1B9SA

Novel aromatic inhibitors of influenza virus neuraminidase make selective interactions with conserved residues and water molecules in the active site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
390
structure length
390
Chain Sequence
EPEWTYPRLSCQGSTFQKALLISPHRFGEIKGNSAPLIIREPFVACGPKECRHFALTHYAAQPGGYYNGTRKDRNKLRHLVSVKLGKIPTVENSIFHMAAWSGSACHDGREWTYIGVDGPDNDALVKIKYGEAYTDTYHSYAHNILRTQESACNCIGGDCYLMITDGSASGISKCRFLKIREGRIIKEILPTGRVEHTEECTCGFASNKTIECACRDNSYTAKRPFVKLNVETDTAEIRLMCTKTYLDTPRPDDGSIAGPCESNGDKWLGGIKGGFVHQRMASKIGRWYSRTMSKTNRMGMELYVRYDGDPWTDSDALTLSGVMVSIEEPGWYSFGFEIKDKKCDVPCIGIEMVHDGGKDTWHSAATAIYCLMGSGQLLWDTVTGVDMAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel aromatic inhibitors of influenza virus neuraminidase make selective interactions with conserved residues and water molecules in the active site.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (NEURAMINIDASE)
total genus 104
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 1999-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 1b9sA00
4X47A 3D12A 1VCUA 2VW0A 4J9TA 3NN9A 3PJQA 4NN9A 2F29A 4MWWA 4CPOA 4K1KA 4KS2A 2YA4A 2F11A 4H52A 1Z50A 1NNBA 4FOQA 2JKBA 1B9SA 5HUMA 2C4AA 1USXA 1NNAA 4HZVA 4MZAA 2HTYA 1V0ZA 2ZB5A 4GZXA 2ZB6A 1VCJA 3H73A 1IVGA 1SNTA 4MX0A 4FPJA 4BBWA 4M4UA 1N1SA 4B7QA 4FPFA 4YW3A 1NCCN 4MWJA 4XYXA 1A4QA 1BJIA 2XZKA 3O9JA 3O9KA 1DIMA 4CPZA 4YZ2A 2VSMA 4XJZA 2QWAA 3CKZA 2QWGA 2YDTA 1INYA 3OPZA 4NCSA 1EUSA 1F8BA 2F24A 4MWUA 1MR5A 2QWEA 1SO7A 1MS9A 3B7EA 4FPLA 1EUTA 2W5OA 4Q6KA 4GB1A 3CL2A 1MS0A 2W5NA 4WA5A 3TI8A 1NCDN 3GVKA 2RKCA 3A71A 2QWIA 4FPOB 1NMCA 1W0OA 2VSKA 1A14N 4XJ9A 1DILA 4JF7A 2BF6A 4XJWA 1INGA 4K1IA 1WCSA 4GJTA 6NN9A 4KS1A 2HTRA 4WA3A 4CPLA 3SALA 1NN2A 4MJVA 4XJQA 1NSDA 2HT7A 1MS8A 1W8OA 1IVEA 2HTQA 4XHBA 1V2IA 4GEZA 1V3CA 4CPMA 1Z4VA 4YW5A 2YDPA 1MS1A 3K3AA 4GZTA 4FOWA 4XMAA 1N1YA 2W20A 4HZWA 4UF7A 4FPCA 3JU4A 1MS5A 1B9TA 4QN5A 4YZ3A 2QWCA 7NN9A 1L7FA 3SILA 2VWDA 1A4GA 1INXA 4XJAA 4XJUA 4XJ8A 4HIZA 2F27A 2VK7A 4XJRA 4X6KA 3GVJA 4FQ4A 4GZQA 4FVKA 4YW1A 3ALWA 4MWYA 4KS5A 1L7GA 1NSBA 4MWQA 2VW2A 2QWHA 4QNPA 1W21A 4FP3A 4GDJA 4KS4A 1F8EA 1F8CA 4FPEA 3TI4A 1NSCA 2BATA 1INVA 4YZ4A 1W8NA 1EUUA 4B7NA 4MWXA 3K38A 1W20A 1Z4WA 1SLLA 1WCQA 2VVZA 2QWDA 1MS4A 2X9MA 3TI5A 2AGSA 2A75A 3TIAA 4XOGA 3B69A 4NC5A 2W38A 4WEGA 1MWEA 3TI3A 4XHXA 2BZDA 4MJUA 3H6JA 4K1JA 4XILA 5F9TA 1E8UA 2QWBA 1MS3A 4MZEA 2FHRA 4B7JA 1N1VA 4FPKA 4K3YA 1INHA 1NNCA 2QWFA 4YW4A 4GDIA 2AEQA 1MZ6A 2XZJA 4DGRA 1V3DA 5HUKA 2HU0A 4MC7A 2CMLA 4WEFA 3K36A 2B8HA 1IVDA 2SILA 2QWKA 4GZPA 2YA5A 4QN6A 3SLIA 1USRA 1IVBA 5NN9A 2YA7A 5HUGA 2HTVA 3H72A 4M4NA 4YZ5A 4GZWA 4WA4A 4XIOA 1S0JA 1EURA 3K39A 3SANA 4XMIA 1NMAN 2VW1A 2F12A 3D11A 1Z4ZA 3TICA 3TIBA 2C4LA 4FOVA 1N1TA 4K1HA 2SIMA 4B7MA 1B9VA 4FPHA 4QN3A 4CPYA 1IVCA 1XOGA 4M3MA 1KITA 2F25A 4QN7A 4YZ1A 3H71A 1E8TA 3INBA 4FPYA 1V0EA 2F0ZA 4D8SA 3TI6A 1L7HA 1XOEA 2BERA 2YA6A 1INFA 1E8VA 2HTUA 1Z4XA 4MWLA 1V3EA 1IVFA 4KS3A 5HUNA 4XE9A 4FJ6A 3CYEA 4HZYA 1F8DA 4FZHA 4I00A 4FPGA 4HZXA 2HT5A 2F26A 3W09A 1INWA 1MZ5A 2VK6A 2AEPA 4GZOA 1Z4YA 4B7RA 1V3BA 1NCAN 3A72A 4MWRA 1NCBN 2QWJA 1W1XA 3T1EA 3GVLA 1NMBN 4QN4A 2XCYA 2HU4A 3CL0A 3K37A 4HZZA 2HTWA 1S0IA 4X4AA 2F28A 5M1ZA 2AH2A 3ALXA 4XIKA 5HX0A 2F13A 4MWVA 1V0FA 3NSSA 4M4VA 2F10A 5JYYA 1W0PA 4SLIA 4FOYA 2XZIA 2SLIA 2YA8A 5B2DA 2HT8A 2VK5A 4H53A 4CPNA 4YW2A 4GZSA 4FP2A 1SLIA 3BEQA 4X49A 5B2CA
chains in the Genus database with same CATH superfamily
4X47A 3D12A 1X2JA 1VCUA 3WDZA 2VW0A 4J9TA 3I1CA 3NN9A 5EO7A 3PJQA 3U0SA 4NN9A 5H47A 4DG6A 2F29A 4MWWA 5GX5A 4CPOA 4GN8A 3S8ZA 4K1KA 4KS2A 4G3NA 3FW0A 2YA4A 2F11A 4H52A 1C5KA 1Z50A 1NNBA 4FOQA 2JKBA 1PJXA 1B9SA 5HUMA 3V1SA 2C4AA 3SREA 3E5ZA 1USXA 1NNAA 4HZVA 4MZAA 2HTYA 1V0ZA 5F72C 2ZB5A 1CQ1A 1N6FA 4GZXA 2ZB6A 2ISMA 1VCJA 4IFNX 3H73A 1IVGA 1SNTA 4MX0A 4D52C 4FPJA 3SRGA 4BBWA 4M4UA 1N1SA 4B7QA 3LI3A 4FPFA 4YW3A 4UOUA 4IYGA 1NCCN 4MWJA 2IATA 4XYXA 1A4QA 1BJIA 2XZKA 3O9JA 4ASCA 3O9KA 1DIMA 2QE8A 4HHQA 5D9DA 4AGIA 4CPZA 4YZ2A 2VSMA 4XJZA 2QWAA 3CKZA 2QWGA 4L7CA 3A9HA 2YDTA 1INYA 3OPZA 1Q7FA 4NCSA 1EUSA 1F8BA 2F24A 4YY8A 4MWUA 3HLHA 5GX4A 1MR5A 1NPEA 1SO7A 2QWEA 3FVZA 4IMBA 1MS9A 3B7EA 2ZWAA 4FPLA 1EUTA 2W5OA 3WW9A 4Q6KA 2P4OA 4GB1A 5FNQA 2DG0A 3CL2A 1MS0A 2W5NA 4WA5A 3TI8A 3V65B 1NCDN 3KYAA 2DSOA 3GVKA 2HQSA 2IAUA 2RKCA 3A71A 2QWIA 4FPOB 2H2UA 1NMCA 2DYHA 3VNHA 1W0OA 2VSKA 1A14N 4XJ9A 1DILA 4JF7A 2BF6A 4XJWA 1INGA 4L7DA 4K1IA 3HRPA 2IAWA 1WCSA 4GJTA 1CRUA 1S1DA 6NN9A 4KS1A 2HTRA 4WA3A 4CPLA 3SALA 1QLGA 1NN2A 4MJVA 4XJQA 1NSDA 4JMLA 2HT7A 1MS8A 1W8OA 1IVEA 2HTQA 4XHBA 1V2IA 5B2CA 4GEZA 1V3CA 4CPMA 1RWLA 5GX1A 3II7A 1Z4VA 4YW5A 2YDPA 1MS1A 3AMRA 2DG1A 2W8BB 3K3AA 4GZTA 4FOWA 4IQKA 4XMAA 1N1YA 2W20A 3A9GA 4HZWA 4UF7A 4FPCA 4D4UA 3JU4A 4D52A 1MS5A 2FLUX 4D52B 5GTQA 1B9TA 4QN5A 3WWAA 4YZ3A 3SOBB 5CGJA 2QWCA 7NN9A 1L7FA 4GN9A 3SILA 2VWDA 4GNBA 2IARA 1A4GA 1INXA 1SUUA 3KGGA 1C9UA 4XJAA 4XJUA 4XJ8A 4HIZA 2F27A 4CSDA 3G4HA 3Q6PA 2VK7A 4O5TA 4XJRA 4GN7A 3GVJA 4X6KA 3ZGCA 4FQ4A 4GZQA 4FVKA 1RWIA 4YW1A 3ALWA 4C1YB 1OFZA 4MWYA 2IAVA 4KS5A 4CH9A 4HHOA 1L7GA 2IAPA 1NSBA 3P5BL 4MWQA 1IJQA 1CVMA 2VW2A 2QWHA 2VAQA 4QNPA 1W21A 4FP3A 5EX7A 4GDJA 4KS4A 1F8EA 1F8CA 4FPEA 3TI4A 1NSCA 3NO0A 2BATA 1IUCA 1INVA 4YZ4A 1W8NA 1EUUA 4B7NA 4MWXA 3K38A 1W20A 4IN4A 1Z4WA 3S2KA 1SLLA 2H2NA 1CRZA 4O5SA 4Q1UA 1WCQA 4N1BA 2WOZA 3G4EA 3S94A 2VVZA 2QWDA 1MS4A 2GVWA 2X9MA 3TI5A 2AGSA 2A75A 3TIAA 4XOGA 3B69A 4NC5A 2W38A 4WEGA 1MWEA 3TI3A 2VPJA 2V91A 4XHXA 5D9BA 2BZDA 5FNUA 5FNSA 4MJUA 3H6JA 4K1JA 4XILA 5F9TA 1E8UA 4ZY3A 3UC1A 2QWBA 2XN4A 4A0PA 1MS3A 2POOA 4MZEA 2FHRA 1ZGKA 2G8SA 1N1VA 4FPKA 4K3YA 4B7JA 1INHA 4C1YA 1NNCA 2QWFA 3BYCA 5GX2A 4YW4A 3SOQA 4GDIA 2AEQA 3Q6TA 1MZ6A 2XZJA 5D9CA 4DGRA 1V3DA 5HUKA 2HU0A 4MC7A 2CMLA 3DR2A 4WEFA 3K36A 3S8VA 2B8HA 1IVDA 2SILA 2QWKA 4GZPA 2FPBA 2YA5A 4QN6A 2IASA 3SLIA 1USRA 1IVBA 1K32A 4ZGCA 1N6EA 5FZNA 5NN9A 2YA7A 2GHSA 2GVXA 2IVZA 1N6DA 5FNRA 5HUGA 2HTVA 3H72A 3LI4A 4M4NA 1N7DA 4YZ5A 4GZWA 4WA4A 4XIOA 1S0JA 4IFLX 1EURA 3K39A 3SANA 4XMIA 2FPCA 1NMAN 2VW1A 3VNGA 2F12A 3D11A 1Z4ZA 3TICA 2OJHA 1WP5A 4L7BA 3TIBA 2C4LA 2W8BA 4FOVA 1N1TA 4K1HA 2SIMA 4B7MA 1B9VA 1POOA 4FPHA 4QN3A 4CPYA 4HW6A 1IVCA 1XOGA 4M3MA 1KITA 2F25A 4QN7A 4YZ1A 3H71A 4GNCA 1E8TA 2IAOA 3INBA 4FPYA 1V0EA 2F0ZA 4XMBA 4D8SA 3TI6A 1L7HA 1XOEA 2BERA 2YA6A 1INFA 1S18A 1E8VA 2HTUA 5FNTA 4R40A 1Z4XA 4MWLA 5FWWA 2ZZKA 1V3EA 3LI5A 1E1AA 1IVFA 1ZI0A 4KS3A 1IUBA 3ZGDA 5HUNA 3HLIA 4AGTA 4XE9A 2Z32A 4FJ6A 2ZW9A 3CYEA 4HZYA 4AHAA 1F8DA 4FZHA 3O4PA 4I00A 1X2RA 3SOVA 1V04A 4FPGA 4HZXA 2HT5A 3IAXA 2F26A 3WN7A 3W09A 4AH4A 4IFJA 1INWA 1MZ5A 1QBIA 2VK6A 2AEPA 2GVUA 4GZOA 1Z4YA 4B7RA 1V3BA 1NCAN 3A72A 4MWRA 1U6DX 1NCBN 2QWJA 1W1XA 3T1EA 3GVLA 1NMBN 3TC9A 4QN4A 2XCYA 2HU4A 3CL0A 4ZLRA 3K37A 3AMSA 3V64C 4GNAA 4HZZA 2HTWA 1S0IA 4X4AA 2F28A 5M1ZA 2AH2A 3ALXA 4XIKA 2FP8A 5HX0A 2F13A 5FZJA 4MWVA 1V0FA 3Q6KA 3NSSA 4M4VA 2F10A 5JYYA 4PWZA 1W0PA 4SLIA 4FOYA 2XZIA 2IAXA 3DASA 2SLIA 2FP9A 2YA8A 5B2DA 2HT8A 2VK5A 4H53A 4CPNA 4YW2A 4GZSA 3L6VA 2GVVA 4FP2A 5EO8A 3ADEA 5GX3A 1SLIA 3BEQA 4X49A 2IAQA 1H6LA 4CHBA
chains in the Genus database with same CATH topology
4X47A 3D12A 1VCUA 2VW0A 4J9TA 3NN9A 3PJQA 4NN9A 2F29A 4MWWA 4CPOA 4K1KA 4KS2A 2YA4A 2F11A 4H52A 1Z50A 1NNBA 4FOQA 2JKBA 1B9SA 5HUMA 2C4AA 1USXA 1NNAA 4HZVA 4MZAA 2HTYA 1V0ZA 2ZB5A 4GZXA 2ZB6A 1VCJA 3H73A 1IVGA 1SNTA 4MX0A 4FPJA 4BBWA 4M4UA 1N1SA 4B7QA 4FPFA 4YW3A 1NCCN 4MWJA 4XYXA 1A4QA 1BJIA 2XZKA 3O9JA 3O9KA 1DIMA 4CPZA 4YZ2A 2VSMA 4XJZA 2QWAA 3CKZA 2QWGA 2YDTA 1INYA 3OPZA 4NCSA 1EUSA 1F8BA 2F24A 4MWUA 1MR5A 2QWEA 1SO7A 1MS9A 3B7EA 4FPLA 1EUTA 2W5OA 4Q6KA 4GB1A 3CL2A 1MS0A 2W5NA 4WA5A 3TI8A 1NCDN 3GVKA 2RKCA 3A71A 2QWIA 4FPOB 2H2UA 1NMCA 1W0OA 2VSKA 1A14N 4XJ9A 1DILA 4JF7A 2BF6A 4XJWA 1INGA 4K1IA 1WCSA 4GJTA 1S1DA 6NN9A 4KS1A 2HTRA 4WA3A 4CPLA 3SALA 1NN2A 4MJVA 4XJQA 1NSDA 2HT7A 1MS8A 1W8OA 1IVEA 2HTQA 4XHBA 1V2IA 4GEZA 1V3CA 4CPMA 1Z4VA 4YW5A 2YDPA 1MS1A 3K3AA 4GZTA 4FOWA 4XMAA 1N1YA 2W20A 4HZWA 4UF7A 4FPCA 3JU4A 1MS5A 1B9TA 4QN5A 4YZ3A 2QWCA 7NN9A 1L7FA 3SILA 2VWDA 1A4GA 1INXA 4XJAA 4XJUA 4XJ8A 4HIZA 2F27A 2VK7A 4XJRA 4X6KA 3GVJA 4FQ4A 4GZQA 4FVKA 4YW1A 3ALWA 4MWYA 4KS5A 1L7GA 1NSBA 4MWQA 2VW2A 2QWHA 4QNPA 1W21A 4FP3A 4GDJA 4KS4A 1F8EA 1F8CA 4FPEA 3TI4A 1NSCA 2BATA 1INVA 4YZ4A 1W8NA 1EUUA 4B7NA 4MWXA 3K38A 1W20A 1Z4WA 1SLLA 2H2NA 1WCQA 2VVZA 2QWDA 1MS4A 2X9MA 3TI5A 2AGSA 2A75A 3TIAA 4XOGA 3B69A 4NC5A 2W38A 4WEGA 1MWEA 3TI3A 4XHXA 2BZDA 4MJUA 3H6JA 4K1JA 4XILA 5F9TA 1E8UA 2QWBA 1MS3A 4MZEA 2FHRA 4B7JA 1N1VA 4FPKA 4K3YA 1INHA 1NNCA 2QWFA 4YW4A 4GDIA 2AEQA 1MZ6A 2XZJA 4DGRA 1V3DA 5HUKA 2HU0A 4MC7A 2CMLA 4WEFA 3K36A 2B8HA 1IVDA 2SILA 2QWKA 4GZPA 2YA5A 4QN6A 3SLIA 1USRA 1IVBA 5NN9A 2YA7A 5HUGA 2HTVA 3H72A 4M4NA 4YZ5A 4GZWA 4WA4A 4XIOA 1S0JA 1EURA 3K39A 3SANA 4XMIA 1NMAN 2VW1A 2F12A 3D11A 1Z4ZA 3TICA 3TIBA 2C4LA 4FOVA 1N1TA 4K1HA 2SIMA 4B7MA 1B9VA 4FPHA 4QN3A 4CPYA 1IVCA 1XOGA 4M3MA 1KITA 2F25A 4QN7A 4YZ1A 3H71A 1E8TA 3INBA 4FPYA 1V0EA 2F0ZA 4D8SA 3TI6A 1L7HA 1XOEA 2BERA 2YA6A 1INFA 1S18A 1E8VA 2HTUA 1Z4XA 4MWLA 1V3EA 1IVFA 4KS3A 5HUNA 4XE9A 4FJ6A 3CYEA 4HZYA 1F8DA 4FZHA 4I00A 4FPGA 4HZXA 2HT5A 2F26A 3W09A 1INWA 1MZ5A 2VK6A 2AEPA 4GZOA 1Z4YA 4B7RA 1V3BA 1NCAN 3A72A 4MWRA 1NCBN 2QWJA 1W1XA 3T1EA 3GVLA 1NMBN 4QN4A 2XCYA 2HU4A 3CL0A 3K37A 4HZZA 2HTWA 1S0IA 4X4AA 2F28A 5M1ZA 2AH2A 3ALXA 4XIKA 5HX0A 2F13A 4MWVA 1V0FA 3NSSA 4M4VA 2F10A 5JYYA 1W0PA 4SLIA 4FOYA 2XZIA 2SLIA 2YA8A 5B2DA 2HT8A 2VK5A 4H53A 4CPNA 4YW2A 4GZSA 4FP2A 1SLIA 3BEQA 4X49A 5B2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X47 A;  3D12 A;  1VCU A;  2VW0 A;  4J9T A;  3NN9 A;  3PJQ A;  4NN9 A;  2F29 A;  4MWW A;  4CPO A;  4K1K A;  4KS2 A;  2YA4 A;  2F11 A;  4H52 A;  1Z50 A;  1NNB A;  4FOQ A;  2JKB A;  1B9S A;  5HUM A;  2C4A A;  1USX A;  1NNA A;  4HZV A;  4MZA A;  2HTY A;  1V0Z A;  2ZB5 A;  4GZX A;  2ZB6 A;  1VCJ A;  3H73 A;  1IVG A;  1SNT A;  4MX0 A;  4FPJ A;  4BBW A;  4M4U A;  1N1S A;  4B7Q A;  4FPF A;  4YW3 A;  1NCC N;  4MWJ A;  4XYX A;  1A4Q A;  1BJI A;  2XZK A;  3O9J A;  3O9K A;  1DIM A;  4CPZ A;  4YZ2 A;  2VSM A;  4XJZ A;  2QWA A;  3CKZ A;  2QWG A;  2YDT A;  1INY A;  3OPZ A;  4NCS A;  1EUS A;  1F8B A;  2F24 A;  4MWU A;  1MR5 A;  2QWE A;  1SO7 A;  1MS9 A;  3B7E A;  4FPL A;  1EUT A;  2W5O A;  4Q6K A;  4GB1 A;  3CL2 A;  1MS0 A;  2W5N A;  4WA5 A;  3TI8 A;  1NCD N;  3GVK A;  2RKC A;  3A71 A;  2QWI A;  4FPO B;  1NMC A;  1W0O A;  2VSK A;  1A14 N;  4XJ9 A;  1DIL A;  4JF7 A;  2BF6 A;  4XJW A;  1ING A;  4K1I A;  1WCS A;  4GJT A;  6NN9 A;  4KS1 A;  2HTR A;  4WA3 A;  4CPL A;  3SAL A;  1NN2 A;  4MJV A;  4XJQ A;  1NSD A;  2HT7 A;  1MS8 A;  1W8O A;  1IVE A;  2HTQ A;  4XHB A;  1V2I A;  4GEZ A;  1V3C A;  4CPM A;  1Z4V A;  4YW5 A;  2YDP A;  1MS1 A;  3K3A A;  4GZT A;  4FOW A;  4XMA A;  1N1Y A;  2W20 A;  4HZW A;  4UF7 A;  4FPC A;  3JU4 A;  1MS5 A;  1B9T A;  4QN5 A;  4YZ3 A;  2QWC A;  7NN9 A;  1L7F A;  3SIL A;  2VWD A;  1A4G A;  1INX A;  4XJA A;  4XJU A;  4XJ8 A;  4HIZ A;  2F27 A;  2VK7 A;  4XJR A;  4X6K A;  3GVJ A;  4FQ4 A;  4GZQ A;  4FVK A;  4YW1 A;  3ALW A;  4MWY A;  4KS5 A;  1L7G A;  1NSB A;  4MWQ A;  2VW2 A;  2QWH A;  4QNP A;  1W21 A;  4FP3 A;  4GDJ A;  4KS4 A;  1F8E A;  1F8C A;  4FPE A;  3TI4 A;  1NSC A;  2BAT A;  1INV A;  4YZ4 A;  1W8N A;  1EUU A;  4B7N A;  4MWX A;  3K38 A;  1W20 A;  1Z4W A;  1SLL A;  1WCQ A;  2VVZ A;  2QWD A;  1MS4 A;  2X9M A;  3TI5 A;  2AGS A;  2A75 A;  3TIA A;  4XOG A;  3B69 A;  4NC5 A;  2W38 A;  4WEG A;  1MWE A;  3TI3 A;  4XHX A;  2BZD A;  4MJU A;  3H6J A;  4K1J A;  4XIL A;  5F9T A;  1E8U A;  2QWB A;  1MS3 A;  4MZE A;  2FHR A;  4B7J A;  1N1V A;  4FPK A;  4K3Y A;  1INH A;  1NNC A;  2QWF A;  4YW4 A;  4GDI A;  2AEQ A;  1MZ6 A;  2XZJ A;  4DGR A;  1V3D A;  5HUK A;  2HU0 A;  4MC7 A;  2CML A;  4WEF A;  3K36 A;  2B8H A;  1IVD A;  2SIL A;  2QWK A;  4GZP A;  2YA5 A;  4QN6 A;  3SLI A;  1USR A;  1IVB A;  5NN9 A;  2YA7 A;  5HUG A;  2HTV A;  3H72 A;  4M4N A;  4YZ5 A;  4GZW A;  4WA4 A;  4XIO A;  1S0J A;  1EUR A;  3K39 A;  3SAN A;  4XMI A;  1NMA N;  2VW1 A;  2F12 A;  3D11 A;  1Z4Z A;  3TIC A;  3TIB A;  2C4L A;  4FOV A;  1N1T A;  4K1H A;  2SIM A;  4B7M A;  1B9V A;  4FPH A;  4QN3 A;  4CPY A;  1IVC A;  1XOG A;  4M3M A;  1KIT A;  2F25 A;  4QN7 A;  4YZ1 A;  3H71 A;  1E8T A;  3INB A;  4FPY A;  1V0E A;  2F0Z A;  4D8S A;  3TI6 A;  1L7H A;  1XOE A;  2BER A;  2YA6 A;  1INF A;  1E8V A;  2HTU A;  1Z4X A;  4MWL A;  1V3E A;  1IVF A;  4KS3 A;  5HUN A;  4XE9 A;  4FJ6 A;  3CYE A;  4HZY A;  1F8D A;  4FZH A;  4I00 A;  4FPG A;  4HZX A;  2HT5 A;  2F26 A;  3W09 A;  1INW A;  1MZ5 A;  2VK6 A;  2AEP A;  4GZO A;  1Z4Y A;  4B7R A;  1V3B A;  1NCA N;  3A72 A;  4MWR A;  1NCB N;  2QWJ A;  1W1X A;  3T1E A;  3GVL A;  1NMB N;  4QN4 A;  2XCY A;  2HU4 A;  3CL0 A;  3K37 A;  4HZZ A;  2HTW A;  1S0I A;  4X4A A;  2F28 A;  5M1Z A;  2AH2 A;  3ALX A;  4XIK A;  5HX0 A;  2F13 A;  4MWV A;  1V0F A;  3NSS A;  4M4V A;  2F10 A;  5JYY A;  1W0P A;  4SLI A;  4FOY A;  2XZI A;  2SLI A;  2YA8 A;  5B2D A;  2HT8 A;  2VK5 A;  4H53 A;  4CPN A;  4YW2 A;  4GZS A;  4FP2 A;  1SLI A;  3BEQ A;  4X49 A;  5B2C A; 
#chains in the Genus database with same CATH topology
 4X47 A;  3D12 A;  1X2J A;  1VCU A;  3WDZ A;  2VW0 A;  4J9T A;  3I1C A;  3NN9 A;  5EO7 A;  3PJQ A;  3U0S A;  4NN9 A;  5H47 A;  4DG6 A;  2F29 A;  4MWW A;  5GX5 A;  4CPO A;  4GN8 A;  3S8Z A;  4K1K A;  4KS2 A;  4G3N A;  3FW0 A;  2YA4 A;  2F11 A;  4H52 A;  1C5K A;  1Z50 A;  1NNB A;  4FOQ A;  2JKB A;  1PJX A;  1B9S A;  5HUM A;  3V1S A;  2C4A A;  3SRE A;  3E5Z A;  1USX A;  1NNA A;  4HZV A;  4MZA A;  2HTY A;  1V0Z A;  5F72 C;  2ZB5 A;  1CQ1 A;  1N6F A;  4GZX A;  2ZB6 A;  2ISM A;  1VCJ A;  4IFN X;  3H73 A;  1IVG A;  1SNT A;  4MX0 A;  4D52 C;  4FPJ A;  3SRG A;  4BBW A;  4M4U A;  1N1S A;  4B7Q A;  3LI3 A;  4FPF A;  4YW3 A;  4UOU A;  4IYG A;  1NCC N;  4MWJ A;  2IAT A;  4XYX A;  1A4Q A;  1BJI A;  2XZK A;  3O9J A;  4ASC A;  3O9K A;  1DIM A;  2QE8 A;  4HHQ A;  5D9D A;  4AGI A;  4CPZ A;  4YZ2 A;  2VSM A;  4XJZ A;  2QWA A;  3CKZ A;  2QWG A;  4L7C A;  3A9H A;  2YDT A;  1INY A;  3OPZ A;  1Q7F A;  4NCS A;  1EUS A;  1F8B A;  2F24 A;  4YY8 A;  4MWU A;  3HLH A;  5GX4 A;  1MR5 A;  1NPE A;  1SO7 A;  2QWE A;  3FVZ A;  4IMB A;  1MS9 A;  3B7E A;  2ZWA A;  4FPL A;  1EUT A;  2W5O A;  3WW9 A;  4Q6K A;  2P4O A;  4GB1 A;  5FNQ A;  2DG0 A;  3CL2 A;  1MS0 A;  2W5N A;  4WA5 A;  3TI8 A;  3V65 B;  1NCD N;  3KYA A;  2DSO A;  3GVK A;  2HQS A;  2IAU A;  2RKC A;  3A71 A;  2QWI A;  4FPO B;  2H2U A;  1NMC A;  2DYH A;  3VNH A;  1W0O A;  2VSK A;  1A14 N;  4XJ9 A;  1DIL A;  4JF7 A;  2BF6 A;  4XJW A;  1ING A;  4L7D A;  4K1I A;  3HRP A;  2IAW A;  1WCS A;  4GJT A;  1CRU A;  1S1D A;  6NN9 A;  4KS1 A;  2HTR A;  4WA3 A;  4CPL A;  3SAL A;  1QLG A;  1NN2 A;  4MJV A;  4XJQ A;  1NSD A;  4JML A;  2HT7 A;  1MS8 A;  1W8O A;  1IVE A;  2HTQ A;  4XHB A;  1V2I A;  5B2C A;  4GEZ A;  1V3C A;  4CPM A;  1RWL A;  5GX1 A;  3II7 A;  1Z4V A;  4YW5 A;  2YDP A;  1MS1 A;  3AMR A;  2DG1 A;  2W8B B;  3K3A A;  4GZT A;  4FOW A;  4IQK A;  4XMA A;  1N1Y A;  2W20 A;  3A9G A;  4HZW A;  4UF7 A;  4FPC A;  4D4U A;  3JU4 A;  4D52 A;  1MS5 A;  2FLU X;  4D52 B;  5GTQ A;  1B9T A;  4QN5 A;  3WWA A;  4YZ3 A;  3SOB B;  5CGJ A;  2QWC A;  7NN9 A;  1L7F A;  4GN9 A;  3SIL A;  2VWD A;  4GNB A;  2IAR A;  1A4G A;  1INX A;  1SUU A;  3KGG A;  1C9U A;  4XJA A;  4XJU A;  4XJ8 A;  4HIZ A;  2F27 A;  4CSD A;  3G4H A;  3Q6P A;  2VK7 A;  4O5T A;  4XJR A;  4GN7 A;  3GVJ A;  4X6K A;  3ZGC A;  4FQ4 A;  4GZQ A;  4FVK A;  1RWI A;  4YW1 A;  3ALW A;  4C1Y B;  1OFZ A;  4MWY A;  2IAV A;  4KS5 A;  4CH9 A;  4HHO A;  1L7G A;  2IAP A;  1NSB A;  3P5B L;  4MWQ A;  1IJQ A;  1CVM A;  2VW2 A;  2QWH A;  2VAQ A;  4QNP A;  1W21 A;  4FP3 A;  5EX7 A;  4GDJ A;  4KS4 A;  1F8E A;  1F8C A;  4FPE A;  3TI4 A;  1NSC A;  3NO0 A;  2BAT A;  1IUC A;  1INV A;  4YZ4 A;  1W8N A;  1EUU A;  4B7N A;  4MWX A;  3K38 A;  1W20 A;  4IN4 A;  1Z4W A;  3S2K A;  1SLL A;  2H2N A;  1CRZ A;  4O5S A;  4Q1U A;  1WCQ A;  4N1B A;  2WOZ A;  3G4E A;  3S94 A;  2VVZ A;  2QWD A;  1MS4 A;  2GVW A;  2X9M A;  3TI5 A;  2AGS A;  2A75 A;  3TIA A;  4XOG A;  3B69 A;  4NC5 A;  2W38 A;  4WEG A;  1MWE A;  3TI3 A;  2VPJ A;  2V91 A;  4XHX A;  5D9B A;  2BZD A;  5FNU A;  5FNS A;  4MJU A;  3H6J A;  4K1J A;  4XIL A;  5F9T A;  1E8U A;  4ZY3 A;  3UC1 A;  2QWB A;  2XN4 A;  4A0P A;  1MS3 A;  2POO A;  4MZE A;  2FHR A;  1ZGK A;  2G8S A;  1N1V A;  4FPK A;  4K3Y A;  4B7J A;  1INH A;  4C1Y A;  1NNC A;  2QWF A;  3BYC A;  5GX2 A;  4YW4 A;  3SOQ A;  4GDI A;  2AEQ A;  3Q6T A;  1MZ6 A;  2XZJ A;  5D9C A;  4DGR A;  1V3D A;  5HUK A;  2HU0 A;  4MC7 A;  2CML A;  3DR2 A;  4WEF A;  3K36 A;  3S8V A;  2B8H A;  1IVD A;  2SIL A;  2QWK A;  4GZP A;  2FPB A;  2YA5 A;  4QN6 A;  2IAS A;  3SLI A;  1USR A;  1IVB A;  1K32 A;  4ZGC A;  1N6E A;  5FZN A;  5NN9 A;  2YA7 A;  2GHS A;  2GVX A;  2IVZ A;  1N6D A;  5FNR A;  5HUG A;  2HTV A;  3H72 A;  3LI4 A;  4M4N A;  1N7D A;  4YZ5 A;  4GZW A;  4WA4 A;  4XIO A;  1S0J A;  4IFL X;  1EUR A;  3K39 A;  3SAN A;  4XMI A;  2FPC A;  1NMA N;  2VW1 A;  3VNG A;  2F12 A;  3D11 A;  1Z4Z A;  3TIC A;  2OJH A;  1WP5 A;  4L7B A;  3TIB A;  2C4L A;  2W8B A;  4FOV A;  1N1T A;  4K1H A;  2SIM A;  4B7M A;  1B9V A;  1POO A;  4FPH A;  4QN3 A;  4CPY A;  4HW6 A;  1IVC A;  1XOG A;  4M3M A;  1KIT A;  2F25 A;  4QN7 A;  4YZ1 A;  3H71 A;  4GNC A;  1E8T A;  2IAO A;  3INB A;  4FPY A;  1V0E A;  2F0Z A;  4XMB A;  4D8S A;  3TI6 A;  1L7H A;  1XOE A;  2BER A;  2YA6 A;  1INF A;  1S18 A;  1E8V A;  2HTU A;  5FNT A;  4R40 A;  1Z4X A;  4MWL A;  5FWW A;  2ZZK A;  1V3E A;  3LI5 A;  1E1A A;  1IVF A;  1ZI0 A;  4KS3 A;  1IUB A;  3ZGD A;  5HUN A;  3HLI A;  4AGT A;  4XE9 A;  2Z32 A;  4FJ6 A;  2ZW9 A;  3CYE A;  4HZY A;  4AHA A;  1F8D A;  4FZH A;  3O4P A;  4I00 A;  1X2R A;  3SOV A;  1V04 A;  4FPG A;  4HZX A;  2HT5 A;  3IAX A;  2F26 A;  3WN7 A;  3W09 A;  4AH4 A;  4IFJ A;  1INW A;  1MZ5 A;  1QBI A;  2VK6 A;  2AEP A;  2GVU A;  4GZO A;  1Z4Y A;  4B7R A;  1V3B A;  1NCA N;  3A72 A;  4MWR A;  1U6D X;  1NCB N;  2QWJ A;  1W1X A;  3T1E A;  3GVL A;  1NMB N;  3TC9 A;  4QN4 A;  2XCY A;  2HU4 A;  3CL0 A;  4ZLR A;  3K37 A;  3AMS A;  3V64 C;  4GNA A;  4HZZ A;  2HTW A;  1S0I A;  4X4A A;  2F28 A;  5M1Z A;  2AH2 A;  3ALX A;  4XIK A;  2FP8 A;  5HX0 A;  2F13 A;  5FZJ A;  4MWV A;  1V0F A;  3Q6K A;  3NSS A;  4M4V A;  2F10 A;  5JYY A;  4PWZ A;  1W0P A;  4SLI A;  4FOY A;  2XZI A;  2IAX A;  3DAS A;  2SLI A;  2FP9 A;  2YA8 A;  5B2D A;  2HT8 A;  2VK5 A;  4H53 A;  4CPN A;  4YW2 A;  4GZS A;  3L6V A;  2GVV A;  4FP2 A;  5EO8 A;  3ADE A;  5GX3 A;  1SLI A;  3BEQ A;  4X49 A;  2IAQ A;  1H6L A;  4CHB A; 
#chains in the Genus database with same CATH homology
 4X47 A;  3D12 A;  1VCU A;  2VW0 A;  4J9T A;  3NN9 A;  3PJQ A;  4NN9 A;  2F29 A;  4MWW A;  4CPO A;  4K1K A;  4KS2 A;  2YA4 A;  2F11 A;  4H52 A;  1Z50 A;  1NNB A;  4FOQ A;  2JKB A;  1B9S A;  5HUM A;  2C4A A;  1USX A;  1NNA A;  4HZV A;  4MZA A;  2HTY A;  1V0Z A;  2ZB5 A;  4GZX A;  2ZB6 A;  1VCJ A;  3H73 A;  1IVG A;  1SNT A;  4MX0 A;  4FPJ A;  4BBW A;  4M4U A;  1N1S A;  4B7Q A;  4FPF A;  4YW3 A;  1NCC N;  4MWJ A;  4XYX A;  1A4Q A;  1BJI A;  2XZK A;  3O9J A;  3O9K A;  1DIM A;  4CPZ A;  4YZ2 A;  2VSM A;  4XJZ A;  2QWA A;  3CKZ A;  2QWG A;  2YDT A;  1INY A;  3OPZ A;  4NCS A;  1EUS A;  1F8B A;  2F24 A;  4MWU A;  1MR5 A;  2QWE A;  1SO7 A;  1MS9 A;  3B7E A;  4FPL A;  1EUT A;  2W5O A;  4Q6K A;  4GB1 A;  3CL2 A;  1MS0 A;  2W5N A;  4WA5 A;  3TI8 A;  1NCD N;  3GVK A;  2RKC A;  3A71 A;  2QWI A;  4FPO B;  2H2U A;  1NMC A;  1W0O A;  2VSK A;  1A14 N;  4XJ9 A;  1DIL A;  4JF7 A;  2BF6 A;  4XJW A;  1ING A;  4K1I A;  1WCS A;  4GJT A;  1S1D A;  6NN9 A;  4KS1 A;  2HTR A;  4WA3 A;  4CPL A;  3SAL A;  1NN2 A;  4MJV A;  4XJQ A;  1NSD A;  2HT7 A;  1MS8 A;  1W8O A;  1IVE A;  2HTQ A;  4XHB A;  1V2I A;  4GEZ A;  1V3C A;  4CPM A;  1Z4V A;  4YW5 A;  2YDP A;  1MS1 A;  3K3A A;  4GZT A;  4FOW A;  4XMA A;  1N1Y A;  2W20 A;  4HZW A;  4UF7 A;  4FPC A;  3JU4 A;  1MS5 A;  1B9T A;  4QN5 A;  4YZ3 A;  2QWC A;  7NN9 A;  1L7F A;  3SIL A;  2VWD A;  1A4G A;  1INX A;  4XJA A;  4XJU A;  4XJ8 A;  4HIZ A;  2F27 A;  2VK7 A;  4XJR A;  4X6K A;  3GVJ A;  4FQ4 A;  4GZQ A;  4FVK A;  4YW1 A;  3ALW A;  4MWY A;  4KS5 A;  1L7G A;  1NSB A;  4MWQ A;  2VW2 A;  2QWH A;  4QNP A;  1W21 A;  4FP3 A;  4GDJ A;  4KS4 A;  1F8E A;  1F8C A;  4FPE A;  3TI4 A;  1NSC A;  2BAT A;  1INV A;  4YZ4 A;  1W8N A;  1EUU A;  4B7N A;  4MWX A;  3K38 A;  1W20 A;  1Z4W A;  1SLL A;  2H2N A;  1WCQ A;  2VVZ A;  2QWD A;  1MS4 A;  2X9M A;  3TI5 A;  2AGS A;  2A75 A;  3TIA A;  4XOG A;  3B69 A;  4NC5 A;  2W38 A;  4WEG A;  1MWE A;  3TI3 A;  4XHX A;  2BZD A;  4MJU A;  3H6J A;  4K1J A;  4XIL A;  5F9T A;  1E8U A;  2QWB A;  1MS3 A;  4MZE A;  2FHR A;  4B7J A;  1N1V A;  4FPK A;  4K3Y A;  1INH A;  1NNC A;  2QWF A;  4YW4 A;  4GDI A;  2AEQ A;  1MZ6 A;  2XZJ A;  4DGR A;  1V3D A;  5HUK A;  2HU0 A;  4MC7 A;  2CML A;  4WEF A;  3K36 A;  2B8H A;  1IVD A;  2SIL A;  2QWK A;  4GZP A;  2YA5 A;  4QN6 A;  3SLI A;  1USR A;  1IVB A;  5NN9 A;  2YA7 A;  5HUG A;  2HTV A;  3H72 A;  4M4N A;  4YZ5 A;  4GZW A;  4WA4 A;  4XIO A;  1S0J A;  1EUR A;  3K39 A;  3SAN A;  4XMI A;  1NMA N;  2VW1 A;  2F12 A;  3D11 A;  1Z4Z A;  3TIC A;  3TIB A;  2C4L A;  4FOV A;  1N1T A;  4K1H A;  2SIM A;  4B7M A;  1B9V A;  4FPH A;  4QN3 A;  4CPY A;  1IVC A;  1XOG A;  4M3M A;  1KIT A;  2F25 A;  4QN7 A;  4YZ1 A;  3H71 A;  1E8T A;  3INB A;  4FPY A;  1V0E A;  2F0Z A;  4D8S A;  3TI6 A;  1L7H A;  1XOE A;  2BER A;  2YA6 A;  1INF A;  1S18 A;  1E8V A;  2HTU A;  1Z4X A;  4MWL A;  1V3E A;  1IVF A;  4KS3 A;  5HUN A;  4XE9 A;  4FJ6 A;  3CYE A;  4HZY A;  1F8D A;  4FZH A;  4I00 A;  4FPG A;  4HZX A;  2HT5 A;  2F26 A;  3W09 A;  1INW A;  1MZ5 A;  2VK6 A;  2AEP A;  4GZO A;  1Z4Y A;  4B7R A;  1V3B A;  1NCA N;  3A72 A;  4MWR A;  1NCB N;  2QWJ A;  1W1X A;  3T1E A;  3GVL A;  1NMB N;  4QN4 A;  2XCY A;  2HU4 A;  3CL0 A;  3K37 A;  4HZZ A;  2HTW A;  1S0I A;  4X4A A;  2F28 A;  5M1Z A;  2AH2 A;  3ALX A;  4XIK A;  5HX0 A;  2F13 A;  4MWV A;  1V0F A;  3NSS A;  4M4V A;  2F10 A;  5JYY A;  1W0P A;  4SLI A;  4FOY A;  2XZI A;  2SLI A;  2YA8 A;  5B2D A;  2HT8 A;  2VK5 A;  4H53 A;  4CPN A;  4YW2 A;  4GZS A;  4FP2 A;  1SLI A;  3BEQ A;  4X49 A;  5B2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...