1B9KA

Alpha-adaptin appendage domain, from clathrin adaptor ap2
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
237
structure length
237
Chain Sequence
EDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVINIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (ALPHA-ADAPTIN APPENDAGE DOMAIN)
publication title A structural explanation for the binding of multiple ligands by the alpha-adaptin appendage domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 66
structure length 237
sequence length 237
ec nomenclature
pdb deposition date 1999-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1b9kA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1b9kA02
1VOKA 1B9KA 1OM9A 3ZHFA 1CDWA 1MP9A 1GYUA 1RM1A 1QNBA 2DWXA 3ZY7A 1AISA 2D0AA 2E9GA 1QN3A 1YTFA 1QNEA 1R4XA 1C9BB 5CN1A 1VTLE 4ROEB 1TGHA 2A7BA 1IU1A 4ROCB 1QTSA 1NVPA 2IV8A 4BCXA 4PY5A 1JFIC 2G30A 2Z8UA 1VOLB 2DWYA 1W80A 1QNCA 1KYUA 1GYWA 3HS8A 3EIKA 3MNMA 1P4UA 1QN5A 1QNAA 2D0CA 1VTOA 1KYDA 1D3UA 1KY6A 1KY7A 1QN9A 1QTPA 3OC3C 5IYDP 2D0BA 1E42A 5IYBP 1YTBA 3VN5A 5CN2A 5IYCP 3OCIA 1GYVA 1NA8A 1PZDA 2YMTA 1QN4A 4B0AA 2VJ0A 1QN8A 1QN6A 1PCZA 1QN7A 1TBAB 1KYFA 4WZSD 4RODB 3H1ZA 2MJ7A 2IV9A 1NH2A 1TBPA 1NGMA 3HS9A 3ASMA
chains in the Genus database with same CATH superfamily
1FDLH 3OR6B 2E76C 5IB5B 1VZGA 5F7WC 4U3SB 5IB1B 1N7ML 4YR6A 4S0HA 1AJ7L 3UJJL 2HRPL 3S37H 5HJGA 1AZCA 2AW2A 4TS6A 2FATL 3LS5L 4PRPA 3EF7A 1J8RA 1IGYA 4D0DA 2JJVA 5BPPA 4KKCD 4JKPL 3NCJL 5CGYD 4JG9A 4CNIA 1J86A 2X44D 2WN3A 4A7TA 4PCKA 1QUPA 3ZIYA 4F7TB 5F9WC 5KAQG 4HCFA 3R06B 1ONQB 2EKSB 5JO5B 4QI3A 4JY5L 3MA7B 5BXFA 2YD3A 5GSVA 5DJ8A 4KX7A 4UZGA 4UOJA 3IVKA 3K80A 35C8H 3IXTA 4FQCH 4RAVB 3V7AG 1JRHH 3UZVB 3OMIB 2VM9A 4N86A 5JR1H 3FNKA 4X6CF 1S7XA 4UNTA 5DVLA 4B41A 3DIFA 4A39A 3FQWB 3FAWA 3GJFH 1KC5H 3PPSA 5C8JB 3S8GB 2CM6A 4TSAL 1BFTA 4Z78A 4K8RL 1TF4A 2QMJA 4BBWA 1O0VA 4UTAL 1MCQA 3CH1A 3QORB 4CMHC 4GG8B 5I8CA 3FU8A 1BZ9A 5JORA 4BIKA 1FBIL 4NNYB 1H6FA 3RL1A 2Q20A 1NSNH 3ARGC 5LDUA 3F65A 1LMKA 5F0LB 3DGGB 3IETA 5LGJA 4DGIL 4UU9A 3SE8H 3POHA 3RB5A 5D7KE 4XP6L 2I5YH 3VH8A 1FYTD 3VB9A 4S1QH 5ECJE 4BK5C 3BW9A 3SQBA 1DZBA 3QCUH 3DMMD 3K5RA 2VDLL 3FRPA 1MI5D 4PREB 4ELDA 1G9HA 3NFPA 3E2HC 1VENA 2ED7A 3LD8B 3OSKA 1FNGB 1U2CA 4KXCA 4L9LA 5AOZA 3R0MA 5DMYA 3WIFB 5AW0B 4WFHE 4KRPB 2FWLB 1JZ7A 2GTWB 1XB6A 3V0VA 4E5XB 4JANA 2XG4A 3H53A 3IJYA 5H94B 5IHBA 4NN6C 4D7QA 4X5LA 4JRYD 4RH4A 4ZUTA 4Z5RA 2BCMA 3U4BL 1A6VL 1FA4A 4PU2A 2VERN 1Q9LA 5L4JA 5I24A 3VWJC 4AY0A 4XGZB 4CN4A 3ALWA 5EBWA 2APBA 2ZUQC 3KPRE 3SBPA 3PHAA 3PHOA 2OYMA 4PTUA 4FERA 3OJDB 4WW2C 4PD4J 1M9SA 5FDWA 4Q0XH 3GXUB 2QZQA 4TUUA 4RFNB 3U6XA 1O7DE 3T65B 2EYSB 1K8IB 3CFQA 4NQCE 4OF6A 4PJ8C 1GJWA 1K3IA 4PW9A 5JHDA 3NZ8B 3DPDA 3O3BA 5C0RL 4GI6A 1EJ6A 3WNJA 3KLHD 4GXUM 4JN1L 3AXHA 4UYPA 1IGJB 4TQIA 4CVWA 5D1ZC 1Z2KA 3BZ4A 3K8MA 2WLIB 4FLHA 4DP4X 4Y16C 3DUUB 2H5UA 2C5DC 1WA1X 1CE1H 4JRXE 2G2PA 4UQDA 3D4ZA 3U2JA 4KQ4L 5IMMA 1EZVX 1NFAA 1ZA6B 1J0YA 4U1MB 4S0TD 2PCPA 4AZ8B 3DYMA 1S3RA 2QR0B 1CGSL 3D69B 3K6FA 3T4AA 2FD6L 5KSVB 3ZDZF 5B1JA 2NXZB 3U0PB 1TCRA 1ADWA 1U3JA 2VH5H 2FX9H 5AEAA 1R6VA 4GAYA 4JFSA 1BQSA 3MRCA 3G7TA 3HLAA 3ZZLA 3WBDA 2P5WB 3QQ4A 4I9XA 5HJDA 4L8CB 4YL9A 4E9SA 1QUNB 1JTOA 1QRNB 1WZ1H 3E1ZA 3PF2A 5I8KH 1HZLA 2CKBA 5D71H 4JAMB 4B9YA 2E0PA 1JHKH 5DUMH 4CBPA 4DVBA 5JW4R 3HNVH 3VFNA 5E1AA 3KPTA 4F8PA 3Q6FA 3QUYC 1X44A 5DUBA 1JJUA 3SD5A 2XBZA 5IB2B 4ECNA 1S9YA 4ODBD 2O5YL 4UT9A 2OZ4H 2ZOLA 4UMGA 4P23A 1FNSH 5AW3B 1KLFB 1FUNA 3NGBC 1MKFA 3W39A 4YMPA 3LEVH 4QOKB 3ESPA 5DC0A 1XCWA 4H8QA 3IJSB 4CU8A 5HGAB 5ALCL 5E6SB 3O2DH 1D5XB 2VXUL 4QY8B 4O02L 3U82B 5IESH 4L3EB 4YGVB 4LPUA 2EYTB 1E9PB 5DK3A 1DSYA 4V11A 4G5ZH 3E3QC 5D2NE 4UUJA 4BKLA 4QWWD 2CCVA 4B50A 3H55A 1BG1A 3B9KA 4HIEA 2QJDA 2X4UA 5DMGC 3VE0B 3Q06A 1JGUH 5D2LF 4NRZB 2O6DA 4PP1D 5H4YA 3DX1A 2PCFB 1S7VB 4ZTOH 5I66A 2ZKHH 5DMIH 5I0VA 1OKEA 4GJTB 1DVSA 4GRMB 4UQBA 3CX5J 1JIBA 4U0RC 2KT6A 2F08A 4PRHE 4IIZA 5MP6L 1A1MB 3KPSE 5C6TL 1BZQK 3VGBA 3GC3A 1YQMA 2EC9U 1VAHA 2V2XA 3HG1D 2EQDA 3CHRA 1J05A 1CLOH 1EWHA 2MH4A 3IFOB 4KKZA 1P84J 4K07A 4BSVB 1TTCA 4FQQA 1INDL 1E6JL 1LO5A 2K6WA 4FG0A 4YVNA 2ZXBA 3BKQX 3EYSL 1NFDE 4HJSA 4N2MA 4AM0B 2IMMA 2ICEC 5KS9A 5FO8B 1P7HL 1B6UA 3UTPE 3WKMH 2WWNA 4JFWA 4LLDB 2A77H 2WLLB 5F1NB 5FECB 4N6RB 3LYRA 4Y19D 3GB7A 3V4PA 1C4GA 3CVTA 5AAWC 4YHLH 1HEZA 3AADB 4KKBD 4JFHD 5I75B 1XB8A 1J18A 2CUIA 4PUBH 4W9LC 5E9DB 2VISB 3DVNB 3ZHNA 4ZMAT 3REVB 4Y2LA 3F00A 4H26A 4NKIL 4FNLH 5SX5K 2BSDA 1Y6MR 3FCSB 3TONA 3LDBC 3B2VH 4LL4A 4XCNB 3I2CH 3BN3B 3ARDB 5DI8A 2I07A 2X1WL 3S3CB 4YHZL 3COOA 4NM4L 5KSBA 2VDML 2CSPA 3R19A 4EAKA 1EEZB 2BY1A 1C08B 3QZNA 5K59F 5D7IA 2AV1B 1E40A 1QWUA 1KN2L 2NDFA 1N6QL 3PUCA 2EE2A 3P9MB 3MO1A 4KH9A 4M02A 4WZ9A 4JFDE 1C1EH 1DQQB 1OSEA 5C7XH 4M5ZH 2YEZB 5GS1C 4U6TA 5C9JB 4WU7B 1KB5L 2ZIDA 5I1LA 5TGBA 1M4KA 1CK0L 1NQBA 2BHYA 4GS7C 4L8BB 4F57H 3BFWA 1R3JA 3EGDA 3D18B 5IJDC 1CI5A 2GUYA 4NAJA 2W65A 2APFA 3EH2A 2NXYB 1S3KH 1TU2A 1VFAA 2CO7A 3KS0H 3KLLA 4E0RB 4FQIH 4F58H 1WJWA 4V33A 4MJIA 2VDOL 4XZUA 3OH9A 3HMWH 5IBTH 1CLCA 1AQ8A 4ZS7H 4FG2A 4ZQTA 1RAMA 3WLBA 4JM2C 1NICA 2H3KA 4IEFA 2QKIB 4XHQA 4GAGL 2QVTA 3O0LA 4CU7A 1BGXH 4MCNA 4DAGL 1C47A 3LRGA 5DHYB 1IKNC 2XYCA 4YL4A 5C92A 3LKRB 3CMGA 3ORJA 3T6QC 1LEIB 2F18A 2A83B 5DFWH 1B4LA 1JZHA 3QDJA 4S2SB 3SE4A 1M7DA 4KMTH 5TQ0H 3TJEL 2NOBA 5D7KD 1FVCA 4K94H 1Y1UA 4Z7QF 4LL9A 3LZQA 1AXTL 3MUGA 4O00A 4XBEH 3FF7A 5B21A 3W0WB 2XQ0A 3KYKL 5TK4A 5AW8B 5E2TL 1I1CA 1WA2X 1AQKL 2WVVB 1CF1A 3MCKA 3ELAT 1I7ZB 3PQYA 4X5QA 1IRAY 2F1AA 1AHWC 3QH3A 1N5YL 3FB8A 3D2UA 4ODXB 3KGRA 4QXTA 1BLIA 1E5UI 3SY0A 3TO4A 4Z77B 2ITDA 4TTDC 2I7OA 4ZUWA 5AENA 1RZ7H 2VC2B 4Y4FB 3G08A 1MJ8L 1MCCA 1XTMA 4GXFA 1VFBA 1OANA 3ZVVA 4DQOH 1L9PA 1DBBL 4NN5B 3O2DA 3FO1B 1BFVL 4G6MH 3TO2B 4P59H 3I3BA 1UOVA 4ADIA 2AVGA 2HKHL 3QWOA 4RZCA 1FN4B 3V6OA 1D9KA 1MWOA 5DRNB 4F7PB 2P8PB 4ZFZB 3TCXA 3FPYA 1S7QA 3EH3B 5BW7C 3KPRD 3SYPA 2H32B 4LDLB 1TETL 4QAMB 1P2CA 1UVQA 4A6YB 5C70A 2E7LC 1OB0A 3I6SA 3PRZA 3TBWB 1BMGA 2WAHA 4PJGE 4Z18A 3N42B 4DUWA 2BINA 3QZMA 1HSAB 1C16B 3HC0A 1FI8C 4F8LA 3G5YB 2EDBA 2OMYB 4HAFA 1GH7A 4LVOB 4RX4A 4N8VG 1F41A 1IARB 2JLPA 2IANA 3BZFB 4KFMA 2Y24A 2DJMA 5EUOF 3BI9X 5F0PB 5I16B 5J6GB 4N1CA 4AJVA 1HCZA 2Q3AA 4JRXD 4APXA 2B1AL 4OGAC 3DWTA 4BDVA 4K8RD 2FX7L 4B5ZA 3ABLB 3IDYB 4E9LA 4NJAL 2NOHA 2OSLA 4BFGA 5CJOH 3VG9C 1G9MC 2NUTA 5A43C 1C5CL 7TAAA 2XWRA 4APQB 3CFBA 4KQ3L 3V6ZA 3S0PA 3EJPA 5L0QC 5C0GB 4WVRA 3WG7B 1RZGA 5DR5L 5ID1A 4FLRA 5EWIH 4XP1L 5K1NA 5FV2A 2XZAL 2V8MA 4CMMA 1E90A 2BIIA 1BQHB 4Y2OA 1PIGA 1L3NA 3SDXF 1WVZA 3NFNA 3CSFA 1Q0XH 4ZZFA 1KG0B 3BP6B 4AIEA 3ARBD 5I1DB 2ISDA 5D1XD 4XO5A 4LF3A 2KBGA 4NJ9H 2YLHA 4HKXA 3PDOA 5CZKA 4M43H 4GI8A 4UT7L 5BVPH 2W88A 5AKVA 1NC2B 1OAJA 1MRCH 2K9FB 4LSVL 4P5TD 5EU6B 1OAZL 1U93A 4JFOB 3NCBB 4YEEA 3MREB 5KVEL 5ERWA 2ADIB 2F54A 1E2ZA 1G7MA 5BO1L 1XTLA 3KVPA 1SLUA 1DJZA 3QIWD 5FIEA 2A73A 5MEOB 2CPCA 4GBXB 4XPGL 2PWEA 4KTGA 3RI5F 1AR1B 2QADD 1CBVL 1ORSA 3CUPB 3F6LA 3M8OH 4M1GL 3C2AH 5EOCL 5E08L 3JTSB 3FT3B 1A7NH 1D7BA 5EO0A 4F92B 3P30H 1AY1H 5IEHA 2DQUL 5EC2A 4KJWC 3EOAA 3HNTH 3L1EA 1A7QH 4RMVA 1BG9A 1YY8A 5DK2A 1B90A 2CLZA 4ZW7A 2WUCL 1N5AB 4KJPD 3ARED 2JI1A 4PJDE 4UAOB 5DTFB 1IAII 3HE7C 2A9CA 4E9QA 3KEHA 5I0XA 3UC0H 2V17L 4TSBL 1ZEAL 2R15A 3M45A 2Y23A 4PJAB 2IV8A 4DGVH 1S78D 5EU4A 2K3HA 2X70B 4MA7H 5CD5C 3PHQA 3H4HA 4PRHD 3QYCA 3MV9D 1ZE3C 2I27N 3C6LB 2F2HA 3KPSD 3WS6A 1Z9PA 1JF1A 2NY6B 1MHHA 4IU3A 1NGYB 4D8OA 5LBSH 1WITA 3DPTA 3VCLA 5BUPA 3GUFA 2CJSA 4QRUA 4PWGA 1DQKA 2VRAA 1H8NA 2GYSA 4FYSA 3QJXA 2IAMD 4XCCH 1YG9A 1L4IA 4JKLA 4N2CA 4XBMA 1TZAA 3WTUA 4N0CC 3U9PH 3UTPD 3WO3B 2CBMA 4U7MA 4TOYH 4PJ7B 4U6XB 3QJHA 2C9UA 4J4PD 1MCOH 2XZQL 1MJJB 4KHTL 3WSQH 2WXIA 1CFTA 1S9VA 4HUKB 4M00A 1FAKT 3HZVA 3VGHA 1F8TH 3ZTNH 4KHXH 1DN0B 2YEVB 3TZVC 4ALAH 2P5EA 3QFJE 3QVAA 1WP6A 3OV6A 1U33A 3JVGC 5FYKU 2ZD0A 1GY1A 1KGCE 1RSYA 3UTTE 5C0JA 1QN4A 3BD4A 5E6ZA 2TSBA 4BWWA 3JV4A 2HX9A 4UV4H 3RDTA 1IAIH 4PS8A 5E8PB 5B3SB 1NIFA 1PJ9A 2C3WA 1NIAA 3BXNB 4KO5A 4Z7UE 5DS8A 4I3GA 4FHBD 4QGTA 2N56A 2WXNA 3GSNA 3NIFB 3PDKA 4WO4B 1WT5C 4NNPH 1EIBA 1UACH 3I75A 3L3DB 5D7SH 5F8RC 1SF5A 2J55A 5JTWA 2CKBL 5AW5B 3L3JB 1BF2A 3U4AA 2Z65C 2A38A 5I8OL 2PCXA 1CG9B 3RJOA 2WCGA 5B22A 4N2GA 1WUNT 1FO0B 4UT9L 1GYUA 5D2LA 5C07B 5F3BA 3NK4A 1NIBA 1QSVA 5H35B 4I77H 4N2OA 5ADPH 5E56A 5I6PA 1FRGH 1UCBH 4JS7A 4NYLA 4XN2A 3THML 4NKMB 4X50A 5ETUB 3H9YA 1AACA 5EFIB 4YXLH 3C5JA 1QAWA 2CO1A 2DYPA 2VLKA 2Q8BH 1HDMB 1RVFH 2DOCA 5MI0B 2EVIA 1OPOA 1BWWA 2IQAA 3PGFL 2HKAA 2CLRA 3QQXA 5CLWA 4YZWA 2D3VA 2Z9TA 5SX5H 3BE1L 4CADA 5I1CL 4JO8A 1G5AA 3FO0H 3FONA 4KKPA 4EI5C 3LEYH 3B1TA 3B8SA 4I2XB 4OVUA 4G82A 2G2NA 3KTUA 3O8XB 1QABA 1R5WA 2EACA 1MCJA 3QEUB 5IM7B 3QSKB 1OE3A 1AE6H 2G2RB 1L9RA 2XVLA 2GJ6A 3FU3A 4WI3A 4ZUVB 5E6UB 3FYEB 3S4SG 1S7RA 3OHXB 4IU2B 2HJLA 2X9YA 3MOBH 3OSMA 3V55A 3MJ7B 5EUKB 2ZCHH 1U8QA 4KDWA 3QZWB 2PR9A 1G1KA 2D7NA 1JF6A 5J11C 1DVUA 3NT0A 1W6WA 4JPVL 4DCQA 2ZZUT 2AQPA 4JPQA 3NACL 1YZZA 5FO9B 2NYKA 1B2YA 1BVZA 2KPWA 3U1SL 2XNAB 4L1TA 2G5BA 2NY2C 3NZSA 2GHWB 5FYJL 3JSSA 1WO2A 1ETJA 4EXKA 3WDIA 3EUUA 4JFYB 2H0PA 4ZMYA 3HI1B 1K6QH 3HZKB 3X2QB 2EEBA 3BKJL 2V3DA 4ZXBB 4JO5A 4EUPA 4U33A 2E86A 3MRLB 2VDQB 3F5WA 3TBSB 4ZUSB 4R0LB 4NNXB 2AQQA 3M1OA 1O5PA 1I75A 3V4PL 1I85C 5GS3A 1NGWA 4OLUH 3C8HA 3O2VL 4Q56A 1MFEH 4H1LB 5EZOL 2CRYA 4L1LA 4I9WE 4KBPA 4PRAA 5DYFA 1I8KB 3QUXD 5ESQB 4I18A 4Q9QH 5EU7E 2YA1A 1WBXB 1OP4A 3OKEB 1EEYB 2R59A 3NFSH 1DQMH 3FU5A 3P0VH 4QNPF 4RBPK 2LFEA 5A2LH 3H4FA 4O2EB 1E6OH 5IHLB 5EF1A 1J1OH 4NC2B 4Q97A 5IZ7A 1GIGH 2ARJB 3L5HA 3OXSA 4AI7A 2FGWH 4DPBX 4FN0A 3TNMB 4ZDHB 1AFVH 2DM4A 2R9HC 1KCKA 1T21B 4EXPX 4Y2DA 4OCSH 3D7PA 1KJMA 1U91B 2NCMA 4MAYC 4AGOA 4OFDA 4EVNB 5E8DH 3KWTA 2DEYX 4JFZH 1FVEA 4OKVA 5IBUB 1OTSC 2LR4A 5AW9B 3CZGA 3O45B 4HUVA 4LBEA 2XWTA 3RUGB 3ZO0A 1YUHA 3BZEB 2AXFA 3U7YL 1TSRA 4PVBA 3CXHJ 5DJ6B 2O61B 4JFPB 4Y0GA 5IVZB 1QR1B 1P7KB 2LTQB 3VXMA 2HRGA 5J56B 2VW7A 4WKXA 4A7VA 2NNXA 3C08H 1J8HB 4XT1C 3LV3B 4C4UA 5DLML 5DMKA 3BH9A 2DI8A 1R3KB 3UMTA 1UTDA 3V5DA 1IAOA 2XWEA 4RMQA 3WFBH 5FHBH 2N3JA 2DQFB 3LN5B 1P5UA 5DZOA 1NCWH 4OJEH 1RZ8A 2IQ9H 4LL1A 4NZFA 4KKLD 4U1NA 4X7TB 4XN8A 2VDNH 1OAXH 1PF3A 5MENA 4JN2B 4KTEL 3S36X 4FXGB 1PKQB 5KVDH 2Z93B 3PDDA 4I8OA 4AQ1B 1GW0A 5ANMA 3EG9B 4FTDA 4O51B 3GJEB 5DQJA 5LXGH 1QN5A 2DQ6A 2NMSA 4YDNA 2WANA 5EMYA 2JF1A 2VR3A 4JM4H 4Y9EA 3MRBB 1VIWA 4IS6B 2BW4A 4LK4A 2Y6SC 4FG4A 4G9FB 3VFVB 1WEJH 2AI0L 1VGKA 5TE4L 2C9SA 4PAZA 4QTFA 4G9DA 4PWFA 3WGUB 3A6CL 5T3XE 4M5YH 4WY7L 4QRFA 4X4XA 4KROD 2QHRH 1UZ6E 4E41A 3HFMH 2DIBA 2P80A 1HYRC 4MCYA 4EJYA 3KCWA 3NTCH 1U8OA 4OLWL 3SGEI 1IQWH 4XCFL 5HHVH 5EUOA 2IG2H 4IGBC 4JPKL 1HXMA 2FBJH 3RWDA 4PYGA 5EBLB 4HZLB 3DECA 4LGRB 4F1ZA 3U83A 5DXWA 1OHZA 3WD5L 5I2IB 2DTMH 3U7AA 1JDCA 1OW0C 2KKQA 2HXAA 5L8LB 4P4KD 1LL1A 1MQKL 1AMXA 1L0XA 1NBQA 1MCWM 4WUUA 2MJ7A 2WYTA 3V6FA 4PGCA 4U4IA 5IHUL 1ZLVK 5DURD 4O2CA 1R3IL 4FQJH 5C08A 3NJMA 3SDXA 2V7NA 3G5ZB 3ZE1E 3D39E 2WKOF 1A4JA 2OYPA 4UTBH 5JPMC 1CFBA 4IRSD 5B1AB 4LLYB 1BYNA 1RPUA 3PV6A 1NOAA 4R7DB 3W5MA 4WTQA 2DKCA 4MJ5B 3WKYA 3FMGH 5JHMA 1XV8A 3GLEA 2Q10A 4K73A 3QFJD 4K5OA 3NUKA 4Y1AB 1QSEA 4WNQB 4JDZA 1A0QH 1OO2A 2CGYA 2PXYD 1FZMB 1KGCD 3UTTD 4M3HA 1OF2A 4F7MB 4OLXL 1E9QA 3NSFA 3T04D 1HSBA 4XWOD 4MX7A 1B3JA 1IILE 5D4JA 3SGEH 1NAMB 3RX9A 3MJ9A 3X3FL 1T6WA 4WF7A 5J5EA 3DGDA 1A02N 5G5DA 3ESOA 3ETBF 3VGAC 4MD4A 9CGTA 4AVKA 1S5HB 2Q8AL 2OPCA 4OZFG 1GYAA 1XZWA 2OXHA 1JGVL 4MA1B 5CCKL 1XXFC 1SHSA 5F1IA 4AJYV 5GHWL 3QRLA 2ORBH 3SJVB 3ULUH 5L2KB 5KN5B 5C0NC 2XWBB 4OGYH 1DE4B 1EAQA 2IBZY 4O58H 3S34L 4FQ2H 4YHKL 4KO9A 3KPMA 2HVJB 1EUUA 1CQKA 3O3EB 5E99H 3Q7JA 1IM9A 2W60B 4MQXD 4RGNC 1UJ3C 4M8RA 5ABDE 3CNKA 3GMOB 1IGCH 2WVUA 4R2GC 3CXDH 1CBJA 1YAZA 2B14A 2ED9A 4JQIL 4PJ9C 1VEOA 3SO3B 2VOTA 2VQ1B 2XWDA 4LRNL 1J48A 3BQUA 1UWXH 2H6UA 2VWEE 3KCPA 1KENL 1SEBA 4WJKB 1N64L 5AALA 4OCYH 1NCBL 3QJOA 4U1GC 4A2FA 3SPGA 4OLEA 5GSRB 1JGLL 3DK0A 4LLUA 1D6VL 5E8OB 1J1PL 2YSSB 3S48A 4WIQA 1ZIBA 3KYNA 5CBAB 5EU5B 1EMTH 1PZAA 4B0MB 3EAYA 2HTKC 4XN7A 5AVQB 1BM7A 5CMAB 4YQXH 2CLVA 3NMEA 4G7VH 2DMKA 1JGDB 1A6ZB 4C55A 4K9EH 3CVHB 2NY3B 2DMCA 3FT9A 3R7RA 1KPVA 3FSAA 1HOEA 43CAA 1U8CA 4NPYA 2ZOUA 4Y5YC 3V0WH 1AGDB 2QTVA 1MWAL 5T1KB 3TEWA 3D0AA 5C0EA 1TIUA 4RFOL 2CDGB 1MFCL 1LP9E 4TVSa 5DD6B 3VWJA 3BEVB 2A74A 1RULH 4HSQA 5HHXL 3RU8H 6PCYA 1BQHG 4KX8A 4BZ1A 4NRXA 3TU6A 2D3LA 3K2UH 3GEFA 3MX0A 3RGVD 4YWGH 3GT6A 4ZFOA 2C7UA 4JO1L 3E0GA 1MY5A 2AVFA 1KBGL 4RLDA 2NY1D 1CFVL 2YK1L 3KXFA 3QW9A 1XFPA 4F20A 4N2FA 4OGZA 4P5KB 3VI3E 5D1QC 4FI8A 5F71A 2J8UB 5HGDB 4K94C 2J73A 3APFA 3GSWB 4YHOH 5BRZE 2HN7B 4UIMB 3O4LE 2IOOA 4JKKA 2OMBA 5AAMC 1PJWA 1KLUB 4HLZG 4LASL 5JPNA 1R5IB 2FAUA 2XN9E 5A3ID 1E3XA 1J8SA 5CBEB 1NPNA 3L4TA 3ZGIA 4RAHA 1ETZB 2J5LC 1ZV2A 3IMRA 1U8HA 5DHMC 3MV8D 1NOLA 5FEBA 3RWHB 4GIOA 4KK8C 4L4VB 1TVHA 3BSHA 3PIQA 5DQ9A 1T2XA 1YMME 2FZ3A 3C8DA 3KR3H 1UA6L 4G80B 3HKZA 3MLUH 3O9WB 4JRFA 2ATKA 3VD3A 2MSPA 2ZXDA 1S8DB 3WEMA 3FO9B 2B59A 1LO3L 5I71C 3L16A 2F5AH 2Q7YA 1QEWB 4PV9B 4ZI8A 2G75B 3KPPB 3QR2A 2CBQA 4JFFB 4XH2B 5E5MB 2QLVA 2IF7A 2XQBL 5IVXB 4Q6KA 2CDEA 2LW3A 3LH2H 4BKSC 5CUSH 4F2ME 3ASNB 3K8LA 4JFEA 4AKPA 4OV5B 3VA6A 1U3HB 3MCLH 2FH6A 3ZPDA 3EOTL 2X0UA 2ZSVB 3B9KD 1HILB 4M7ZC 1VERA 4V1DA 2IWEA 3NBNA 2CRMA 1XXDC 3TA3B 1P69B 3KPQB 4NO5A 1TEYA 2JCWA 3WMSA 5IWLA 3MFGB 1CIDA 4U3SA 5IB1A 1WS8A 1TCMA 2DQDL 2VSCA 5LCVH 3PE9A 5D93B 1A47A 4JDVA 5C0AE 4AUJA 25C8L 2BP0B 4X5XB 1AXSB 5KBDA 3ESVF 1GC1H 5DJCB 1PLCA 3D3VE 2X3CA 4EN3B 4DVRL 8FABA 5D7HA 3LB6C 3RURA 2HT4C 3AMLA 3NCEB 4QJ3B 4MQTB 3AY2A 4ERSH 2I69A 4OBSA 1SXNA 4F7TA 4HH8A 1ONQA 4HPOH 2Z31C 4GO9A 3EFFB 2EKSA 3T1FB 5JO5A 1F4XL 5F9DC 1LVEA 3F7YA 1J9QA 1F4AA 1H8OA 3HB3B 4PWHA 2WN2A 1T5WB 1K3ZA 4RAVA 2FE0A 2BSTB 2YRPA 3D0VB 1CF8L 3MROB 4KXBA 3UZVA 4FXKB 1LWYA 3BPCB 4XPHH 2R8SL 3WE6B 2KLRA 4PS4L 3B2UC 4HXAH 1E4WH 1E3FA 1JK9A 3N42F 3RP1A 5C8JA 3IKKA 5T3XD 1KTCA 2PKDA 4OQ1A 3EYVB 4QRRE 3WXWH 2AAAA 2H7WA 3PL6D 1BD2E 2E4TA 4QHUB 1PGRB 4HAKA 2Y36L 4C56A 3QORA 5FCUH 4LO9A 5C6WH 1FIEA 5I1HL 1CT8A 3BKYL 1Q90A 2J4WH 4GSRA 2XWCA 5INDB 4NNYA 3VRLF 2BNQD 1VF5C 3NA9H 4BH7B 4WWKC 5EZIH 1GKOA 4G7QB 2F7QA 3N6YA 3N89A 3O6FC 5AAWA 4LRIC 4U1IA 3RPJA 3PGCB 3ARYA 4W9CC 3PWPE 4PREA 4YX2L 4HGWB 4FFZL 4YSQA 3D39D 4N22A 1X4ZA 1C7SA 4JHZA 1FNGA 3I6LE 1NBVH 5LXVA 2PP7A 4HHAA 3ZOAA 4UNUA 3WIFA 2YUVA 4OTXH 4TN9A 1UOWA 5K1JA 4HETA 2GTWA 3EH5B 1PZBA 2DIEA 4E5XA 2FQFA 3N1MC 5I1KH 3VXSE 3CWSA 1L7TH 3SDAC 5D7LB 4KUCF 1GZQB 3WO4C 3CWAA 3GWJA 2R69L 3MACL 4G6KH 1K85A 1UEMA 3O3UN 1DANU 3CAFA 1BEXA 3SGDI 3TURA 4WW1B 1JHLH 2A6IA 2TSAA 4FD0A 4P5MB 4RGOH 5E2UL 4Q9RH 1XB3A 3GSOB 2JJSA 4XGZA 3H6AA 4J8QA 4KMQA 3AM8A 1WYJA 1ET8A 3RWCB 2YIHA 3OJDA 4H7VA 1DJSA 4X80L 4KTDL 3BAEH 5HYJB 4CGTA 3DRQA 4OLVL 3T65A 1MHPL 1K8IA 2EYSA 1PD1A 3EYQD 4FLQA 4TULH 2VW4A 4QRSB 1TTUA 3NZ8A 2A9NH 3IFLH 1XF4A 4I3RH 1L6XA 5I1HH 1JFQL 1QSFA 4H0HB 1ZLVH 2J6WA 5KUKA 2WXRA 4AYSA 1IGJA 3TO4D 4M1CD 4PJAF 2NX5E 1EO5A 1RP8A 5FA3B 2GTZB 3FH7A 4LCIH 4IRJC 1AKJD 3DVGB 4OCWL 1MREL 4K7PL 4TLSA 1ZA6A 4H0LC 5CSZB 3IRCA 4Z6AT 1DQJA 1RPKA 1V7MH 3QUZB 1B0GB 4HJTA 4MKMA 4AZ8A 2QR0A 1T5KA 4OFVA 3D69A 1WA0X 4L8SA 3RKPA 3N1GC 4J3OF 2ENJA 2XN0A 4NP4H 4P9HH 1FL6B 1TSHA 1VPOH 3U0PA 1UG9A 1ZDSA 3MNVB 1SRDA 4D9QD 4LVEA 4JEGB 3VD9A 3BDYL 4G8EB 3GMPB 4IHBA 2WKOA 5HJ3B 2P5WA 2WSDA 2NR6A 2NT0A 4L8CA 1Q72H 2YARA 1DJXA 1O6SB 1QUNA 1QRNA 5CN3A 4YHYB 4TTGA 1PLAA 2H6OA 2Q1EA 1A1OA 4PJ7F 2P3YA 2HG5B 4ZFFB 5L88L 3LZFH 1JK8B 2QQNL 3MRIB 5IFHH 2ODIA 1A8JH 5H37G 1FFOB 2ESVB 2Y0SA 4HT1L 5AB2A 5IB2A 3UYRL 2UYLA 12E8H 3BN9C 5ECGA 3QEGH 1UWGL 1KIUB 3QIUC 4NP9A 2UY6B 1KCUH 2CUMA 5EO9B 5F44A 2BNRA 3R7QA 5L7XL 3LAFA 2VMDA 1KEGL 3ZDWA 5CJQH 2FO8A 2J43A 4HIHB 4AMXA 2R2EB 2VC2H 3GBNL 3N1FC 3GMNB 2WXJA 3MRDB 4OZFH 4UILH 2Z8WC 4NCDA 4AJWA 1XH0A 3IJSA 3EO0B 5HGAA 5JZ7C 1P4LA 4FJ6A 3ARQA 4O4YH 5CILH 4A7UA 4KRMB 3MBEB 1FZJB 1OGSA 1D5XA 3NIFF 4FQXC 4ATTA 4QY8A 4BZ2A 2ALWA 1CGUA 1E7VA 4L3EA 1QLEL 4YGVA 1XBRA 1NCCL 2EYTA 3Q6GL 5KYXB 2NDGA 2QKSA 5KSAD 3BVDB 3QRBA 2YZ1A 1B0IA 1E43A 2CGRL 3VGFA 5BRZD 4OZHE 4BWTA 3O4LD 2XA8H 2FSDA 4A6YH 4HWUA 3L5IA 3ZYIA 3VE0A 2F53B 3EH4B 4NRZA 3MRPB 2H3XC 5IUSA 3TBTB 1A6UL 4NZRH 1S7VA 1KB9K 1UURA 4GRMA 3P2BA 4OQTA 3V4VL 4EZMA 3CZSA 3VWKA 2J1XA 5JXAL 1EFXB 2CJUH 3GMQB 3T8VA 1A1MA 5JIDA 1GAFL 1KXVC 4LSPL 3B2DC 5AVYB 1YMMD 1KJ2L 4LQFL 4N2NA 4N85A 3IFOA 3PWUB 5KW9H 1ERNA 2AJXL 5FM5M 4BSVA 2K0RA 4K5MA 5L9DH 1OIOA 4XVUC 4Z7VB 4U6VH 3T4YA 3RRQA 4H2CA 5CSBA 3VFPA 2IXQA 3V0EA 1IKFH 4CKQA 4MCZA 3S3BB 4AM0A 4ENED 1CURA 2CK0H 3CLFH 4FXTA 3DV6B 4LLDA 1LO0H 2WLLA 2WINB 5FECA 2QVKA 4N6RA 4XX1E 4AVHA 2ZT9C 1A4KA 3VYPA 1P9MC 4CVZB 1VFOA 4K7PY 1E5AA 2LU7A 1S7UB 3GZOA 3CHQA 2NW2B 2L7JA 3VRJB 3VXPA 5E9DA 4EOWH 2VXVL 3DVNA 7FABH 4PLJC 3REVA 1ZY9A 1S5IL 2Q3ZA 4GRLD 4KPHH 3FCSA 4QRPB 3U46A 1NUGA 1T3FA 5EZLA 3JWOH 3UBXG 5EPCA 2AABL 3ARDA 2DD8L 3U6RB 2AXHA 2BVYA 5GRVL 3VGEA 3DO7B 5C0AD 2OJZH 2VDKL 3DJZA 2DTSA 1A3ZA 1M53A 3QIBB 3O41A 4OJAA 4DKFH 3PAUA 1C08A 4L5FL 1EUVA 1S7WB 3CVCA 3S9DB 3D3VD 2AV1A 2CXGA 2WIMA 3S98A 3P9MA 3G6AA 4HLZH 5BQ7B 3ZKQD 1DQQA 3FQNA 1A4BA 1QYGH 3L2LA 4ROEB 2YEZA 3GNML 2FQGA 4A63A 1KXQA 2AGJL 4R5XA 4WU7A 2WXHA 4MJJA 3UDWC 1KXTA 1I1AD 2H1PH 3ARFD 3FRUB 4XAWH 4PJBF 1CDUA 2UZYA 3BUDA 3WOVA 3CDZB 1UFUA 3S97C 4PJCE 5I76B 2WQVA 3O6KL 4G3YL 4OFIA 1ZWIB 4BZ1L 4MD5B 4E0RA 4PB0H 5LAXB 3T0EE 1EJOH 2I85A 3GTTA 1OARL 3AQDA 4N0UB 3DTUB 4NLHA 4MS6A 4DFHA 4KNQA 4ODSL 2X4NB 1G1YA 3NIGE 4QRRD 4RGMB 1BD2D 2KZ1B 2OL3L 4OLYH 3RVWD 4HAGA 4KQ0A 3EHBD 3HS0C 3MNDA 1L9NA 1OCWH 4UOQA 5EBMB 1JZ2A 4O9HH 2UV3A 4Z95L 2C3VB 2BRRL 5DWPA 4JDTH 4KVNL 2V5SA 4CVUA 2F8IA 4TLUA 1MW0A 5DHYA 3LKRA 5A1AA 3FCGA 3IDMB 3UCRA 5JHBA 1LEIA 4S2SA 1KN4L 3PV7A 2SEBA 1JE6A 1NAKH 5SX4H 5FW8A 3CFCH 4MVBD 1L5GB 3WDJA 2VAJA 2KLTA 1L3WA 1UM6H 4PR5B 4AW7A 4QHKI 3W0WA 2ZP0T 3PWPD 1NCTA 2WVVA 1I7ZA 4M56A 1CLYH 3I6LD 3R4DA 5ESAA 4PRIE 3L48A 3P4NB 4ODXA 3I84A 1DHKA 2R29H 5HDQH 4Z77A 3FN9A 5EF0A 5JYMA 5FKPB 1Z32X 1N59B 3CFDB 1QSZA 2X3BA 5HI3D 5IOKA 4Q58C 2Y7SA 1KEML 4MZ2A 1CU4H 2NY4C 4WSGA 1XIWD 4FX5A 3FO1A 3TO2A 2XJKA 1C7TA 1MFAL 2VUKA 4L5FE 3LRKA 4OFPA 3UO1L 3A6OA 1FN4A 3QDMD 2X2UA 5T1DH 4F7PA 2P8PA 4ZFZA 4MMZC 1XBDA 5HHQB 3BPNB 3FSZA 2FHBA 4IBQA 5BQDA 2XXGA 2H32A 3QCTH 4A6YA 3UJIH 4B27A 1LD9A 4RSVA 5EHFA 1TQWA 2B2XL 4MB1A 4PJIE 4QHLB 3TBWA 4FXLA 1FYTB 2WQUA 3EO9H 3NDZE 3KYOB 3II3A 5DD0L 3DMMB 4Q6IB 1HSAA 1C16A 3X12B 1A6AB 1FO0H 1I7TB 1MI5B 5BOZG 3G5YA 4OB5H 3ILPB 3Q44A 3OKLB 3RY6A 1HYSC 5J3HD 1OAQL 3AAZB 1G0XA 1KGYE 2JIXA 4DJMA 1LK2B 4QHMB 3BZFA 5I16A 3GBEA 5IV2B 4EI5A 1UATA 1QWNA 2C3HA 2OJ1A 1W8EA 2BHFA 4HF5L 4PGBB 3SOBH 2W0FB 2GJPA 2XOTA 3LPOA 3HR5B 1CZ8H 2XICA 3FCUB 3V10A 1QOKA 2HZSA 4PG2A 1YYLL 3RLSA 2FVNA 2OX5B 3H54A 3LPPA 1VESA 3L2NA 1NCDL 4APQA 4YLCA 2FIRT 3H42L 4PJHE 4KDTA 4M6OL 4RRPG 5GRWA 5C0GA 1TJXA 2UZIH 4ANUA 4FOMA 5F7AA 3GI9H 4PJ5E 5I1AB 2NY5H 2NZ9D 2VDPH 1G1CA 1IBGH 1RJZB 1BQHA 1LO4L 3VNYA 1U21A 1ZTMA 4XHJC 2FKMX 3TXAA 4OM1H 1KG0A 3BP6A 5I1DA 5EIIA 3QULB 4NC1C 1WFNA 1ZLEA 5FA4B 3T2LA 4I0PD 1G6RB 1GXEA 1MAMH 2NOEA 2R0ZH 1NC2A 2VSMB 5EU6A 3BESR 1FIGH 2AERT 1YVLA 2L3BA 2KL6A 1A7OL 1WFTA 4URKA 3FK3A 2XYBA 3MREA 3GIZL 2ADIA 4P46B 5E9AA 1RZFL 1JXJA 1CTOA 3KJ6L 2N7AA 4LDCA 5MEOA 4GBXA 4F3FB 4NQSB 2HFGL 3HTLX 1SBSH 2XIDA 3SPVB 4YVUA 1GCYA 4HIXH 1CICD 3SBWA 4GMTL 4XB7A 2IMNA 3HVDA 4K9EC 5B7EA 1YEKL 3M7FB 3U0WL 4HGKC 3T3PB 1S7TB 4HUUB 1N0XL 4GP4B 4S1DC 1V3KA 2E8YA 1NWPA 1D5RA 2APTA 2W9DH 3X11A 5I30L 3AU0A 3RVUD 4U7SA 3HC3H 2HT3D 1N5AA 3LH9A 2F8XC 3PP4L 1PLGL 1WCBA 3MV7E 4HGMA 1GR7A 4N1HB 2OYLA 5GS0H 5IQ7H 2YAMA 2G0LA 4PJAA 4OKDA 4A04A 2P48B 3QXVA 5JHLL 4A37A 4KRPC 1VOKA 4JO4L 1SDYA 3STZA 1GW6A 2X70A 2GKIA 3CPUA 3KG5A 5F6IC 3FF8A 1N68A 3CX5K 5LBGA 1DVQA 4JCMA 4NQDE 5T33H 2OAAA 3C6LA 4JO2L 3QC5X 1BJ1J 2ZONA 4MXWH 5EA0L 1KCWA 4DETA 15C8L 1NGYA 3JV6B 5TQ2H 1ADQH 2IGFH 3V4UL 3CIQA 3DDGA 4XC1L 2GPZA 2QSQA 2ZTBA 3KGSA 1FV1A 1IGTA 5M95B 2G4EA 2V6HA 3C5ZD 4BE6A 1IL1B 2EYRB 1MFUA 1AZBA 2V8LA 4NEHB 1KF9B 2A5UA 4HZAA 5H37H 5I6MA 5J57B 4PJ7A 4LVNB 2VYRE 3D50A 4WWNA 4Q2ZA 4MB4A 1QNZL 4WHYG 5CJ5A 1MJJA 4AVIA 2Q2EB 4HJIA 2WV3A 4JPIB 3NIDE 4YC2B 2AQ3A 3V0FA 4GQRA 2R29A 2KERA 1NMAL 2BVOB 3BT2H 3TN0A 2EUZA 4DKDC 1EUTA 1MW2A 3QZBA 1BZOA 4NXSA 2EDHA 1D2OA 4OFQA 3WELA 2ZF9A 1O9ZA 2J72A 3QUGA 2WWMD 1VA9A 4XPAL 2AJYL 3T0DA 5GRJL 1P6AB 5E8PA 1HL8A 4J2XA 4X2UA 2JKTM 4ZW6A 2RMNA 5B1BB 3HG1B 4N5ED 3CZLA 4UBDC 2NY7L 2HL9A 3GI8H 4WO4A 3N2JA 2MWCA 3EYFA 4M8QB 3L3DA 3UX9B 1EHLH 1SQMA 1I9IH 1JXKA 1T7WA 4K7FB 2EUVA 4EI0A 2O1AA 4N2AA 2J8UF 3L3JA 2Y06H 3EDFA 3RPKA 4ODHH 1CDBA 3UO8B 1CG9A 3VM7A 2VLRB 2ERJC 4LCWD 3QCVH 1FO0A 1JTTA 5C07A 1CL7L 3UAJC 3OKOB 2WZPA 2CJ3A 3S5ZA 5H35A 4OD3L 2AJVH 3DX3A 4BA8A 1TYEB 4GIPD 1AIZA 3E6FB 3L9RB 3TLRA 5A16A 5IB3B 3GINA 3LIUA 4NKMA 5I74B 2RHEA 4DO6A 4PEEA 2EH7H 5ETUA 2Q0ZX 5DJYA 5EFIA 1HINH 5F21B 1PIFA 3PGDB 1HDMA 4RMTA 5KZCD 2EIJB 4OI7A 3FU0A 3RWEB 4XP9L 3EBIA 2A9ML 2H2PC 4WO0A 3WFCL 4X8CA 4MA8H 5CEZH 3BJLA 2FL5A 4XE5B 5KUMA 4AENB 4KI5F 3SDDB 1JSYA 5FHAL 4I1NB 4Z0BH 5I1IL 4MBOA 1Y1DA 5CP7A 2EVHA 4BWUA 3O8XA 5IM7A 2VUOA 3EYUL 2G2RA 2FJGB 3OKMB 4ZUVA 4IU2A 3F85A 2VIRB 3G5XB 2GVYA 3MJ7A 5F7BA 3RNQB 4Z7NE 3GMRB 3QZWA 4IDLA 3E6HB 4OT1L 3DOSA 2BIQA 1F5WA 4W9IC 1BFSA 5D5ME 2VR4A 4YHNB 3QFGA 2A4CA 2BVTA 5FO9A 3ZZSA 4XVJH 1KO9A 3FB7A 4ONGL 3VJ6B 3HLKA 2TAAA 3ARGD 5DZJA 4AV4A 4KU1A 4W9KC 2G3NA 2MEJB 4Y7OC 4HPYL 3U79A 3UERA 1QPXA 2YD8A 4LKXB 3FQ4A 1LEGB 1I7RB 2B20A 3N9GL 1O6TA 2KDGA 3HZKA 5HVHB 2ZUWA 2VSDA 1QKZL 4NQEE 4ZXBA 2NVMA 5KYYB 4ZFGL 2OP4H 3MRLA 4LARH 3TBSA 3O0RH 4ZUSA 4NNXA 4ZODA 5BV7B 1BMWA 1ID5I 2DL2A 3DUSB 4WENB 3QPXL 4IM8A 4HWEH 5KBKA 4H1LA 1NAMH 4NOFA 2G60L 1DBJL 3KNBA 2GEQA 5IQ9B 1I8KA 3ESUF 5ESQA 3BUPA 4OCRL 4P4RB 4KZEH 2XV6B 1WBXA 3OKEA 1EEYA 4PJBA 1F4YH 1FAIH 3C2SA 4TNEA 4O2EA 1UJ3A 5I75C 2ARJA 4LOEA 1UASA 5T5NG 4K23H 4DN4H 1E5BA 3JZ7A 3SGJC 2Y6TE 4FLOA 3GXNA 1EJFA 1FZKB 3K5SA 2ICWB 1T21A 3K91A 1TQUA 3B37A 3VWJD 4AIOA 1BYPA 3B34A 3NZUA 1ADQA 1U91A 3UTOA 3H56A 4YDIL 5HDLA 4EVNA 1H3VA 3UC2A 4ICWA 4CJ1A 5FCSH 4WI0B 2D7QA 2MQCA 3O45A 5FO7B 3TVMC 3H9SE 1YEEL 1LO2H 5IMKB 3OKYA 3BZEA 3I9IA 4NZTL 4ORGA 1A64A 2RCSH 4PJ8D 5DJ6A 4KOBA 4JFPA 3T2NH 2O61A 2Z34A 5IVZA 1DVYA 1QR1A 1P7KA 4LP4A 2V37A 1A3LL 3L1OH 1XO8A 5LG6A 3B3BA 3K6OA 1JD9A 1UT9A 3B2XA 4PJ5D 1UXWB 3M1BB 2BXYA 4WI8A 2RGSA 2VQTA 5D1ZD 5E95B 4Y16D 5CEXB 4XN1A 1V3JA 4RA0C 1HFUA 1HNGA 1BLNB 4N2IA 4XP4L 4PN6A 4JMXA 4K5PA 3CVHH 4WHDA 1FFQA 3EO1B 3M86A 4NKQB 3P02A 4UB0L 5F96H 2X05A 2DQFA 2EDWA 1HL5A 4HIJB 3ZDXE 1IE5A 3US0A 2VW6A 4L3AA 3TIEB 1F97A 3NCCB 1IT9L 4JN2A 3WY3A 1DDHB 4A7SA 2W80C 3JQOB 1P5VB 2C9VA 1QI3A 5E94B 3FSOA 4FXGA 1PKQA 4YS4A 3ETSA 1V10A 3EBAA 2OTPA 1WHPA 3GO1H 3DJRA 4AG4L 3EG9A 4O51A 3GJEA 4JRXB 4R84A 4Z1PA 3UJTH 4XVTL 5AZ2L 2VGLM 2XTJC 1LWHA 4HA1A 4U6HB 5D70H 5CGMA 2L8AA 5DGQA 4M3JA 2OK0H 5J9PA 4GW1B 5KJRL 4G9FA 3QUYD 3VFVA 4CA4A 2OMZB 2IVFC 1K2DB 2VXSH 2QHLA 1NM9A 3MSPA 4WK0B 3NJVA 1PYWB 3NPSC 3WY4A 3OAZK 3U25A 5EOQL 3RFZC 1OOWA 1OGTB 2MCPH 5EZJB 1S6NA 2O26U 4Y1TA 1ZKAA 1TITA 1D5MB 3PJSB 3K81A 4D3CL 4XVSH 5KTEH 3ARBB 1ZAGA 2LHAA 5E00B 5D1XB 3P3SA 3DX4A 2ALAA 2DAVA 1S9WB 4G71B 4W1TA 1KELH 1XGUB 1GGIH 1VZHA 4Y4FC 5EBLA 1YDPA 4HZLA 4XPFH 2DBLL 1J9CT 2ZYSA 1JHTB 3N44B 4HG4K 4NQDD 5I2IA 2XKUA 1EV2E 3CQFA 3HKFA 1K4DB 3ULSB 1EHNA 3VFUB 3OZ9H 3J8F7 2GIYA 5MERB 5CFHA 5FK9B 2ENSA 5GGQL 1XH2A 2PPCA 3TESA 3TT1L 2V2WB 3VVWA 3QIWB 5DMGD 1MIEL 5DVMA 3SCMB 2FECI 2CHXA 4M1DH 1ZHBA 4YBQC 4NN7C 5HBBA 2QADB 4NX0A 5AW4B 1F56A 4KC3B 2EH8L 1FORL 4JG5A 4YZFF 3S35L 3SE9L 3L5XH 3OZKA 4QD2E 3MKKA 1GGBL 3NN8B 5DEFB 4Y8AA 5C3TA 2QR1A 4I8DA 1G4MA 4LLYA 1VLXA 2B5IB 4AYBA 1SZNA 4R7DA 3AREB 4MJ5A 4U3XA 3ROLB 4LVHC 3ULVC 35C8L 1F90H 1ZGLB 3EAKA 2BK8A 1H9VA 4WNQA 5DEZA 1FZMA 3HI5H 3VFGH 3B9VA 4N0YH 2EECA 4F7MA 1A3QA 1F6AB 2Z1PA 5CINL 3ZK0A 2DBJA 3VXUE 4FTVB 2JKJA 5HPMB 5JYLA 1UD5A 3MV9B 4KJQC 3IDYC 5B7FA 2NSMA 1X9RA 3KPSB 1AS7A 1XMEB 4PIRF 4RODB 3EDKA 4CRPA 4ILDA 2VITB 5T5NF 4GKSA 1TYRA 1S5HA 2J1WA 3QXUA 2MCAA 3FQ1A 2G5UA 4N2KA 3ZE0F 2W81C 2IAMB 3WYRA 2EABA 2WYHA 3GK8L 2UWEE 3SJVA 5L2KA 4CBZA 3JWDH 2DQHH 2XWBA 1BIIB 1DE4A 2ZNXA 3JWOC 1HT6A 1G7HA 2W60A 4YHMH 3T0BA 1AMYA 3WKPA 4Q9CA 1IE4A 3GMOA 2CBTA 2E6QA 2RB8A 2VQ1A 4JR9L 3AY4A 4PJXE 3VDBA 1HL4A 3QRGL 3S36L 1TEGA 4NHCL 3V52L 1JPSH 2D0GA 4Z7VF 4TVPH 3T3MF 3SHSA 3BUIA 5GSRA 2V9QA 2GC7C 4LOUC 5E8OA 3IU3B 2YSSA 4HX1A 2WLZA 4WHYH 5CBAA 3CIAA 5JXEC 5BOPA 1R0AH 5CMAA 1EGJL 4ZD3H 2Y1ZA 3W2DH 1BZ8A 2IFFH 1OB1B 2XA3A 1A6ZA 3D85D 3CVHA 2PYFB 5BRQA 3UTSE 1EEUA 1TJHH 1BF5A 5ITBL 3HS8A 5FKAB 4O02B 4CSPA 1AGDA 1XAUA 2XSKA 5T1KA 4ZOEA 4JM2D 3VRIA 3DSFH 3QNFA 2CDGA 3CE1A 2QPEB 5TPWH 1IC4H 3DROB 1MCHA 1ZSDA 2ITCB 5C0BE 3QA3B 5DD6A 3BEVA 1WQAA 5AW7B 1AOHA 3H0TB 2HH0H 4ONFH 1XL4A 1E3ZA 1YMHB 4IOFC 3QJUB 1CR9H 1JPFB 5GRYA 1M6UA 5ICXB 1KPRB 4WFGE 4JHAL 2WPGA 1NCJA 5IB4A 3A0OA 5ESVB 2OSYA 4L2YA 3D06A 4NQED 2CHNA 4P5KA 5DZLA 1HCYA 3L3GB 4AVJA 4AW4A 3MA9H 2J8UA 5HGDA 1QQDB 3GSWA 2P8LB 2HN7A 5I1JH 4QIRA 4UIMA 1GGYA 2MQGA 5F3HB 4DK3A 5E6IC 4JY6B 1A2YB 1UD3A 1HHIB 4J27A 3BKCH 3GM0A 4HCRH 1NGPL 1R5IA 1TXKA 4P99A 3JZYA 5CBEA 5AVRB 2XUWA 5A2KH 1FGNH 4TTDD 1ETZA 3O6LL 4WUKH 2JTDA 1OPGH 1T1YB 3RWHA 3OC8A 4L4VA 3SE3A 1MRFL 3I50H 3MRNB 1NH2A 1ZHKB 4G80A 4RRPA 1AO7E 2BNRD 3J7HA 3O9WA 3VA2C 1QW8A 1YPZE 1S8DA 2FX8H 1YEDA 3FO9A 5GXBB 5KJ4A 4YSAA 3OF6D 2D2OA 1YEIL 2G75A 3KPPA 4M62H 4JFXB 5D71L 5B38B 4JFFA 1OF0A 4XH2A 5E5MA 4KKRA 1ZVNA 3BH8B 3HHSB 1XDTT 4GW4B 2V5RA 2WHVA 3HG0A 1ZXKA 2GSGB 1BPLB 3H9SD 3LRHA 4NRYB 4G43B 1X7TA 5FW7A 4OV5A 1E5CA 4P5TC 1R17A 1U3HA 1RZKC 2FJHB 2VDMB 4YSOA 1UKTA 4GSDL 2PR4H 3L4YA 3PREA 2AEPL 2YKLH 2X1QA 2PP8A 3FTXA 3D4VA 2J7LA 1TFHA 1RZPA 1TGHA 2AV7B 3TA3A 3QUXB 1BQLH 1SJHB 4HUWB 4XPBH 4ZMQA 1B0RA 3ZL4L 4OIIL 3DJ9A 3KDMB 3BPOB 1KB5B 3QFDB 1H3PL 4OGAD 2WXGA 2AEOA 3FCTA 4TL5A 4V2BA 3S5LA 2BP0A 4X5XA 4M4RA 5JDSB 4OJFH 4BCXA 4QGYA 5DJCA 5D2NC 4X4MA 2JELL 2AK1H 3GHBL 1TYJA 2OLDA 3PABB 3BWSA 2WQRA 1NKGA 1FH5H 4FQ1L 3MOAH 2FEEI 2VDOB 4BK4A 3T1FA 1KFIA 2X4PB 4QJ4B 2APXA 3LZRA 2HLAB 4X4KA 3CC1A 1ZLSH 5IROA 1CLOL 1T5WA 1J9TA 2WNKA 1ZT4B 2BSTA 2FIKB 3C60A 3D0VA 4OIAA 4FXKA 3BPCA 4MJIE 2YEQA 4C4BA 2RH0A 3WE6A 1T6BX 2O5NA 2OMTB 4ZTPL 4UI2A 4QEGA 5IF0B 4JPWH 5L6YL 2CKNA 3W38A 3ZKXB 3VSQA 2DZEA 4Y4KC 3EYVA 2F5BH 5DDHB 1OE2A 1KCSH 1F58L 5GZOA 4QHUA 4YHLL 2WP3T 5GZNA 4OZIB 3IU4L 4CUCA 2YPVH 4NUGH 4LDOB 3BUYB 3FAXA 3WEOA 6FABL 4DEPB 5HYIA 2X38A 5JLZA 4KJWD 4BH7A 4KZDL 4GXVH 4R0LC 1YQVH 1KCRH 2IDFA 2VMCA 4P07A 4FNUA 1P1VA 1DVFC 3HE7D 4FYTA 3PGCA 1AIFB 1RU9H 3NZHL 1ZLDA 5KANG 3R8BB 1RFDL 1XAKA 2CAKA 2DQEL 4HGWA 3S6CA 1M2VB 3CZKA 1OP3K 1C1EL 3RY4A 5CD5D 3E38A 1SEQL 1F3DJ 1LTXA 4GUQA 1OCZB 1W8OA 4J2QA 5LKNA 1B0WA 1XGTA 2OMVA 1VCBC 4MNGB 1I3UA 3LS4L 4ZAKA 1RM1A 1N39A 2HB0A 3RGHA 2PETA 1OY3B 1KFGA 1UA3A 1TQCC 3JYBA 3P0GB 4C58B 5BCAA 2DLIA 2OR8A 5LVEA 5D7LA 4ONOA 4Y5VB 2VERA 1XF2B 1GZQA 3OAZH 1N3CA 1QVOB 3CZJA 3ZLQC 1L0PA 3OM3B 4X7CC 4WW1A 1IGYB 3JXAA 4N0CD 3GSOA 4KY1H 2FGTA 3VXUD 2XETA 4CNIB 3EJRA 1T03L 5ICYB 1RUML 4EO5A 2HPTA 2A1WH 4GKZB 4R26L 3POCA 4IMLB 4P4KB 2D4DA 2LTQC 4MHHG 2VJ8A 3IGLA 3QUML 2NTSP 5HYJA 3MJ8A 3TZVD 5DJ8B 3JVFC 2AQTA 4QRSA 5DURB 3T3PF 4M48H 1PEZA 3PG2A 2ZAGA 3APMA 2VXTH 4XMXA 5JQ6L 1UL7A 4EPSA 3VXTB 3GHEL 3WFDH 1S7XB 3ILQC 1FE8H 2HAZA 3BWUC 1NBZB 5I18H 3DIFB 1JGIA 1LWJA 5TQ0L 3MPCA 4IRSB 3STBA 4K94L 1PY9A 1CYXA 1RXLA 4XNZB 2GTZA 2OQJB 5FYLH 3DVGA 3IDXL 2OBGA 1KFQA 1EANA 1ICTA 1PNDA 1FLRH 3QFJB 4N2LA 3VD5A 4UDUA 1DYZA 3CH1B 3QUZA 4BJLA 2PXYB 1B0GA 1E4KC 1M3JA 3GS4A 3PWLB 2RQEA 1SDDB 3SE6A 3UTTB 1KYOJ 3TT3L 4IBUA 1KGXA 5CM1A 1HESA 1XVSA 5DEGA 2VL4A 3PJNA 3BSZH 1WIUA 1X3DA 3MNVA 5LQBL 4JZJC 3WEAA 1JF5A 1RUPH 4Z7UB 2O5ZL 5FOJA 4G8EA 2AJUL 4RGNE 1SXZA 4DQOL 3GMPA 3HNSH 1QFUH 4TRPL 4Z7IA 4K71B 5HJ3A 1I9EA 3VH8B 1RZJH 4P59L 1O6SA 1GPOL 4XO9A 4IJ3B 3RWGB 2BS8A 2HG5A 5H2BB 3FT4B 3MRJA 3FRPB 3UTSD 2BIMA 1U95B 4ZFFA 3UGUA 4J3TA 3VTTA 2ZCKH 1JK8A 3UBGA 3MRIA 3P2TA 1INEH 4X9YA 3QHFH 1FFOA 2ESVA 2GCYB 2K8QA 4X4YA 5K9OB 3TWCL 1KIUA 1XGYH 2AJSH 2BHZA 4EI5D 5EO9A 1LLAA 2QT6A 1BBJB 3U0TA 2MKWA 3CGTA 3B9AA 4N8CL 3G9VA 5J0BA 4HIHA 2JCCF 2H26A 3G6DH 4LCCB 3V0VB 4NBYB 2R2EA 3IJYB 1ED3B 1NJ9B 5CEYB 3MRDA 3WJJC 1SF3A 1IC5L 3CK0H 3EO0A 2Y9RT 3WIHH 4QTIH 3INUH 1U8LA 4PIBA 5HGBB 3RVVC 2F74A 4WFGD 3RZWA 4M7KL 4BQ8A 4UIKL 3SDYH 4FRWA 2B7DT 3F6IA 4AEHH 4BFNA 5KYXA 1P4BL 3PHOB 1SGKA 2BOLA 4HKBA 2FO4B 3DIDA 4PTUB 3Q5YA 1DANT 2IPTH 1KGWA 2X88A 2XIIA 4R7XA 4CAGA 2F53A 4F5CA 7PAZA 2NY2D 3KLQA 3MRPA 5JHDB 2YLKA 4KNTA 1QFWL 5D72H 4Z7OE 3O3BB 3LVTA 5F1KC 4AE1A 2R51A 4KUCD 5EWIL 1EFXA 1KIRB 3GMQA 5AYTA 3FXIC 2RALA 4D2NA 5D1QE 5E2WH 3BGAA 2KYIA 2P26A 1GHFL 3PWUA 2H41A 1AO7D 3A4DA 2JV6A 2DKUA 3V2AR 4AH2B 3RL2A 4KK6C 4Z7VA 3MCG1 1D5ZA 2BSRB 4OLZL 1UEYA 3MLPA 3BO8B 3H9HB 1OGPA 3NH7H 4XNXL 3RGVB 4AXWB 3ARVA 1RIUL 3IDIA 1YEJL 5BVPL 1MSPA 4ZMLA 3DV6A 1MRCL 2NY1B 2WINA 1OWWA 4RMBA 4HOWA 4ZX6A 3T4AB 3ILDA 2HKPA 3T0WA 4FNTA 4RIRB 3FN3A 1WLHA 5IK3A 3B9DA 2JLLA 4GAYB 1QTYT 2O72A 2R9HD 4PJ6A 2HX7A 3DIVA 3MRCB 1S7UA 4OJCA 2NW2A 1MJUH 3H3BC 4XX5A 3V7AE 1PCMX 5JIQA 4MAYD 3DX2A 1A7NL 4HC1H 4QRPA 4G8GE 2OZNA 3U6RA 3NYKA 1Q0YH 3HNTL 5DUBB 5J8OA 3MV8B 2D7PA 5I1GH 3QIBA 1G6RH 2XFXB 1PSKL 3MJ6A 1S7WA 4O5LH 5D6DC 5IBLC 4KROC 5FLUA 4WWPA 4H5SB 5DD5H 4ZQKB 4D9LL 3HPLB 2V2TB 5EEUA 5BQ7A 4B9JA 1CLZH 2DS4A 1T1ZB 4KX9A 1AHKA 2QELA 1AGBB 3X1BA 3H3PL 3BPLB 5KL0A 5I73B 3IJEA 5AYUH 5AVUB 3FRUA 3TV8A 3BVUA 4OFYA 5LBSL 3W9EB 4H8HA 4UDTB 3VMOA 1J1XL 1PD0A 4FGMA 4F9LA 5TH2B 2VLKE 1M56B 4FZ8H 3CDZA 5I76A 3F2LA 4W4OA 3B9KB 4HIEB 1K8DA 1F4WL 3PXLA 5LHDA 5LAXA 1JWUA 1AP2B 4N0UA 2B0SH 1S9XA 3C75A 1E2VA 2X4NA 4JFTA 1XMWA 4DGYH 3SZ6A 1VDGA 2GW5A 1M71B 5F7DB 1FHGA 3G04B 4EMZA 1YEFH 4IIQB 2GJ6E 5EBMA 3BSZA 5JMVD 4KHXL 3Q3GA 2C3VA 2VAAA 2QGBA 2G3XA 2Y6SD 3M46A 1AGFB 3HG4A 4DTGH 1LO5B 3MLRL 1HH9B 4BINA 2OSXA 1SJVA 4PYHA 5I6XB 3MLYH 5GRUH 4FHKA 3GSRA 4GQQA 4LEEA 1ACYL 3TH4T 1L5GA 3KGUA 4PR5A 1MCWW 3X14B 2N1TE 4NGHL 3QG7L 3IJ7A 3AXLB 1SLVA 5IQNA 4NNPL 3V4PB 4IGBD 3BVTA 4XO3A 3T6WA 3ULXA 3U7WL 2DQTH 4F7CB 1C9SA 4ZK8A 1RK1A 1F11B 4W6WB 2ZUUA 2ZYIA 1TQBC 1HHKB 1JXGA 3TEYA 5E4EB 1R5VB 5BZWB 5FKPA 3CFDA 5D96B 5KVGH 2LAAA 4KVCL 4P8QA 3PL6B 4GLRI 2Z7ZA 4I77L 3NCFB 5KSBB 3QK0A 1LMIA 1UD6A 3OWEA 3VG0L 4BM7A 1FRGL 3BHBB 3FB6B 4BK8A 2APWA 2DPKA 3RFRA 5B3JE 1F6LL 4E9TA 2BNQB 4WGVB 1N19A 2DM2A 1LILA 2HG0A 4KZCA 2Q8BL 3A67L 4M5TA 4NZDA 4PSRA 2HCZX 2EXYC 1EDYA 4QHLA 1TJGH 5BS0E 2DQIH 3APCA 3IDUA 3MJWA 1E28A 5TGBB 2HKFL 2QZ5A 3LEYL 3KYOA 5GGRY 4Q6IA 3X12A 1A6AA 1I7TA 1MI5A 2CR0A 4DN3L 4KKAC 3ILPA 3ZE1B 2KLSA 3OLEA 3OKLA 2C26A 1A4AA 5D93C 3ENOC 4FYRA 2DQCH 5PAZA 2ZOKB 3AAZA 2CO7B 3MOBL 1LK2A 1TTGA 4QHMA 4OF8A 5AOLA 2ZCHL 3EDJA 5IV2A 4M93C 3IE9A 4M9PA 4UM8A 4KAQH 1OP3H 1F4HA 3CBJB 3LTVA 4PGBA 3N44F 3EJZC 4G42A 2HWZH 4E9RA 2W0FA 3U9WA 3HR5A 4JRYA 4L4JA 5GGVL 3LJ3A 4IEFB 1Q9KB 1UM5L 2OX5A 3GXIA 4FCHA 4DUVA 3DV4B 1W72H 2WYIA 2WXLA 1I8UA 1CGYA 3Q8EA 1KDJA 4HBQA 3W37A 3P73B 4JG0H 2R7EB 5C0ND 4Q4IA 5HY9B 1OT2A 4U4BA 3WNOA 4F8QA 1NEZB 3TFKC 1A7PH 1K6QL 4H13C 4RGND 4LSDA 5IMLB 1FVCB 4LLWB 4R2GD 4PJ9D 4A2EA 1G5GA 2BERA 3QULA 2E27L 4EQ2A 5AG8A 4UV7L 4KK9C 5FA4A 4YLBA 1TT6A 3EFDL 3UYOD 1X5KA 2FHCA 1A9BA 3MCKB 1B2WH 2F58L 3PQYB 3OKDB 3T2OA 2B39A 1CN4A 1IU1A 4HMDA 4MAUL 1UH4A 3TO4B 3KJ4B 3KAAA 3HMXL 1ZHNB 1YEHH 1M6OB 2HTKD 4AYMC 2GJZB 3G5VA 1VOLB 3DRTB 1AKJB 3H9ZA 4ZSOE 5B39B 1IBYA 4H8UA 4TSCH 4I1RA 3SPVA 4TUKH 3CVIL 5HHME 2XTLA 2OMXA 1C8PA 4E41E 1AQHA 5BV7H 3CFNA 1HXKA 3KDPB 2JK5B 1XH3A 4XN9A 1S7TA 5TE6H 4HUUA 3TPUB 1P2CB 1UVQB 4MJ2A 5CAYB 1NFDF 3SOTA 2G9KA 3APDA 4X6CB 4WV1C 3PWJA 5TF0A 1WFIA 2YA2A 4TNVF 3WTYA 4FNPA 3ARPA 4FI7A 4N3TA 4XPTH 3T0VA 5L8JB 1SY6H 4WNJA 1LEKB 5ABAA 4JM0A 3HC0B 2BDNL 3X17A 3TVMA 1SOKA 1TVBB 5DC9B 3MXWH 4WCYH 2JOIA 5IW6A 2BZCA 4YK4B 4XMZA 5D1QD 5J6HB 1KJ3L 3HHRB 5GJTL 1WAAA 4R3SA 3JV6A 3ERXA 2ZX5A 3OC5A 1LP9B 1FFPA 5DLLA 2EVFA 1W2KT 1GGCH 5F8QC 1N7MH 1XR8B 2OSLB 3WUWG 1A1NB 1AJ7H 1KIQA 1OAXL 2HRPH 3UJJH 1IL1A 4Y4HC 2EYRA 1U3ZA 3GKZA 3AW5A 2WKLA 3CFBB 1S9KC 3U9UB 2FATH 3LS5H 5ID1B 1A4CA 2VTFA 3PMGA 3CFIC 4KK8D 1KBPA 2WAQA 4HWBL 3VI3B 3P4LA 3IFNL 2WOBA 5KSAB 2HLFC 4PJEE 5B3NA 4CMMB 4XBGA 4Y2OB 5DGRA 3O4LB 4YIQB 2GJJA 5DRXB 3OLDA 1PX4A 2WO2B 1HVXA 1L9SA 2JQZA 2XQYA 3MLSL 5EN3A 4R8WL 2XY2A 4LF3B 3ZZQA 1WEJL 4G8GD 4JQXC 1JDDA 4D9RE 3PDOB 1G1OA 5HSFA 1BVLA 4ZS6C 3CN3A 5AD0B 1PTZA 2J56A 4M5YL 3I3EA 3N55A 5D7JC 1HE7A 2QHRL 1M05A 2Z6FA 1QNEA 3HG1A 3QDGE 1YMMB 3CHOA 2E7DA 2J8HA 5GGSY 4LSQL 1UM4L 5ERWB 1IQWL 3NCWA 4M8QA 4KKQA 2M2DA 4UMSA 1EA9C 1Z5LB 4K7FA 2IG2L 2A73B 3LPFA 4TSAH 3LNIA 2J71A 3CZFA 1ORSB 2XX1A 4GKOA 1KUMA 3CQQA 4RISL 4UTAH 3BRDA 1MRDL 4ATWA 4OAWB 3LRLA 3OKOA 3BWUF 3E8VA 4OCLC 1FBIH 1H5BB 4Y19A 5FUZL 2CLZB 3E6FA 1BVKB 1BVNP 1KCLA 1DQDL 5TE7L 5IB3A 4IOSD 3LB6D 2HT4D 4OCNC 2EE3A 2RIKA 1CVSC 3ENCA 4XP6H 4CN1A 4GRLB 4XWGL 3TF4A 3RWEA 2Z31D 4IKKA 2AKRB 4UTBL 3CU1A 2VDLH 3PHQB 3SSGA 4BFKA 3GMMB 4DNLA 4AENA 1MWAB 4NFBA 3DBXA 2PO6C 3LMJH 4U0QB 4IU3B 2AAVA 1E65A 3KE0A 4LSSH 5LUMA 1TTBA 2EDYA 5FR3A 3D3VB 3VCLB 5DMIL 2X1OA 3BX7C 4F15C 1MY7A 1V55B 1UT2A 4KXAA 1VJSA 3CHSA 3S2AA 4WQOA 3OKMA 3QJSB 4J3SA 4OY9A 2VIRA 3G5XA 3M6DA 3RNQA 3GMRA 4X5WB 1XSKA 5IJVB 3E6HA 3I9GH 1A6VH 3U4BH 1JPST 1I8IB 1PNCA 5J06A 1I1AB 3HUJE 4IBVA 3ARFB 3QYNA 4YHNA 4YPGB 1Z5HA 3D0LB 4PJFE 4XC3L 1TTRA 2DLFL 1I9JH 3DX6B 1S9VB 4MMXC 3CZNA 2P5PA 1A7RL 4WI4A 4PJGF 3VH8G 1P5DX 4WWKD 4UQ2A 3WN5B 4LKXA 1LEGA 1I7RA 3O6FD 2Z3FA 4QRRB 1MPAL 2MZ8A 4FQ2L 3FRPG 4H40A 3JV4B 4XMPL 5KYYA 5C0RH 4HKZA 4EJZA 5C9KA 3EHBB 5DS8B 3DUSA 4JN1H 4HOMA 5C09E 1THAA 1HHJB 3DLQR 3VO0A 2N0KA 3QQNA 5IJBC 2KZBA 5IQ9A 2J2ZA 1WUZA 3ZUNC 3DTXB 3KL3A 4P4RA 1AHMA 1C8QA 5IREA 2X9WA 2OULB 4QMEA 4OCYL 2YD6A 4KQ4H 1CUOA 2VDRL 3IB4A 4IBYA 1SY6A 3RZCC 5BS0D 3BRGC 1XCTB 3SDAD 1QLFB 4XMVA 3P0YL 5D2LB 3N91A 1EMTL 3VD1A 4K3DH 3VFTA 3PWPB 4GUPB 2K6ZA 3I74A 4P2RE 5EORH 3LQAL 4BFEA 5JIIA 1DBKH 1P4IL 3KPLA 1JYWA 3DURA 4K9EL 3KZ8A 1ND0A 5CJXC 3K2IA 4PY7A 3S3PA 1HIML 5D4IA 4WI0A 5T5FA 2Y2TA 3EJTA 2IWFA 3CPLB 2K3TA 2IQAB 5IMKA 2HFEB 4V1DE 2HT2C 3CN0A 1XIWB 2IBZX 4M3KB 5DA0B 5FYKL 1W80A 4QG5A 3RU8L 3EGXA 1DUYB 2C1PB 4FNSA 2XHIA 2PUQT 3QDMB 4BFRA 2QFPA 1DLHB 4BSWA 1R5WB 4YWGL 3M1BA 1PEWA 3KPRA 3TCTA 1YNKH 4ZPVB 1ZJBA 2WWKO 4LEBA 4B9IA 4LHJB 5CEXA 2JTYA 1I9RL 3EO1A 1KY6A 3DHUA 4IRJD 5G55A 5ALCH 4DO5A 4NQCA 2CUHA 5ALBH 3L4WA 4O02H 1DP0A 4OCMC 1UHVA 2H9GB 2Y4SA 1IGIH 4OJDH 3T3ME 3TIEA 5I1EL 3GTVA 4PJDF 1DDHA 2G5BB 3OMZA 4RGMC 4YE4L 1P5VA 1ZTXL 2FJSA 1ASQA 4GQ9L 2OMUB 4XNMA 1ZS8B 3ZT7A 3ULUE 4X5PA 2XVBA 3KW8A 4XOEA 3V0AC 4JRXA 4HSAC 4KXZH 2XX0A 4FNRA 4U6HA 2WQ8A 5JIHA 4EUPB 4AL8H 4UTAA 2A0LC 4XNUL 3DGCR 4K2UL 4GW1A 4NO0D 4WEEA 5HHMD 5MP6H 2I9TB 5CJ8A 5C6TH 3JWNG 1ET5A 2AHIA 2NOFA 2OMZA 1G9NC 1TZHA 3RX8A 1V27A 4RZKA 4HJJL 4PRAB 3ZHDA 1PVSA 1OAYH 3HRZB 1PYWA 1TOXA 3BN9D 3QIUD 1INDH 1E6JH 1DJHA 3T0XA 1I8LC 2IBBA 1NGMA 5EZJA 1HQ4B 1OXYA 1K72A 3NPZB 4HK0B 1VFMA 3EYSH 4AMKL 1D5MA 1PS3A 3PJSA 2OTWB 4JBSA 3ARBA 3D9AL 2JKIS 5BMPA 5E00A 5D1XA 5ACZA 1S9WA 5JZ7D 1DSWA 1X9LA 1XGUA 4GOSA 4MDJB 1SYVB 1MCFA 1NGZA 4I0PB 4FQXD 1JHTA 3OSEA 5DU7A 3QNYB 2DWXA 1UH2A 3UL4A 4P5TA 4ANXA 3CWUA 1JFHA 5LCVL 1K4DA 4N87A 3VFUA 2NLJA 3AGVA 5MERA 5FK9A 3GSQA 2XWTB 5TDNB 4NKIH 2R56H 3FTYA 3OMNB 2V2WA 1YUHB 4H4NA 3QIWA 4CC4C 3DPUA 1I3RA 4MCMA 2MTPA 2DWTA 4Z7UF 5I9QC 2NRDA 4YHZH 2R23B 1CICB 2GK2A 4NM4H 2V9JA 2VDMH 4Z7QB 2BJML 3FUKA 3B7SA 3NN8A 5DEFA 3ZTJG 4JCLA 3C04A 3P69A 1KN2H 2ADJB 3KM2A 5IP4A 3Q43A 1N6QH 1ZT1B 2V5MA 1QBLL 3AREA 3PFQA 5D2NA 3ROLA 1XF5B 4XVUD 1INQB 1ZGLA 2BNUB 5K9QI 2J8OA 5E5RB 3HJEA 1I7UA 3ZYZA 3L9BA 2FGZA 1KB5H 2PWFA 1F6AA 5HDOA 1CK0H 2VM4A 1E4WL 4D9RD 4MRBA 5AVVB 3QAZB 3BAYA 4EQ3A 2GAZB 5A2JH 3GSUA 4PRHA 3LKNB 3WE1A 1ZTXE 3MV9A 1XSJA 3KPSA 1SXAA 4HFUL 4DESA 4AYFB 3QJFB 3QDHA 3D25B 3QDGD 3AROA 3I3DA 4X7EC 5CLXA 5ANMB 4WX8A 5DQJB 2NY0C 2FTAA 3DX0A 4NZUL 2CMRL 2EZ0C 2VDOH 5F7HA 4PLJD 4W93A 3AG1B 2J4WL 4MB5A 4F80A 4Z8FL 1A5FL 2IH9A 2IAMA 2Y7LA 3U4EB 5B8CB 4LSUL 4NUMA 3C5ZB 3PLYA 1UT7A 1NFDA 5C0IA 5AW2B 4W9EC 3LXBA 5TK2A 4N90E 2Y2YA 3CMOL 4DOHE 3NA9L 4KJYB 2EKJA 1E9OA 2ZJSL 3QNZA 2LABA 4C83B 3LNGA 3KHQA 4AX3A 4NHUB 1LE9B 3TJPA 1IC1A 4GAGH 3CLEL 4DAGH 4B95C 4J4PA 3UG3A 1DLFL 2DH2A 1E5ZA 3NA5A 4GY4A 4ZUUB 2ADGB 5ADOH 1YJDC 1CFQB 3TJEH 1VKLA 1RL1A 2R0WL 1AXTH 1HXMB 1J9SA 2XN1A 4AOFA 2WLNA 3NP4A 1JUFB 4P46C 2DQJL 4NSKB 5E2TH 5E1HB 1AQKH 1GZHA 5IOPB 2FYYB 3IU3A 4QRQA 1N5YH 1P0SE 4B9ZA 5HVWA 1PZCA 4FFYA 1T5XA 3MYJB 1JWSB 1OB1A 1SBBA 1XGQB 4GMSL 1MJ8H 2LOEA 2PYFA 5JOPE 2FHFA 3ARSA 4YFLF 5DT1L 4P05A 1DBBH 1ZT7B 1KTJA 2R83A 2IALB 4TQEH 1BFVH 1AD0B 5FKAA 4O02A 1JV5B 3RIFK 2Q5BA 3GZQA 4LCWB 3MC0A 1QLEB 4QOKE 5D55A 2E4FA 4L2LA 3NRPA 3DROA 1NBYB 2ITCA 3ZSTA 3QA3A 4H25A 1NEZG 3AGWA 3H0TA 3IN2A 3V79C 2A9NL 4PJCB 4L3EE 5AUMA 1YMHA 2C9AA 3L08A 1Y6KR 1QSEB 2FJFB 3PWNA 2GSIB 1JPFA 2WQXA 2YQ2A 5ICXA 1KPRA 3MYZA 1QTSA 2R2BB 2MPAL 2X6AA 3BOVA 5F9WB 3PNWB 3NIGB 4M29A 5AVXB 5ESVA 3V4VB 1MCKA 2OXGB 1QQDA 2HX8A 2P8LA 1KJ2B 3FU7B 5F3HA 4M61B 5E4IA 1HHIA 1AH1A 1QACA 3OPUA 2E6PA 1AANA 2XFGB 2OXHB 3TV3H 4LVNC 4K4KA 1N2RB 3OLGA 4WWID 1EO8L 2FX7H 4NJAH 4BRJA 1OD9A 3K4ZA 3OAUL 5IHZB 3Q8FA 2NY4D 3ZZ1A 4KQ3H 2B1OA 5T3ZL 3HOGA 4CMHB 5DR5H 1Q72L 3PAYA 4WJ5A 4IKJA 4P2RD 1M3IA 3BCDA 2XZAH 3L4VA 3OTTA 4RWHA 4JFXA 5B38A 3ARGB 3WL9B 3FTZA 5HHPB 4I87A 3BH8A 3HHSA 3TTYA 3BQUB 4EN2A 2ARWA 2WLJA 3ECBB 5I5JA 1SEBB 3HW7A 3D4GA 2NOZA 3PCYA 3QEGL 4NRYA 1F45A 2VDKB 4EF3A 1N0LB 4Y9GA 5EDSA 4XN5A 4KITB 4OJYA 4MMYB 1G7LB 4L29B 4F24A 3E2HB 4LSVH 4AWJC 1OAZH 3L6FB 3TASA 2CLVB 2AV7A 4BCZA 1HYSD 3QUXA 2OW7A 3VDCA 5KVEH 1NKOA 5FGSA 4HUWA 5BO1H 4NWUH 4B96A 4J6RL 3OL2A 1NEUA 1KPVB 2GSMB 3FSVA 3V0DA 1GKEA 1U8CB 4NPYB 1UD2A 4XPGH 1CBVH 1NM4A 2ZCZA 3V5HB 2Y8LA 4M1GH 4PJGA 5EOCH 2DWDA 4NN6B 2CH8A 3SDCC 1C5BH 4OM0L 5LBVA 2VZOA 2LQRA 3D12B 3MBWA 1HNFA 4QLRA 5HHOE 3SKNB 2DQUH 5HPOA 3VWJB 1UZ6F 2I5WA 3NDYE 4DERA 3IM1A 4NZRL 2DWSA 2WUCH 1QNBA 1EZLA 3PABA 3SDDC 3KS0J 3L4CA 3ULUD 2EEFA 3A5VA 2BM3A 2CJUL 2V17H 3LRSB 4YFLI 1SJMA 4TSBH 2CXKA 3BLBA 2D2CC 1JP5A 2WVTA 2HLAA 4WW2B 5JUEH 3ULVL 3QS3A 1FNEB 4JQVC 2OL3B 5KW9L 1ZT4A 1TG8A 2B9AA 2FIKA 1DDTA 4PJ8B 3UCQA 3QI9C 4TNWF 5L9DL 4U6VL 2VE6B 3LXCA 3O4OC 4PJHB 5IF0A 3D05A 1O9WA 4PJ5B 4LEXL 1N10A 5D1ZB 1JVKA 5DJ2B 4NENA 3Q5TA 4Y16B 4OUUB 5DDHA 4NM8L 3ZE1F 5KYNA 1CDCA 3P1VA 5CIPB 2Q3XA 4X9GA 2ZWKA 2L4OA 5IKCB 2E7CA 3ZDYE 1TVHB 3PIQB 1URZA 5DQ9B 5T3ZE 1H19A 2WB1A 1AS8A 1PG7W 3BUYA 1GYWA 1W15A 5HVHC 2Q7YB 4GSUA 4NO2A 4KHTH 3X13B 2XZQH 1XT5A 4X6FB 4M7JL 3W0WE 3JWOL 8PAZA 4S1DD 1TO4A 1NH6A 2DI9A 2CDEB 2ADFL 2OJZL 3EADA 5FF6B 3VQMA 5DUPL 4L1DA 2H5AX 2AK4D 4YDLC 2WLKA 1X5GA 2LU4A 1AIFA 4ZRGA 5GISH 1YA5A 4EAGA 1SVCP 1X7QA 4KRPD 5DHVB 1NPJA 1SN2A 1M2VA 1T0OA 4L05A 1GZPB 3QUYB 1BVNT 2QGDA 4MNGA 3IPBA 3DX8B 1CTNA 1M1SA 2BCKB 3QO1B 3ZKNC 5T5FL 4M8UA 5DHEA 4FKHA 4YNYB 3B8YA 2CKBH 1EZUA 1WAEA 3NGBB 4JDVB 4Y5VA 4F8OA 1XF2A 1HOCA 4C59B 4X42A 3IN0A 2ZXGA 4PG9B 5I8OH 4ZYKB 4QRBA 1QVOA 2F7IA 4IK7A 2X9ZA 4UT9H 3TJHC 8FABB 2JVUA 4K7PX 1OT4A 2YJLA 3JWNH 1EJOL 1DBAL 5E5UB 5J12C 2ITEA 5DJDB 4D7PA 4NQDB 4PQXA 5ICYA 3T0EC 2X3AA 2OI9C 1DL7L 1T89C 2IH8A 3ZQWA 2CWRA 4GKZA 4IMLA 4P4KA 2MPVA 5FM8A 3HS9A 4Q8BA 1IEBA 4Z23A 1AD9A 3ULVE 1T04B 1M5Q1 3F7YB 4PLOB 2OJEB 2CJTA 3PGFH 4HU8A 1MIML 4S1RL 4YXKH 4QJ5B 5I1CH 3BE1H 1IAMA 3VXTA 1WICA 1NBZA 2F61A 4DT2A 3WENA 1JK9B 4IRSA 4PGZA 4BSJA 2OQJA 4UBDD 3IDNB 3NIDB 3UZQA 2GFBA 4TXVB 3ES6B 5E0FA 3GXDA 3DBSA 5CZVL 3QFJA 2APVA 4C56B 1QX1A 2W94A 2PXYA 3UTTA 1CT8B 3PWLA 1SDDA 3IMWA 3ATEA 2VO5A 4JPVH 2ICEB 1RLWA 4JVPA 1LP9F 4HLJA 4F37F 1XH1A 1BYOA 3W9DB 3NACH 2IDSA 1KCVL 4B97A 3UAJD 4Z7UA 3U1SH 4OD1L 3ZTJH 1Q9WB 4UNVA 3LEXB 5FYJH 1J9RA 2OOXA 3VB8A 3ZL1A 3HE6C 4U1IB 2GIMA 1H6EA 3O2WL 1I53A 3RWGA 2LV4A 3VI3F 1AOZA 5H2BA 2H45A 2X6MA 3FT4A 1KDIA 5JOPD 3FT0A 1U95A 3BJ91 3LDBB 2YAPA 2H2PD 1TPXC 2GCYA 3V4PH 1JPTL 4HHAB 4NKDB 5K9OA 3O2VH 1OCCB 1RZKL 3NABL 3NSXA 1BBJA 1BX2B 3B3IB 2OA9A 4HIQA 1YSOA 4LCCA 3ELQA 4AUYA 2XDHA 4D0BB 1QASA 3C6SB 1ED3A 1NJ9A 5CEYA 3SQOL 5EB9A 1MW1A 1BAFL 2BIPA 3K0YA 3B1UA 5GGUB 1U8MA 2B1HL 4F8TA 5HGBA 5GS1B 2A6IB 1TTAA 5LAPA 3UZEC 1GGTA 4I4WA 4LSTL 2WK2A 3FUFA 3WCYA 2CBPA 2ZPKL 4KWUA 1ZCRA 4GS7B 2X4RB 2FO4A 1OAKL 1RJYA 1CZ8L 2DMGA 3DRQB 3P9LB 3V0IA 4ODUB 2CIIB 3QQDA 4RETB 4F7KA 1XF4B 4EUPG 2XVKA 3ABMB 3GI9L 4OW6A 4TYUA 1QSFB 1U58B 2VDPL 3V8OA 1KIRA 2K6YA 4JRLA 4KY2A 4NWTL 1IBGL 4JM2B 1PG7X 5D5MB 3UFIA 2EIZB 3QHZL 2IAAC 1MXGA 2WXPA 4AH2A 4OM1L 2ZUTA 4PWJA 4R90L 3RVTC 5DRZB 5HYEA 2BSRA 1H3XA 3TIDB 2MNUA 3BO8A 3H9HA 3RGVA 5KVMC 5LB1A 4AXWA 1DQJB 1MAML 2R0ZL 5FFGA 4K3JL 1WC7A 4L8SB 3MRKA 3WJLA