;  1SW1 A;  2DYX A;  4OXV A;  4H65 A;  4G8H A;  4H8I A;  2UYF A;  4H5F A;  3OEK A;  1URG A;  1B1H A;  1URD A;  2HQ0 A;  3DLN A;  3IO4 A;  1Y1M A;  3UGW A;  1VFD A;  4M1V A;  4ESX A;  4OES A;  4BDO A;  3S4U A;  2F7B A;  3Q26 A;  1MY1 A;  5L9M A;  2Z8E A;  3G3K A;  1R1N A;  4LZ8 A;  4NWD A;  1GTK A;  1LB8 A;  1H45 A;  4G8M A;  4LON B;  1LLS A;  1FQB A;  4OHN A;  3SDF A;  3MPK A;  3PUV E;  4G68 B;  2XXP A;  1LB9 A;  4QSE A;  2RKM A;  3CHG A;  1B51 A;  1SYH A;  1UTB B;  1VR5 A;  1EZ9 A;  2H9B A;  4KCD A;  5TPA A;  3U92 A;  4C0R A;  2PVU A;  1DMB A;  2XXX A;  1GV8 A;  1MQD A;  2X26 A;  2DE4 A;  2ZYN A;  4OEN A;  5AA1 A;  1O64 A;  1Y9U A;  4KI0 E;  2ONK E;  1B0H A;  5FHN A;  4OYV A;  5FHO A;  1LFG A;  1FTM A;  3ILT B;  3DRH A;  1TFA A;  3PMW A;  1MY0 A;  4IGT A;  3O6I A;  1XOC A;  1OVT A;  4L17 A;  1IXC A;  1JW4 A;  1IQ7 A;  2XXR A;  1DPE A;  1B9J A;  5ITP A;  3IJO B;  3RGY A;  3MPL A;  2I58 A;  2AIX A;  4PE5 B;  4F19 A;  4DXB A;  3LSF B;  3TTK A;  5KCJ A;  2DSF A;  3N5L A;  5EHS A;  1POY 1;  4OFO A;  1NH8 A;  1XC1 A;  3WAF A;  3HST A;  5KZT A;  3FXQ A;  4N6P A;  5TPA B;  5H8F A;  1ANF A;  3E9X A;  3VLW A;  3VXB A;  3RT8 A;  3SEV A;  3K01 A;  4P0G A;  1VSO A;  4OZ9 A;  3LC8 A;  3BKI B;  2HZL A;  2ZYO A;  1VFE A;  3G7W A;  3OEM A;  4JXI A;  3VV5 A;  3EHT A;  4KYD A;  4I9D A;  4DCY A;  3RY3 A;  1OIB A;  3JZJ A;  2QS4 A;  3GXA A;  3IB0 A;  3K4U A;  2YPN A;  3RTF B;  2IEE A;  4F3B A;  2UVG A;  3PUY E;  1BP5 A;  2HEU A;  5I2N B;  3QK6 A;  4H1X A;  5JTY B;  5KDT B;  4WED A;  5HM4 B;  4KR5 A;  4PQJ A;  2HXW A;  1NNP A;  4NF4 A;  4EXK A;  4F1Y A;  1P1O A;  1P1W A;  4G68 C;  4RPN A;  1MPD A;  3RLF E;  1MXZ A;  3T96 B;  4F3S A;  1MY3 A;  4ZEI A;  1JW1 A;  4YZZ A;  2XXY A;  1S9T A;  2ZMB A;  3B7D A;  2ALU A;  4R6H A;  5CMC A;  3T66 A;  1FTL A;  4YKK A;  5DVF A;  3TEP A;  3MQ9 A;  1IIT A;  2PT1 A;  1Y1Z A;  4NF4 B;  3SEY A;  3BBR A;  3TTR A;  4YKI A;  4ONY A;  4WXJ A;  5B70 A;  2QS1 A;  1N7W A;  4H67 A;  4DDD A;  3FVK A;  1B3H A;  2BJJ X;  2VGQ A;  3O9P A;  1JNF A;  2YLN A;  4PFY A;  1QVS A;  2P0S A;  3MVW A;  2DWA A;  4LUB A;  4R2B A;  4R2F A;  5K2X A;  3RUM A;  1QKB A;  1FTO A;  4BDR A;  4OET A;  3OEN A;  3C31 A;  4ZEK A;  4HCY A;  3CSB A;  3U93 A;  4F31 B;  3OD7 A;  3OMB A;  3WAE A;  3MW0 A;  1UQW A;  4FAJ A;  4P11 A;  2I48 A;  3FAT A;  4JWY A;  1EU8 A;  4NF5 B;  1Y4T A;  5CMB A;  3R7X A;  1DTZ A;  3H3G A;  4ND9 A;  2V3T A;  1ATG A;  3IO6 A;  2PT2 A;  4XXU A;  4F2O A;  1SQY A;  3IB1 A;  3IOV A;  1YTV A;  4IB2 A;  4N13 A;  3V89 B;  2O1L A;  1HSL A;  1A99 A;  1A54 A;  3EF7 A;  4YMB A;  1FQC A;  2A5S A;  3S2V A;  1B5I A;  3DRK A;  1SVX B;  2NUV A;  4KFQ A;  4GVO A;  4Q0C A;  3ZSF A;  3ECR A;  4I1D A;  3GLB A;  3FVN A;  2XXU A;  2XXI A;  3K6W A;  1I6B A;  2OLB A;  1ZBM A;  2V84 A;  3R26 A;  5L9O A;  1B5J A;  5CBR A;  3V83 A;  3PAM A;  1FTJ A;  2QMW A;  4DXC A;  4FED A;  4YB6 A;  3V8X B;  1JVY A;  1LAF E;  2O84 X;  1I69 A;  2Z8F A;  3S9N C;  4U22 A;  3HCQ A;  3A09 A;  3S9E A;  5JK4 A;  1Q35 A;  3W9W A;  4JSO A;  1S7Y A;  1N7X A;  3K02 A;  3U1O A;  3G3I A;  3UA8 A;  2Y7W A;  3O29 A;  1LCT A;  3K00 A;  2V3Q A;  1KWH A;  5I58 B;  4GD5 A;  2OWT A;  3OO7 A;  4M4G A;  2F78 A;  2D3I A;  2FYI A;  3ODB A;  5DTB A;  1L5T A;  1B7U A;  2XD3 A;  4NF5 A;  4TLM B;  3VVE A;  1LAG E;  2R71 A;  2F7A A;  3MWB A;  4R6Y A;  2G93 A;  2B3B A;  5DEX A;  4THI A;  5AA2 B;  2XXH A;  1Q1K A;  4GL0 A;  3TTM A;  1IEJ A;  1PDA A;  1QW0 A;  1ZMG A;  3U72 A;  1B3F A;  4BDM A;  5JTY A;  3TPA A;  5LOM A;  1FW0 A;  4FE8 A;  3I5O A;  4GLI A;  2Z8D A;  1Y20 A;  2UYE A;  1IUD A;  3C33 A;  4YIC A;  2E0S A;  2CZL A;  2ZNT A;  4QSC A;  1ZTY A;  1AMF A;  3DRJ A;  5JEI A;  3FV2 A;  4HS7 A;  3G3G A;  4DE8 A;  3W15 C;  3MP1 A;  3BFU A;  1PC3 A;  3B6W A;  3CRB A;  2ZYK A;  4JB7 A;  1SBP A;  2RCA A;  2GHA A;  5HPQ A;  5KCJ B;  4LVQ A;  3G3H A;  2PBW A;  1II5 A;  2LAO A;  5ELV A;  3G3F A;  1IXG A;  2F8D A;  4POX A;  4TQU Q;  5BWJ A;  4G2Z A;  2QL3 A;  2Y7K A;  1R6Z A;  5FTI A;  2GFE A;  4DIG A;  2AL5 A;  5I58 A;  3K2D A;  2WOP A;  4QHQ A;  4FAT A;  4YKJ A;  4ZZA A;  3KN8 A;  3E3K A;  1OLC A;  2KLF A;  2B4M A;  4NMY A;  3SER A;  3MZB A;  2QMX A;  4I62 A;  1I6Q A;  1MQG A;  1FQD A;  4RJZ A;  1M5E A;  5I56 A;  1FCK A;  1MXW A;  3AXF A;  3H6T A;  3O28 A;  1URS A;  4WEP A;  3VVD A;  3OXN A;  4PFU A;  3FTO A;  4U21 A;  1A40 A;  2VOZ A;  4QFP A;  5I2K A;  4R75 A;  1JEU A;  1FTK A;  5F7V A;  2Y7I A;  4LQ5 A;  3UOR A;  1MXY A;  1MRP A;  2UVJ A;  2UXA A;  1B05 A;  2UVH A;  1MQI A;  1XT8 A;  2RF1 A;  2X7P A;  3C36 A;  3V5A A;  1HSE A;  4R73 A;  4DLD A;  2O68 A;  4F2Q A;  3T9U A;  3MBP A;  1IXI A;  2F97 A;  4UA8 A;  4X1B A;  4OTE A;  4RNS A;  3TQW A;  4U2R A;  1M5B A;  3LUY A;  3MP6 A;  1B3E A;  4GOT A;  3M3L A;  3UN6 A;  1DOT A;  3SET A;  1ZU0 A;  3OO9 A;  4PET A;  4XKN A;  2Q8J A;  2O7U A;  3K1P A;  3QYT A;  4ELR A;  3A3C A;  4EUO A;  3SEU A;  1OVB A;  1MXU A;  3JYR A;  3FJM A;  4JSD A;  4Q8R A;  1LBB A;  2H98 A;  4PP0 A;  4E0W A;  2XD2 A;  1MXX A;  2A5T B;  1B1X A;  1IIW A;  1I6A A;  2VD2 A;  5A5X A;  3N6T A;  3MVZ A;  3TCF A;  1YPN A;  5ITO A;  3T93 B;  1B32 A;  2ANJ A;  4HCW A;  5M2V A;  1ZKB A;  1OQH A;  4R6K A;  1UTH A;  3UK4 A;  1AH5 A;  3EQ1 A;  3T22 A;  3CI8 A;  1CB6 A;  2I3W A;  2RIN A;  4MF3 A;  3U8Q A;  1JW5 A;  4O3A A;  3A3U A;  3Q25 A;  3VXC A;  1AIV A;  3I6V A;  3C4M A;  1BTJ A;  3D4C A;  1MY2 A;  4NTL A;  5CC2 A;  1IZ1 A;  3PPN A;  2OK2 A;  4ZE8 A;  5H8S A;  4C1U A;  2RC9 A;  2AYS A;  1MPB A;  1SW4 A;  5TU0 A;  1UIV A;  1LFH A;  3HHF A;  2E1S A;  1LAX A;  4P0I A;  4NE4 A;  4MLV A;  3JV9 A;  4GIZ A;  2QPQ A;  1JVX A;  4EF1 A;  3KN7 A;  5AA3 A;  2YJP A;  4GXA A;  1B52 A;  4R72 A;  4U4X A;  2W7Y A;  3M3K A;  2DOJ A;  2I4B A;  4YB7 A;  3TMG A;  2F6P A;  4Z7E A;  4JDF A;  1B0L A;  1SW2 A;  2DS9 A;  4RPO A;  3CFX A;  2DWH A;  1P1U A;  4MFI A;  4QFN A;  1QUJ A;  4EDP A;  2NOO A;  4QFO A;  3LBS A;  4ZEB A;  2UVI A;  4IO4 A;  4ISU A;  5CMK A;  3TTL A;  5AA4 B;  3N26 A;  5IKB A;  3C9H A;  4MLQ A;  4GXS B;  3FJG A;  3MP8 A;  4LZ5 A;  1OMP A;  3K0V A;  1XHY A;  3FD3 A;  1N84 A;  1FQF A;  2VD3 A;  4EQB A;  1NFT A;  3CFL A;  3GZG A;  3ZS6 A;  4FEB A;  3QSL A;  3M3F A;  1BIY A;  1MY4 A;  2HCA A;  4GF8 A;  3B6Q A;  2REJ A;  2AL4 A;  3DEL B;  3CR9 A;  1BKA A;  4H5G A;  4EQ9 A;  4GWO A;  3R6U A;  1A8F A;  3QXM A;  4QFL A;  2H25 A;  3TUS A;  1DSN A;  2ESN A;  2XXV A;  1TT1 A;  4K3F A;  5L8D A;  1XVY A;  2VHA A;  2F34 A;  3E4R A;  2QJE A;  3LSL A;  2QSX A;  1N04 A;  2ABH A;  2RC7 A;  3CIJ A;  4KPT A;  2D5W A;  5I84 A;  1P99 A;  1B5H A;  1MH3 A;  1NL5 A;  3DRG A;  4OMB A;  2Q2C A;  4O3B A;  4G77 A;  5H8Q A;  1CE2 A;  1IXH A;  2HAV A;  3N6U A;  3PD9 A;  3VVF A;  4AQ4 A;  5L9S A;  4GL8 A;  3PMV A;  2O1M A;  2V93 A;  3KEI A;  5DVJ A;  4EF2 A;  4OFL A;  3Q28 A;  3O6H A;  1GR2 A;  1NNT A;  3K1M A;  2I4C A;  1DPP A;  3MVY A;  2PYY A;  3FVO A;  4U4S A;  5DEX B;  1WDN A;  1Y3Q A;  2IA4 A;  1EZO A;  4F3P A;  2DP8 A;  2VP1 A;  3OEL A;  4PFW A;  2OJT A;  4LAT A;  4ESW A;  5KDT A;  1B4Z A;  4R9G A;  1ZIU A;  3DM0 A;  4XTC Q;  3FIR A;  3S9M C;  1Y4C A;  4IO5 A;  3RNN A;  2ONS A;  3TDJ A;  1GVC A;  3SES A;  1MM6 A;  2H5Y A;  4AB5 A;  1UTB A;  2B3F A;  2M8C A;  3CG3 A;  3KSJ A;  3K1N A;  5H8F B;  5I59 A;  4OWD A;  1GGG A;  3IJX B;  4ELP A;  4X1D A;  3C35 A;  3CVG A;  4FIM A;  1HSJ A;  4U23 A;  5CRY A;  1MPC A;  3CSG A;  5ICT A;  1QJM A;  1TFD A;  4RXL A;  4IO2 A;  3ZKL A;  3QIM A;  3T9H B;  2REG A;  1LST A;  2P2A A;  3T9X B;  2HFB A;  3O6P A;  2I0C A;  4KYE A;  4IGR A;  4GQO A;  3EN3 A;  3IOR A;  2B4L A;  1TWY A;  4RK9 A;  1N0T A;  1PB9 A;  4OEV A;  2Q9T A;  4FOR A;  3Q29 A;  1R9L A;  2Z23 A;  2OZZ A;  2THI A;  2ZXT A;  1PBP A;  1Z7M E;  2R9J A;  3UIF A;  2O6A A;  1MS7 A;  3FXU A;  3MZ1 A;  1QUK A;  1MQJ A;  3IAZ A;  4LA9 A;  3VLU A;  5F1Q A;  1D9V A;  2WOL A;  2B65 A;  2Q2A A;  3L6G A;  3U94 A;  5AA4 A;  1YCJ A;  1MDP 1;  1MQH A;  3PPQ A;  2P1S A;  4IO6 A;  3N94 A;  4BDQ A;  1PEB A;  4RYA A;  2QS2 A;  5I57 B;  1T0K A;  1MG1 A;  3PV0 E;  4PFT A;  1P1Q A;  4JWX A;  4U1O A;  1XS5 A;  3PGF A;  2Y84 A;  2RCB A;  3H6U A;  1US4 A;  4IO7 A;  4R74 A;  3ONM A;  1ELJ A;  3MZ9 A;  3D4G A;  3FVG A;  2GRV A;  2ZNU A;  1DTG A;  2G29 A;  2XXQ A;  4X48 A;  4YAH X;  3MJN A;  4YU0 A;  2Q88 A;  3RTW B;  3SEX A;  5B7D A;  4OFJ A;  4BDL A;  3IOU A;  1QUL A;  1JQF A;  1SDX A;  3C32 A;  1B3L A;  2OWS A;  3PPR A;  4IY5 A;  3RPW A;  1S50 A;  2DE2 A;  2DQV A;  4F18 A;  4AB6 A;  4JBZ A;  4QF9 A;  3SEW A;  3OSR A;  2DWJ A;  1MXV A;  3RYA A;  5IAI A;  1ZLQ A;  1N76 A;  2O51 A;  3DP6 A;  1SI0 A;  1M5F A;  2RC8 A;  3H6V A;  3L6H A;  4G68 A;  4GRK A;  3KSX A;  1ZJL A;  3K6U A;  4TLL B;  1D4N A;  1B7H A;  4KQP A;  3SKP A;  1M5D A;  1D3K A;  3MUQ A;  4POW A;  4IO3 A;  3HN0 A;  4YKP A;  3VFJ A;  4MH5 A;  3I3V A;  3T9V A;  2Y7R A;  2DE3 A;  4F29 A;  3USD A;  1NKX A;  2XHD A;  2I0B A;  4LZ7 A;  2A5T A;  5AA2 A;  2F36 A;  1EZP A;  3M8U A;  3IOW A;  3FZV A;  5H8N A;  3PU5 A;  4EQ7 A;  1BLF A;  3KJT A;  4H8J A;  3DRI A;  1A55 A;  5FTH A;  3CFZ A;  3TZA A;  4XKR A;  5ISU A;  3Q27 A;  4UAC A;  4G4P A;  5HBC A;  3GBA A;  3P7I A;  5H8H A;  1A8E A;  4F1U A;  3RT6 B;  2I6E A;  4ELO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...