1B9YA

Structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
b'MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRANSDUCIN)
publication title A molecular mechanism for the phosphorylation-dependent regulation of heterotrimeric G proteins by phosducin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 100
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1999-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1b9yA00
3I7OA 4OWRA 1P22A 1OMWB 3ODTA 4J8GA 2CN3A 1MDAH 2OVPB 3JZGA 1ERJA 3K27A 4ERZA 3V9FA 5IT9g 3AL8B 3RFHA 3ZWLB 4CI3A 4QQEA 2CO0A 4J81A 4FA4D 3J81g 3J80g 2I3SA 3PXSD 4ZOXA 5GXHA 4A0AA 5HE3B 4JSVC 3UKRC 4E5ZB 5HQGA 3UVKA 2OIZA 4J0XA 2H9PA 1MG3A 3SHFA 4JT6C 3UVLA 3VGZA 4CC9A 2IUPA 3FGBA 1JOFA 1JMZB 2Z2OA 3F3FA 2XU7A 2MTAH 5EM2A 5THAA 1PI6A 5IGQA 4L3HD 3PXWD 2PM6B 4NSXA 4X63B 3SWSD 3SLED 5FLXg 4Y5RD 5SXMA 2YNOA 2H68A 4J77A 3SFZA 3VA6A 4GM3A 3RN1D 5GSAA 2P9UC 2CN2A 3UVOA 3IIWA 4QRJA 2P9PC 3BG0A 4N14A 4GGDA 4GQ2P 2IWFA 5CYKA 3DXKC 4ZOYA 5C2WB 3L4MD 4L9OA 5EMLB 3MXXA 4L3GD 3NVQA 2AGXA 1XKSA 4BL0A 1U2VC 3C99A 3JRPA 4J79A 4U7AA 3KRXB 3JROA 2OVRB 3RN0D 3UKUC 5GXIA 2XYIA 3OKYA 2I0TA 4PC0A 4FAVD 2HJBA 4FA9D 4A09B 1K32A 1PBYB 4JT5C 2H9NA 3UVMA 4GZ8A 4H5IA 3A0FA 1OLZA 2AH1A 5CXCB 4QT8A 1U4CA 3N0EA 4A0BB 4LGNA 3AL9A 2GC7A 3SCYA 4ZN4A 3JB9L 4X3EA 4CY1A 5KDOB 3AL8A 5FKQA 3RRMC 4J8BA 2Q7QA 3U4YA 2AQ5A 3KRWB 4D6VA 4LG8A 1YFQA 4ZOZA 3EU7A 2IAAA 5TEEA 3FM0A 4X60B 2G99A 4JSPC 2H13A 5HE1B 4LG9A 4OZUA 2P9KC 3SN6B 4E5ZA 4IA9A 3MKQA 4IMMA 3NVXA 5EMJB 4JXMA 5IJ7E 5I5JA 3IIYA 3DXMC 4GMBA 5H17A 3SVWD 2CNXA 2HKMA 4YVDA 5EARA 3C9CA 2YMUA 4J78A 2P9NC 2P9IC 1SQ9A 3C5MA 5HE0B 4PBZA 3SXTD 5GMKn 2CE8A 4A11A 2YBAA 5IGOA 3I8EA 3EG6A 4PNKB 1K8KC 3F3PA 4H5JA 5EAMA 4PSWB 4CY3A 4BH6A 3ORVD 5A2Qg 2IUVA 1FWXA 3JAMg 2HESX 4CZXA 4GGAA 1S4UX 1QNIA 3C75H 1GP2B 4GM9A 5AFU3 1SQJA 1L0QA 2BBKH 4K3JB 2TRCB 3NVNA 4A2MA 4A0AB 2O9KA 3EI2B 4E54B 4CZYA 2UZYB 2XL2A 4ERQA 1A0RB 4Y7RA 5IC7A 5I5MA 3V7DB 2HJ4A 3DM0A 3EI4B 4A09A 4BUJC 4AOWA 3PVUB 4FA5D 4TZ4A 3AFCA 5FKRA 4MK0B 2AGLA 2H6QA 4J87A 4FWWA 5EM2B 3MMYA 4CY2A 4A0BA 1XHMA 2J57G 2OK4A 3B7FA 2YB8B 2Z2NA 3RLMD 3EI1B 5FA5B 4A08B 3IKOA 3OL2A 4GGCA 3JZNA 2H14A 3I7HA 1B9YA 5TDHB 4O3TB 5H1MA 3VH0A 2J56H 4QL1A 2J55H 2H9MA 5K1CC 3W15A 2QC5A 4K3ID 3EMHA 2B4EA 2PM7B 3DSMA 2H9LA 3PXTD 1GG2B 3OW8A 1JMXB 4O9DA 4G56B 2IUQA 3I89A 4FB1D 5AMSA 1Q47A 4CZVA 2W18A 4XYHA 4FA1D 1MG2A 5EALA 3RMZD 3IJ0A 3OKYB 2H6KA 3V5WB 3I8CA 1B9XA 2AGYA 5I5IA 3JPXA 3SBPA 4O45A 4X61B 3UVNA 3DWLC 4D0KA 3SBRA 5FXYA 2I3TA 1N6DA 4GM8A 4GQBB 3GREA 4FHLA 3CFSB 3MKSB 3N0DA 1PEVA 2H47A 4AEZA 4J86A 3BG1A 4CI8A 5EMMB 2PM9B 5HYNB 4J82A 5EMKB 2HKRA 3SMRA 2PBIB 5CXBB 3RSEC 3I7NA 2AGZA 1TBGA 2XL3A 3EI3B 3PVWB 2AH0A 1N6FA 1VYHC 2H3XA 2G9AA 2B5LA 4L1QD 4CI2A 2IWKA 3IJCA 5FKSA 4O3UB 5K19A 2GC4A 4EWRA 3EI2A 4E54A 2BCJB 3EI4A 3MZLA 2B5MA 2Z2PA 3CFVA 1GXRA 2P9SC 2OJYA 4I79A 2IURA 3F3GA 2I0RA 3I2NA 2UZXB 4XEIC 5AJAA 3CIKB 4O1QD 3OKWA 3SBQA 4UI9R 5H14A 3OKTA 4ESGA 1TYQC 4PXWA 3I7PA 3EI1A 4A08A 1JJUB 4Z8LA 4A11B 2H6NA 1N6EA 2P9LC 4PSXB 4ES0A 5CXCA 3PSLA 2EBSA 1SHYB 4JD2C 5C9ZB 1NR0A 4R7AB 3GFCA 4A7JA 2CE9A 4JSXC 3PE7A 5TEFA 3MZKA 4KFMB 5IJ8E 3EWEA 3PSCB 4GQ1A 2AGWA 4XYIA 3JZHA 2OK6A 1R5MA 5FKTA 4J84A 3AH8B 2CO0C 2YNPA 4ZOVA 2QXVA 4J0WA 2GNQA 3I7KA 3RFGA 5CYKB 1GOTB 4A2LA 4PBYA 3E0CA 3OTTA 4HDJA 4ERYA 2HYEA 2I0SA 4CI1A 5TF2A 1PGUA 1NEXB 3K26A 4CY5A 3IJ1A 4J73A 2OVQB 4U1EI 1XIPA 5HE2B 4JSNC 2PM9A 2YNNA 5EAPA 3UR4A 3HFQA 5FQDA 2B5NA 5JWZA 3OL2B 3BWSA 5CXBA 3I7LA 3P4FA 3ULEC 3L4OD 3SJLD 3EI3A 5B4WA 1RI6A 2HXCA 5C2VB 4FAND 3FRXA
chains in the Genus database with same CATH superfamily
3I7OA 3EQ9A 4OWRA 1P22A 1OMWB 3ODTA 1UOQA 4J8GA 2CN3A 1MDAH 2OVPB 3JZGA 5FFGA 1ERJA 3K27A 4ERZA 3V9FA 5IT9g 1BPOA 3AL8B 3RFHA 4L1MA 2HU5A 1JV2A 3ZWLB 4CI3A 4QQEA 2CO0A 4J81A 4FA4D 3J81g 3J80g 2I3SA 3PXSD 4DNWA 1H2XA 3IURA 4ZOXA 5GXHA 4A0AA 5HE3B 1QFSA 4JSVC 3UKRC 4E5ZB 4MMXA 4WK4A 5HQGA 3FCSA 2OIZA 3UVKA 2VZ3A 4J0XA 3O4HA 2H9PA 1K3IA 1MG3A 4JT6C 3SHFA 3UVLA 3VGZA 4CC9A 2IUPA 3FGBA 5E6UA 1JOFA 3O4GA 5FFOA 1E5TA 1JMZB 2Z2OA 3F3FA 3QHYB 2XU7A 2MTAH 5EM2A 5THAA 1PI6A 4AN0A 5IGQA 4L3HD 3PXWD 5M5UA 2PM6B 4NSXA 4X63B 3SWSD 3SLED 5C92A 2VDQA 4Y5RD 5SXMA 5FLXg 2YNOA 2H68A 4BCDA 4J77A 3SFZA 3VA6A 4GM3A 3RN1D 3GC3B 5GSAA 2P9UC 2WQ8A 2CN2A 3UVOA 2EIDA 4AMZA 3IIWA 4QRJA 2P9PC 1VE6A 3BG0A 4N14A 4GGDA 4GQ2P 2IWFA 5CYKA 3DXKC 4ZOYA 5C2WB 3L4MD 3OF7A 4L9OA 5EMLB 4BCBA 2VDKA 3MXXA 4L3GD 3NVQA 2AGXA 1XKSA 4BL0A 1U2VC 3C99A 3JRPA 4J79A 4U7AA 3KRXB 3JROA 2OVRB 2HU7A 1C9IA 3RN0D 3UKUC 2VDPA 1H2WA 5GXIA 2XYIA 3OKYA 2I0TA 4PC0A 4FAVD 2HJBA 4FA9D 4A09B 4O02A 1TYEA 1K32A 1PBYB 4JT5C 2H9NA 3UVMA 4O2WA 4GZ8A 4H5IA 3A0FA 4WK2A 1OLZA 2AH1A 5CXCB 4QT8A 1U4CA 3N0EA 4A0BB 4LGNA 3AL9A 2BKLA 2XE4A 3GD1I 2GC7A 3IULA 3SCYA 3VI3A 4ZN4A 3JB9L 4NBMA 4X3EA 4CY1A 4WJKA 5KDOB 3AL8A 4RE6A 5FKQA 3RRMC 4J8BA 2Q7QA 3U4YA 1A12A 2AQ5A 3KRWB 4D6VA 4LG8A 1YFQA 4AN1A 4MMZA 4ZOZA 3EU7A 2IAAA 5TEEA 3FM0A 4X60B 2G99A 4JSPC 2H13A 5HE1B 4LG9A 3K71A 4OZUA 2P9KC 1C9LA 3SN6B 4E5ZA 4IA9A 5E6RA 3MKQA 1H2ZA 3ZE1A 4IMMA 2XDWA 3NVXA 5EMJB 4JXMA 3T3PA 2VDOA 5IJ7E 5I5JA 3IIYA 1QFMA 3DXMC 4GMBA 5H17A 3SVWD 2CNXA 2HKMA 2VDNA 2HU8A 4YVDA 5EARA 3C9CA 4JHNA 2YMUA 4J78A 2P9NC 2P9IC 2EICA 1SQ9A 3C5MA 3IUQA 5HE0B 3ZE2A 4PBZA 3SXTD 2VZ1A 5GMKn 2CE8A 4A11A 2YBAA 5IGOA 3I8EA 3EG6A 4PNKB 1K8KC 3F3PA 4H5JA 3V4PA 5EAMA 4PSWB 4CY3A 4BH6A 3ORVD 1U8CA 3IUJA 4Z7QA 5A2Qg 2IUVA 1FWXA 3JAMg 2HESX 4CZXA 4GGAA 1S4UX 2EIEA 1QNIA 3C75H 1GP2B 4GM9A 5AFU3 5C2VB 1SQJA 1L0QA 1UOPA 2BBKH 4K3JB 2TRCB 3NVNA 4A2MA 1JTDB 4UM8A 4A0AB 2O9KA 3EI2B 3T3MA 4E54B 4CZYA 3ZDXA 1VZ3A 2UZYB 2XL2A 4ERQA 1A0RB 4Y7RA 1UOOA 5IC7A 5I5MA 1L5GA 3V7DB 2HJ4A 3DM0A 3EI4B 4A09A 4BUJC 4AOWA 3PVUB 4FA5D 4TZ4A 3AFCA 4AX4A 5FKRA 2JKXA 4MK0B 2AGLA 2H6QA 4J87A 4FWWA 3IVMA 5EM2B 3MMYA 4CY2A 5M5VA 4A0BA 1XHMA 2J57G 2OK4A 3NIFA 3ZDZA 3B7FA 3IJEA 2VDLA 2YB8B 2Z2NA 3RLMD 3EI1B 5FA5B 4A08B 3IKOA 3OL2A 3V4VA 4GGCA 2QZPA 1GOHA 3JZNA 2H14A 3I7HA 1B9YA 3KCIA 5TDHB 4O3TB 5H1MA 3VH0A 2J56H 4QL1A 2J55H 2H9MA 5K1CC 3W15A 5M5RA 2QC5A 3EQ8A 4K3ID 3EMHA 2B4EA 3IUMA 2PM7B 3DSMA 4NENA 2XZGA 2H9LA 3PXTD 1GG2B 2EIBA 3OW8A 1JMXB 4O9DA 4G56B 2IUQA 3I89A 4FB1D 5AMSA 1Q47A 4CZVA 2W18A 4XYHA 4FA1D 1MG2A 5EALA 3MUNA 3IJ0A 3RMZD 3OKYB 4NC4A 2H6KA 3V5WB 3I8CA 1B9XA 2AGYA 5I5IA 3JPXA 5M61A 3SBPA 4O45A 4X61B 4G55A 3UVNA 3DWLC 4D0KA 3SBRA 5FXYA 2I3TA 1N6DA 4GM8A 4GQBB 3GREA 4FHLA 3CFSB 3MKSB 2VDRA 3N0DA 1PEVA 2H47A 4AEZA 4J86A 4IRZA 3BG1A 4CI8A 5EMMB 2PM9B 5HYNB 5C86A 4J82A 3QI0A 5EMKB 2HKRA 3SMRA 2PBIB 5CXBB 4JHPC 3RSEC 3FCUA 3I7NA 3ZDYA 2AGZA 2VC2A 3NIDA 1TBGA 1I2MB 2XL3A 3EI3B 3PVWB 2AH0A 1N6FA 3O4JA 1VYHC 2H3XA 2G9AA 2B5LA 3VI4A 4L1QD 4CI2A 2IWKA 3IJCA 5FKSA 1GOFA 4O3UB 3O4IA 5K19A 2GC4A 4EWRA 3EI2A 4E54A 1YR2A 4WK0A 2BCJB 4DNVA 3EI4A 3MZLA 2B5MA 2Z2PA 3CFVA 1GXRA 2P9SC 2OJYA 4I79A 2IURA 3F3GA 3MUOA 2I0RA 4RE5A 3I2NA 4UM9A 3ZE0A 2UZXB 4XEIC 2QR5A 4G1EA 1VE7A 5AJAA 3CIKB 4O1QD 3OKWA 3SBQA 4UI9R 5E6SA 5M5SA 5H14A 3OKTA 4ESGA 1TYQC 4PXWA 3I7PA 3EI1A 4A08A 4G1MA 1JJUB 4Z8LA 4A11B 2H6NA 1VZ2A 1N6EA 2P9LC 4PSXB 4BP8A 4ES0A 4AMYA 5CXCA 3IUNA 3PSLA 2EBSA 1SHYB 4JD2C 4MMYA 5C9ZB 2VDMA 3K6SA 1NR0A 1E8NA 4R7AB 3GFCA 4A7JA 2CE9A 4JSXC 3PE7A 5TEFA 4Z7NA 3MZKA 4KFMB 5IJ8E 3EWEA 3PSCB 4GQ1A 2AGWA 4XYIA 3JZHA 2OK6A 1R5MA 3K72A 1O6FA 5FKTA 4J84A 3AH8B 2CO0C 2YNPA 4ZOVA 3EQ7A 2QXVA 4J0WA 2GNQA 3I7KA 3RFGA 5CYKB 1O6GA 1GOTB 4A2LA 4PBYA 3E0CA 3MVDK 3OTTA 4HDJA 4ERYA 5M5TA 2HYEA 2I0SA 4CI1A 5TF2A 4BCCA 1PGUA 1T2XA 1NEXB 3K26A 4CY5A 1M1XA 3IJ1A 4J73A 2OVQB 4U1EI 1XIPA 5HE2B 1GOGA 4JSNC 2PM9A 2YNNA 5EAPA 4QAMA 3UR4A 3HFQA 4D9SA 4DNUA 5FQDA 2B5NA 1E8MA 5JWZA 3OL2B 3BWSA 5CXBA 1UTCA 3I7LA 3P4FA 3DDUA 3ULEC 3L4OD 3SJLD 4Z7OA 3EI3A 4NAAA 5B4WA 1RI6A 2HXCA 1H2YA 4BP9A 5HDBA 3NIGA 4FAND 3FRXA
chains in the Genus database with same CATH topology
3I7OA 4OWRA 1P22A 1OMWB 3ODTA 4J8GA 2CN3A 1MDAH 2OVPB 3JZGA 1ERJA 3K27A 4ERZA 3V9FA 5IT9g 3AL8B 3RFHA 3ZWLB 4CI3A 4QQEA 2CO0A 4J81A 4FA4D 3J81g 3J80g 2I3SA 3PXSD 4ZOXA 5GXHA 4A0AA 5HE3B 4JSVC 3UKRC 4E5ZB 5HQGA 3UVKA 2OIZA 4J0XA 2H9PA 1MG3A 3SHFA 4JT6C 3UVLA 3VGZA 4CC9A 2IUPA 3FGBA 1JOFA 1JMZB 2Z2OA 3F3FA 2XU7A 2MTAH 5EM2A 5THAA 1PI6A 5IGQA 4L3HD 3PXWD 2PM6B 4NSXA 4X63B 3SWSD 3SLED 5FLXg 4Y5RD 5SXMA 2YNOA 2H68A 4J77A 3SFZA 3VA6A 4GM3A 3RN1D 5GSAA 2P9UC 2CN2A 3UVOA 3IIWA 4QRJA 2P9PC 3BG0A 4N14A 4GGDA 4GQ2P 2IWFA 5CYKA 3DXKC 4ZOYA 5C2WB 3L4MD 4L9OA 5EMLB 3MXXA 4L3GD 3NVQA 2AGXA 1XKSA 4BL0A 1U2VC 3C99A 3JRPA 4J79A 4U7AA 3KRXB 3JROA 2OVRB 3RN0D 3UKUC 5GXIA 2XYIA 3OKYA 2I0TA 4PC0A 4FAVD 2HJBA 4FA9D 4A09B 1K32A 1PBYB 4JT5C 2H9NA 3UVMA 4GZ8A 4H5IA 3A0FA 1OLZA 2AH1A 5CXCB 4QT8A 1U4CA 3N0EA 4A0BB 4LGNA 3AL9A 2GC7A 3SCYA 4ZN4A 3JB9L 4X3EA 4CY1A 5KDOB 3AL8A 5FKQA 3RRMC 4J8BA 2Q7QA 3U4YA 2AQ5A 3KRWB 4D6VA 4LG8A 1YFQA 4ZOZA 3EU7A 2IAAA 5TEEA 3FM0A 4X60B 2G99A 4JSPC 2H13A 5HE1B 4LG9A 4OZUA 2P9KC 3SN6B 4E5ZA 4IA9A 3MKQA 4IMMA 3NVXA 5EMJB 4JXMA 5IJ7E 5I5JA 3IIYA 3DXMC 4GMBA 5H17A 3SVWD 2CNXA 2HKMA 4YVDA 5EARA 3C9CA 2YMUA 4J78A 2P9NC 2P9IC 1SQ9A 3C5MA 5HE0B 4PBZA 3SXTD 5GMKn 2CE8A 4A11A 2YBAA 5IGOA 3I8EA 3EG6A 4PNKB 1K8KC 3F3PA 4H5JA 5EAMA 4PSWB 4CY3A 4BH6A 3ORVD 5A2Qg 2IUVA 1FWXA 3JAMg 2HESX 4CZXA 4GGAA 1S4UX 1QNIA 3C75H 1GP2B 4GM9A 5AFU3 1SQJA 1L0QA 2BBKH 4K3JB 2TRCB 3NVNA 4A2MA 4A0AB 2O9KA 3EI2B 4E54B 4CZYA 2UZYB 2XL2A 4ERQA 1A0RB 4Y7RA 5IC7A 5I5MA 3V7DB 2HJ4A 3DM0A 3EI4B 4A09A 4BUJC 4AOWA 3PVUB 4FA5D 4TZ4A 3AFCA 5FKRA 4MK0B 2AGLA 2H6QA 4J87A 4FWWA 5EM2B 3MMYA 4CY2A 4A0BA 1XHMA 2J57G 2OK4A 3B7FA 2YB8B 2Z2NA 3RLMD 3EI1B 5FA5B 4A08B 3IKOA 3OL2A 4GGCA 3JZNA 2H14A 3I7HA 1B9YA 5TDHB 4O3TB 5H1MA 3VH0A 2J56H 4QL1A 2J55H 2H9MA 5K1CC 3W15A 2QC5A 4K3ID 3EMHA 2B4EA 2PM7B 3DSMA 2H9LA 3PXTD 1GG2B 3OW8A 1JMXB 4O9DA 4G56B 2IUQA 3I89A 4FB1D 5AMSA 1Q47A 4CZVA 2W18A 4XYHA 4FA1D 1MG2A 5EALA 3RMZD 3IJ0A 3OKYB 2H6KA 3V5WB 3I8CA 1B9XA 2AGYA 5I5IA 3JPXA 3SBPA 4O45A 4X61B 3UVNA 3DWLC 4D0KA 3SBRA 5FXYA 2I3TA 1N6DA 4GM8A 4GQBB 3GREA 4FHLA 3CFSB 3MKSB 3N0DA 1PEVA 2H47A 4AEZA 4J86A 3BG1A 4CI8A 5EMMB 2PM9B 5HYNB 4J82A 5EMKB 2HKRA 3SMRA 2PBIB 5CXBB 3RSEC 3I7NA 2AGZA 1TBGA 2XL3A 3EI3B 3PVWB 2AH0A 1N6FA 1VYHC 2H3XA 2G9AA 2B5LA 4L1QD 4CI2A 2IWKA 3IJCA 5FKSA 4O3UB 5K19A 2GC4A 4EWRA 3EI2A 4E54A 2BCJB 3EI4A 3MZLA 2B5MA 2Z2PA 3CFVA 1GXRA 2P9SC 2OJYA 4I79A 2IURA 3F3GA 2I0RA 3I2NA 2UZXB 4XEIC 5AJAA 3CIKB 4O1QD 3OKWA 3SBQA 4UI9R 5H14A 3OKTA 4ESGA 1TYQC 4PXWA 3I7PA 3EI1A 4A08A 1JJUB 4Z8LA 4A11B 2H6NA 1N6EA 2P9LC 4PSXB 4ES0A 5CXCA 3PSLA 2EBSA 1SHYB 4JD2C 5C9ZB 1NR0A 4R7AB 3GFCA 4A7JA 2CE9A 4JSXC 3PE7A 5TEFA 3MZKA 4KFMB 5IJ8E 3EWEA 3PSCB 4GQ1A 2AGWA 4XYIA 3JZHA 2OK6A 1R5MA 5FKTA 4J84A 3AH8B 2CO0C 2YNPA 4ZOVA 2QXVA 4J0WA 2GNQA 3I7KA 3RFGA 5CYKB 1GOTB 4A2LA 4PBYA 3E0CA 3OTTA 4HDJA 4ERYA 2HYEA 2I0SA 4CI1A 5TF2A 1PGUA 1NEXB 3K26A 4CY5A 3IJ1A 4J73A 2OVQB 4U1EI 1XIPA 5HE2B 4JSNC 2PM9A 2YNNA 5EAPA 3UR4A 3HFQA 5FQDA 2B5NA 5JWZA 3OL2B 3BWSA 5CXBA 3I7LA 3P4FA 3ULEC 3L4OD 3SJLD 3EI3A 5B4WA 1RI6A 2HXCA 5C2VB 4FAND 3FRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7O A;  4OWR A;  1P22 A;  1OMW B;  3ODT A;  4J8G A;  2CN3 A;  1MDA H;  2OVP B;  3JZG A;  1ERJ A;  3K27 A;  4ERZ A;  3V9F A;  5IT9 g;  3AL8 B;  3RFH A;  3ZWL B;  4CI3 A;  4QQE A;  2CO0 A;  4J81 A;  4FA4 D;  3J81 g;  3J80 g;  2I3S A;  3PXS D;  4ZOX A;  5GXH A;  4A0A A;  5HE3 B;  4JSV C;  3UKR C;  4E5Z B;  5HQG A;  3UVK A;  2OIZ A;  4J0X A;  2H9P A;  1MG3 A;  3SHF A;  4JT6 C;  3UVL A;  3VGZ A;  4CC9 A;  2IUP A;  3FGB A;  1JOF A;  1JMZ B;  2Z2O A;  3F3F A;  2XU7 A;  2MTA H;  5EM2 A;  5THA A;  1PI6 A;  5IGQ A;  4L3H D;  3PXW D;  2PM6 B;  4NSX A;  4X63 B;  3SWS D;  3SLE D;  5FLX g;  4Y5R D;  5SXM A;  2YNO A;  2H68 A;  4J77 A;  3SFZ A;  3VA6 A;  4GM3 A;  3RN1 D;  5GSA A;  2P9U C;  2CN2 A;  3UVO A;  3IIW A;  4QRJ A;  2P9P C;  3BG0 A;  4N14 A;  4GGD A;  4GQ2 P;  2IWF A;  5CYK A;  3DXK C;  4ZOY A;  5C2W B;  3L4M D;  4L9O A;  5EML B;  3MXX A;  4L3G D;  3NVQ A;  2AGX A;  1XKS A;  4BL0 A;  1U2V C;  3C99 A;  3JRP A;  4J79 A;  4U7A A;  3KRX B;  3JRO A;  2OVR B;  3RN0 D;  3UKU C;  5GXI A;  2XYI A;  3OKY A;  2I0T A;  4PC0 A;  4FAV D;  2HJB A;  4FA9 D;  4A09 B;  1K32 A;  1PBY B;  4JT5 C;  2H9N A;  3UVM A;  4GZ8 A;  4H5I A;  3A0F A;  1OLZ A;  2AH1 A;  5CXC B;  4QT8 A;  1U4C A;  3N0E A;  4A0B B;  4LGN A;  3AL9 A;  2GC7 A;  3SCY A;  4ZN4 A;  3JB9 L;  4X3E A;  4CY1 A;  5KDO B;  3AL8 A;  5FKQ A;  3RRM C;  4J8B A;  2Q7Q A;  3U4Y A;  2AQ5 A;  3KRW B;  4D6V A;  4LG8 A;  1YFQ A;  4ZOZ A;  3EU7 A;  2IAA A;  5TEE A;  3FM0 A;  4X60 B;  2G99 A;  4JSP C;  2H13 A;  5HE1 B;  4LG9 A;  4OZU A;  2P9K C;  3SN6 B;  4E5Z A;  4IA9 A;  3MKQ A;  4IMM A;  3NVX A;  5EMJ B;  4JXM A;  5IJ7 E;  5I5J A;  3IIY A;  3DXM C;  4GMB A;  5H17 A;  3SVW D;  2CNX A;  2HKM A;  4YVD A;  5EAR A;  3C9C A;  2YMU A;  4J78 A;  2P9N C;  2P9I C;  1SQ9 A;  3C5M A;  5HE0 B;  4PBZ A;  3SXT D;  5GMK n;  2CE8 A;  4A11 A;  2YBA A;  5IGO A;  3I8E A;  3EG6 A;  4PNK B;  1K8K C;  3F3P A;  4H5J A;  5EAM A;  4PSW B;  4CY3 A;  4BH6 A;  3ORV D;  5A2Q g;  2IUV A;  1FWX A;  3JAM g;  2HES X;  4CZX A;  4GGA A;  1S4U X;  1QNI A;  3C75 H;  1GP2 B;  4GM9 A;  5AFU 3;  1SQJ A;  1L0Q A;  2BBK H;  4K3J B;  2TRC B;  3NVN A;  4A2M A;  4A0A B;  2O9K A;  3EI2 B;  4E54 B;  4CZY A;  2UZY B;  2XL2 A;  4ERQ A;  1A0R B;  4Y7R A;  5IC7 A;  5I5M A;  3V7D B;  2HJ4 A;  3DM0 A;  3EI4 B;  4A09 A;  4BUJ C;  4AOW A;  3PVU B;  4FA5 D;  4TZ4 A;  3AFC A;  5FKR A;  4MK0 B;  2AGL A;  2H6Q A;  4J87 A;  4FWW A;  5EM2 B;  3MMY A;  4CY2 A;  4A0B A;  1XHM A;  2J57 G;  2OK4 A;  3B7F A;  2YB8 B;  2Z2N A;  3RLM D;  3EI1 B;  5FA5 B;  4A08 B;  3IKO A;  3OL2 A;  4GGC A;  3JZN A;  2H14 A;  3I7H A;  1B9Y A;  5TDH B;  4O3T B;  5H1M A;  3VH0 A;  2J56 H;  4QL1 A;  2J55 H;  2H9M A;  5K1C C;  3W15 A;  2QC5 A;  4K3I D;  3EMH A;  2B4E A;  2PM7 B;  3DSM A;  2H9L A;  3PXT D;  1GG2 B;  3OW8 A;  1JMX B;  4O9D A;  4G56 B;  2IUQ A;  3I89 A;  4FB1 D;  5AMS A;  1Q47 A;  4CZV A;  2W18 A;  4XYH A;  4FA1 D;  1MG2 A;  5EAL A;  3RMZ D;  3IJ0 A;  3OKY B;  2H6K A;  3V5W B;  3I8C A;  1B9X A;  2AGY A;  5I5I A;  3JPX A;  3SBP A;  4O45 A;  4X61 B;  3UVN A;  3DWL C;  4D0K A;  3SBR A;  5FXY A;  2I3T A;  1N6D A;  4GM8 A;  4GQB B;  3GRE A;  4FHL A;  3CFS B;  3MKS B;  3N0D A;  1PEV A;  2H47 A;  4AEZ A;  4J86 A;  3BG1 A;  4CI8 A;  5EMM B;  2PM9 B;  5HYN B;  4J82 A;  5EMK B;  2HKR A;  3SMR A;  2PBI B;  5CXB B;  3RSE C;  3I7N A;  2AGZ A;  1TBG A;  2XL3 A;  3EI3 B;  3PVW B;  2AH0 A;  1N6F A;  1VYH C;  2H3X A;  2G9A A;  2B5L A;  4L1Q D;  4CI2 A;  2IWK A;  3IJC A;  5FKS A;  4O3U B;  5K19 A;  2GC4 A;  4EWR A;  3EI2 A;  4E54 A;  2BCJ B;  3EI4 A;  3MZL A;  2B5M A;  2Z2P A;  3CFV A;  1GXR A;  2P9S C;  2OJY A;  4I79 A;  2IUR A;  3F3G A;  2I0R A;  3I2N A;  2UZX B;  4XEI C;  5AJA A;  3CIK B;  4O1Q D;  3OKW A;  3SBQ A;  4UI9 R;  5H14 A;  3OKT A;  4ESG A;  1TYQ C;  4PXW A;  3I7P A;  3EI1 A;  4A08 A;  1JJU B;  4Z8L A;  4A11 B;  2H6N A;  1N6E A;  2P9L C;  4PSX B;  4ES0 A;  5CXC A;  3PSL A;  2EBS A;  1SHY B;  4JD2 C;  5C9Z B;  1NR0 A;  4R7A B;  3GFC A;  4A7J A;  2CE9 A;  4JSX C;  3PE7 A;  5TEF A;  3MZK A;  4KFM B;  5IJ8 E;  3EWE A;  3PSC B;  4GQ1 A;  2AGW A;  4XYI A;  3JZH A;  2OK6 A;  1R5M A;  5FKT A;  4J84 A;  3AH8 B;  2CO0 C;  2YNP A;  4ZOV A;  2QXV A;  4J0W A;  2GNQ A;  3I7K A;  3RFG A;  5CYK B;  1GOT B;  4A2L A;  4PBY A;  3E0C A;  3OTT A;  4HDJ A;  4ERY A;  2HYE A;  2I0S A;  4CI1 A;  5TF2 A;  1PGU A;  1NEX B;  3K26 A;  4CY5 A;  3IJ1 A;  4J73 A;  2OVQ B;  4U1E I;  1XIP A;  5HE2 B;  4JSN C;  2PM9 A;  2YNN A;  5EAP A;  3UR4 A;  3HFQ A;  5FQD A;  2B5N A;  5JWZ A;  3OL2 B;  3BWS A;  5CXB A;  3I7L A;  3P4F A;  3ULE C;  3L4O D;  3SJL D;  3EI3 A;  5B4W A;  1RI6 A;  2HXC A;  5C2V B;  4FAN D;  3FRX A; 
#chains in the Genus database with same CATH topology
 3I7O A;  3EQ9 A;  4OWR A;  1P22 A;  1OMW B;  3ODT A;  1UOQ A;  4J8G A;  2CN3 A;  1MDA H;  2OVP B;  3JZG A;  5FFG A;  1ERJ A;  3K27 A;  4ERZ A;  3V9F A;  5IT9 g;  1BPO A;  3AL8 B;  3RFH A;  4L1M A;  2HU5 A;  1JV2 A;  3ZWL B;  4CI3 A;  4QQE A;  2CO0 A;  4J81 A;  4FA4 D;  3J81 g;  3J80 g;  2I3S A;  3PXS D;  4DNW A;  1H2X A;  3IUR A;  4ZOX A;  5GXH A;  4A0A A;  5HE3 B;  1QFS A;  4JSV C;  3UKR C;  4E5Z B;  4MMX A;  4WK4 A;  5HQG A;  3FCS A;  2OIZ A;  3UVK A;  2VZ3 A;  4J0X A;  3O4H A;  2H9P A;  1K3I A;  1MG3 A;  4JT6 C;  3SHF A;  3UVL A;  3VGZ A;  4CC9 A;  2IUP A;  3FGB A;  5E6U A;  1JOF A;  3O4G A;  5FFO A;  1E5T A;  1JMZ B;  2Z2O A;  3F3F A;  3QHY B;  2XU7 A;  2MTA H;  5EM2 A;  5THA A;  1PI6 A;  4AN0 A;  5IGQ A;  4L3H D;  3PXW D;  5M5U A;  2PM6 B;  4NSX A;  4X63 B;  3SWS D;  3SLE D;  5C92 A;  2VDQ A;  4Y5R D;  5SXM A;  5FLX g;  2YNO A;  2H68 A;  4BCD A;  4J77 A;  3SFZ A;  3VA6 A;  4GM3 A;  3RN1 D;  3GC3 B;  5GSA A;  2P9U C;  2WQ8 A;  2CN2 A;  3UVO A;  2EID A;  4AMZ A;  3IIW A;  4QRJ A;  2P9P C;  1VE6 A;  3BG0 A;  4N14 A;  4GGD A;  4GQ2 P;  2IWF A;  5CYK A;  3DXK C;  4ZOY A;  5C2W B;  3L4M D;  3OF7 A;  4L9O A;  5EML B;  4BCB A;  2VDK A;  3MXX A;  4L3G D;  3NVQ A;  2AGX A;  1XKS A;  4BL0 A;  1U2V C;  3C99 A;  3JRP A;  4J79 A;  4U7A A;  3KRX B;  3JRO A;  2OVR B;  2HU7 A;  1C9I A;  3RN0 D;  3UKU C;  2VDP A;  1H2W A;  5GXI A;  2XYI A;  3OKY A;  2I0T A;  4PC0 A;  4FAV D;  2HJB A;  4FA9 D;  4A09 B;  4O02 A;  1TYE A;  1K32 A;  1PBY B;  4JT5 C;  2H9N A;  3UVM A;  4O2W A;  4GZ8 A;  4H5I A;  3A0F A;  4WK2 A;  1OLZ A;  2AH1 A;  5CXC B;  4QT8 A;  1U4C A;  3N0E A;  4A0B B;  4LGN A;  3AL9 A;  2BKL A;  2XE4 A;  3GD1 I;  2GC7 A;  3IUL A;  3SCY A;  3VI3 A;  4ZN4 A;  3JB9 L;  4NBM A;  4X3E A;  4CY1 A;  4WJK A;  5KDO B;  3AL8 A;  4RE6 A;  5FKQ A;  3RRM C;  4J8B A;  2Q7Q A;  3U4Y A;  1A12 A;  2AQ5 A;  3KRW B;  4D6V A;  4LG8 A;  1YFQ A;  4AN1 A;  4MMZ A;  4ZOZ A;  3EU7 A;  2IAA A;  5TEE A;  3FM0 A;  4X60 B;  2G99 A;  4JSP C;  2H13 A;  5HE1 B;  4LG9 A;  3K71 A;  4OZU A;  2P9K C;  1C9L A;  3SN6 B;  4E5Z A;  4IA9 A;  5E6R A;  3MKQ A;  1H2Z A;  3ZE1 A;  4IMM A;  2XDW A;  3NVX A;  5EMJ B;  4JXM A;  3T3P A;  2VDO A;  5IJ7 E;  5I5J A;  3IIY A;  1QFM A;  3DXM C;  4GMB A;  5H17 A;  3SVW D;  2CNX A;  2HKM A;  2VDN A;  2HU8 A;  4YVD A;  5EAR A;  3C9C A;  4JHN A;  2YMU A;  4J78 A;  2P9N C;  2P9I C;  2EIC A;  1SQ9 A;  3C5M A;  3IUQ A;  5HE0 B;  3ZE2 A;  4PBZ A;  3SXT D;  2VZ1 A;  5GMK n;  2CE8 A;  4A11 A;  2YBA A;  5IGO A;  3I8E A;  3EG6 A;  4PNK B;  1K8K C;  3F3P A;  4H5J A;  3V4P A;  5EAM A;  4PSW B;  4CY3 A;  4BH6 A;  3ORV D;  1U8C A;  3IUJ A;  4Z7Q A;  5A2Q g;  2IUV A;  1FWX A;  3JAM g;  2HES X;  4CZX A;  4GGA A;  1S4U X;  2EIE A;  1QNI A;  3C75 H;  1GP2 B;  4GM9 A;  5AFU 3;  5C2V B;  1SQJ A;  1L0Q A;  1UOP A;  2BBK H;  4K3J B;  2TRC B;  3NVN A;  4A2M A;  1JTD B;  4UM8 A;  4A0A B;  2O9K A;  3EI2 B;  3T3M A;  4E54 B;  4CZY A;  3ZDX A;  1VZ3 A;  2UZY B;  2XL2 A;  4ERQ A;  1A0R B;  4Y7R A;  1UOO A;  5IC7 A;  5I5M A;  1L5G A;  3V7D B;  2HJ4 A;  3DM0 A;  3EI4 B;  4A09 A;  4BUJ C;  4AOW A;  3PVU B;  4FA5 D;  4TZ4 A;  3AFC A;  4AX4 A;  5FKR A;  2JKX A;  4MK0 B;  2AGL A;  2H6Q A;  4J87 A;  4FWW A;  3IVM A;  5EM2 B;  3MMY A;  4CY2 A;  5M5V A;  4A0B A;  1XHM A;  2J57 G;  2OK4 A;  3NIF A;  3ZDZ A;  3B7F A;  3IJE A;  2VDL A;  2YB8 B;  2Z2N A;  3RLM D;  3EI1 B;  5FA5 B;  4A08 B;  3IKO A;  3OL2 A;  3V4V A;  4GGC A;  2QZP A;  1GOH A;  3JZN A;  2H14 A;  3I7H A;  1B9Y A;  3KCI A;  5TDH B;  4O3T B;  5H1M A;  3VH0 A;  2J56 H;  4QL1 A;  2J55 H;  2H9M A;  5K1C C;  3W15 A;  5M5R A;  2QC5 A;  3EQ8 A;  4K3I D;  3EMH A;  2B4E A;  3IUM A;  2PM7 B;  3DSM A;  4NEN A;  2XZG A;  2H9L A;  3PXT D;  1GG2 B;  2EIB A;  3OW8 A;  1JMX B;  4O9D A;  4G56 B;  2IUQ A;  3I89 A;  4FB1 D;  5AMS A;  1Q47 A;  4CZV A;  2W18 A;  4XYH A;  4FA1 D;  1MG2 A;  5EAL A;  3MUN A;  3IJ0 A;  3RMZ D;  3OKY B;  4NC4 A;  2H6K A;  3V5W B;  3I8C A;  1B9X A;  2AGY A;  5I5I A;  3JPX A;  5M61 A;  3SBP A;  4O45 A;  4X61 B;  4G55 A;  3UVN A;  3DWL C;  4D0K A;  3SBR A;  5FXY A;  2I3T A;  1N6D A;  4GM8 A;  4GQB B;  3GRE A;  4FHL A;  3CFS B;  3MKS B;  2VDR A;  3N0D A;  1PEV A;  2H47 A;  4AEZ A;  4J86 A;  4IRZ A;  3BG1 A;  4CI8 A;  5EMM B;  2PM9 B;  5HYN B;  5C86 A;  4J82 A;  3QI0 A;  5EMK B;  2HKR A;  3SMR A;  2PBI B;  5CXB B;  4JHP C;  3RSE C;  3FCU A;  3I7N A;  3ZDY A;  2AGZ A;  2VC2 A;  3NID A;  1TBG A;  1I2M B;  2XL3 A;  3EI3 B;  3PVW B;  2AH0 A;  1N6F A;  3O4J A;  1VYH C;  2H3X A;  2G9A A;  2B5L A;  3VI4 A;  4L1Q D;  4CI2 A;  2IWK A;  3IJC A;  5FKS A;  1GOF A;  4O3U B;  3O4I A;  5K19 A;  2GC4 A;  4EWR A;  3EI2 A;  4E54 A;  1YR2 A;  4WK0 A;  2BCJ B;  4DNV A;  3EI4 A;  3MZL A;  2B5M A;  2Z2P A;  3CFV A;  1GXR A;  2P9S C;  2OJY A;  4I79 A;  2IUR A;  3F3G A;  3MUO A;  2I0R A;  4RE5 A;  3I2N A;  4UM9 A;  3ZE0 A;  2UZX B;  4XEI C;  2QR5 A;  4G1E A;  1VE7 A;  5AJA A;  3CIK B;  4O1Q D;  3OKW A;  3SBQ A;  4UI9 R;  5E6S A;  5M5S A;  5H14 A;  3OKT A;  4ESG A;  1TYQ C;  4PXW A;  3I7P A;  3EI1 A;  4A08 A;  4G1M A;  1JJU B;  4Z8L A;  4A11 B;  2H6N A;  1VZ2 A;  1N6E A;  2P9L C;  4PSX B;  4BP8 A;  4ES0 A;  4AMY A;  5CXC A;  3IUN A;  3PSL A;  2EBS A;  1SHY B;  4JD2 C;  4MMY A;  5C9Z B;  2VDM A;  3K6S A;  1NR0 A;  1E8N A;  4R7A B;  3GFC A;  4A7J A;  2CE9 A;  4JSX C;  3PE7 A;  5TEF A;  4Z7N A;  3MZK A;  4KFM B;  5IJ8 E;  3EWE A;  3PSC B;  4GQ1 A;  2AGW A;  4XYI A;  3JZH A;  2OK6 A;  1R5M A;  3K72 A;  1O6F A;  5FKT A;  4J84 A;  3AH8 B;  2CO0 C;  2YNP A;  4ZOV A;  3EQ7 A;  2QXV A;  4J0W A;  2GNQ A;  3I7K A;  3RFG A;  5CYK B;  1O6G A;  1GOT B;  4A2L A;  4PBY A;  3E0C A;  3MVD K;  3OTT A;  4HDJ A;  4ERY A;  5M5T A;  2HYE A;  2I0S A;  4CI1 A;  5TF2 A;  4BCC A;  1PGU A;  1T2X A;  1NEX B;  3K26 A;  4CY5 A;  1M1X A;  3IJ1 A;  4J73 A;  2OVQ B;  4U1E I;  1XIP A;  5HE2 B;  1GOG A;  4JSN C;  2PM9 A;  2YNN A;  5EAP A;  4QAM A;  3UR4 A;  3HFQ A;  4D9S A;  4DNU A;  5FQD A;  2B5N A;  1E8M A;  5JWZ A;  3OL2 B;  3BWS A;  5CXB A;  1UTC A;  3I7L A;  3P4F A;  3DDU A;  3ULE C;  3L4O D;  3SJL D;  4Z7O A;  3EI3 A;  4NAA A;  5B4W A;  1RI6 A;  2HXC A;  1H2Y A;  4BP9 A;  5HDB A;  3NIG A;  4FAN D;  3FRX A; 
#chains in the Genus database with same CATH homology
 3I7O A;  4OWR A;  1P22 A;  1OMW B;  3ODT A;  4J8G A;  2CN3 A;  1MDA H;  2OVP B;  3JZG A;  1ERJ A;  3K27 A;  4ERZ A;  3V9F A;  5IT9 g;  3AL8 B;  3RFH A;  3ZWL B;  4CI3 A;  4QQE A;  2CO0 A;  4J81 A;  4FA4 D;  3J81 g;  3J80 g;  2I3S A;  3PXS D;  4ZOX A;  5GXH A;  4A0A A;  5HE3 B;  4JSV C;  3UKR C;  4E5Z B;  5HQG A;  3UVK A;  2OIZ A;  4J0X A;  2H9P A;  1MG3 A;  3SHF A;  4JT6 C;  3UVL A;  3VGZ A;  4CC9 A;  2IUP A;  3FGB A;  1JOF A;  1JMZ B;  2Z2O A;  3F3F A;  2XU7 A;  2MTA H;  5EM2 A;  5THA A;  1PI6 A;  5IGQ A;  4L3H D;  3PXW D;  2PM6 B;  4NSX A;  4X63 B;  3SWS D;  3SLE D;  5FLX g;  4Y5R D;  5SXM A;  2YNO A;  2H68 A;  4J77 A;  3SFZ A;  3VA6 A;  4GM3 A;  3RN1 D;  5GSA A;  2P9U C;  2CN2 A;  3UVO A;  3IIW A;  4QRJ A;  2P9P C;  3BG0 A;  4N14 A;  4GGD A;  4GQ2 P;  2IWF A;  5CYK A;  3DXK C;  4ZOY A;  5C2W B;  3L4M D;  4L9O A;  5EML B;  3MXX A;  4L3G D;  3NVQ A;  2AGX A;  1XKS A;  4BL0 A;  1U2V C;  3C99 A;  3JRP A;  4J79 A;  4U7A A;  3KRX B;  3JRO A;  2OVR B;  3RN0 D;  3UKU C;  5GXI A;  2XYI A;  3OKY A;  2I0T A;  4PC0 A;  4FAV D;  2HJB A;  4FA9 D;  4A09 B;  1K32 A;  1PBY B;  4JT5 C;  2H9N A;  3UVM A;  4GZ8 A;  4H5I A;  3A0F A;  1OLZ A;  2AH1 A;  5CXC B;  4QT8 A;  1U4C A;  3N0E A;  4A0B B;  4LGN A;  3AL9 A;  2GC7 A;  3SCY A;  4ZN4 A;  3JB9 L;  4X3E A;  4CY1 A;  5KDO B;  3AL8 A;  5FKQ A;  3RRM C;  4J8B A;  2Q7Q A;  3U4Y A;  2AQ5 A;  3KRW B;  4D6V A;  4LG8 A;  1YFQ A;  4ZOZ A;  3EU7 A;  2IAA A;  5TEE A;  3FM0 A;  4X60 B;  2G99 A;  4JSP C;  2H13 A;  5HE1 B;  4LG9 A;  4OZU A;  2P9K C;  3SN6 B;  4E5Z A;  4IA9 A;  3MKQ A;  4IMM A;  3NVX A;  5EMJ B;  4JXM A;  5IJ7 E;  5I5J A;  3IIY A;  3DXM C;  4GMB A;  5H17 A;  3SVW D;  2CNX A;  2HKM A;  4YVD A;  5EAR A;  3C9C A;  2YMU A;  4J78 A;  2P9N C;  2P9I C;  1SQ9 A;  3C5M A;  5HE0 B;  4PBZ A;  3SXT D;  5GMK n;  2CE8 A;  4A11 A;  2YBA A;  5IGO A;  3I8E A;  3EG6 A;  4PNK B;  1K8K C;  3F3P A;  4H5J A;  5EAM A;  4PSW B;  4CY3 A;  4BH6 A;  3ORV D;  5A2Q g;  2IUV A;  1FWX A;  3JAM g;  2HES X;  4CZX A;  4GGA A;  1S4U X;  1QNI A;  3C75 H;  1GP2 B;  4GM9 A;  5AFU 3;  1SQJ A;  1L0Q A;  2BBK H;  4K3J B;  2TRC B;  3NVN A;  4A2M A;  4A0A B;  2O9K A;  3EI2 B;  4E54 B;  4CZY A;  2UZY B;  2XL2 A;  4ERQ A;  1A0R B;  4Y7R A;  5IC7 A;  5I5M A;  3V7D B;  2HJ4 A;  3DM0 A;  3EI4 B;  4A09 A;  4BUJ C;  4AOW A;  3PVU B;  4FA5 D;  4TZ4 A;  3AFC A;  5FKR A;  4MK0 B;  2AGL A;  2H6Q A;  4J87 A;  4FWW A;  5EM2 B;  3MMY A;  4CY2 A;  4A0B A;  1XHM A;  2J57 G;  2OK4 A;  3B7F A;  2YB8 B;  2Z2N A;  3RLM D;  3EI1 B;  5FA5 B;  4A08 B;  3IKO A;  3OL2 A;  4GGC A;  3JZN A;  2H14 A;  3I7H A;  1B9Y A;  5TDH B;  4O3T B;  5H1M A;  3VH0 A;  2J56 H;  4QL1 A;  2J55 H;  2H9M A;  5K1C C;  3W15 A;  2QC5 A;  4K3I D;  3EMH A;  2B4E A;  2PM7 B;  3DSM A;  2H9L A;  3PXT D;  1GG2 B;  3OW8 A;  1JMX B;  4O9D A;  4G56 B;  2IUQ A;  3I89 A;  4FB1 D;  5AMS A;  1Q47 A;  4CZV A;  2W18 A;  4XYH A;  4FA1 D;  1MG2 A;  5EAL A;  3RMZ D;  3IJ0 A;  3OKY B;  2H6K A;  3V5W B;  3I8C A;  1B9X A;  2AGY A;  5I5I A;  3JPX A;  3SBP A;  4O45 A;  4X61 B;  3UVN A;  3DWL C;  4D0K A;  3SBR A;  5FXY A;  2I3T A;  1N6D A;  4GM8 A;  4GQB B;  3GRE A;  4FHL A;  3CFS B;  3MKS B;  3N0D A;  1PEV A;  2H47 A;  4AEZ A;  4J86 A;  3BG1 A;  4CI8 A;  5EMM B;  2PM9 B;  5HYN B;  4J82 A;  5EMK B;  2HKR A;  3SMR A;  2PBI B;  5CXB B;  3RSE C;  3I7N A;  2AGZ A;  1TBG A;  2XL3 A;  3EI3 B;  3PVW B;  2AH0 A;  1N6F A;  1VYH C;  2H3X A;  2G9A A;  2B5L A;  4L1Q D;  4CI2 A;  2IWK A;  3IJC A;  5FKS A;  4O3U B;  5K19 A;  2GC4 A;  4EWR A;  3EI2 A;  4E54 A;  2BCJ B;  3EI4 A;  3MZL A;  2B5M A;  2Z2P A;  3CFV A;  1GXR A;  2P9S C;  2OJY A;  4I79 A;  2IUR A;  3F3G A;  2I0R A;  3I2N A;  2UZX B;  4XEI C;  5AJA A;  3CIK B;  4O1Q D;  3OKW A;  3SBQ A;  4UI9 R;  5H14 A;  3OKT A;  4ESG A;  1TYQ C;  4PXW A;  3I7P A;  3EI1 A;  4A08 A;  1JJU B;  4Z8L A;  4A11 B;  2H6N A;  1N6E A;  2P9L C;  4PSX B;  4ES0 A;  5CXC A;  3PSL A;  2EBS A;  1SHY B;  4JD2 C;  5C9Z B;  1NR0 A;  4R7A B;  3GFC A;  4A7J A;  2CE9 A;  4JSX C;  3PE7 A;  5TEF A;  3MZK A;  4KFM B;  5IJ8 E;  3EWE A;  3PSC B;  4GQ1 A;  2AGW A;  4XYI A;  3JZH A;  2OK6 A;  1R5M A;  5FKT A;  4J84 A;  3AH8 B;  2CO0 C;  2YNP A;  4ZOV A;  2QXV A;  4J0W A;  2GNQ A;  3I7K A;  3RFG A;  5CYK B;  1GOT B;  4A2L A;  4PBY A;  3E0C A;  3OTT A;  4HDJ A;  4ERY A;  2HYE A;  2I0S A;  4CI1 A;  5TF2 A;  1PGU A;  1NEX B;  3K26 A;  4CY5 A;  3IJ1 A;  4J73 A;  2OVQ B;  4U1E I;  1XIP A;  5HE2 B;  4JSN C;  2PM9 A;  2YNN A;  5EAP A;  3UR4 A;  3HFQ A;  5FQD A;  2B5N A;  5JWZ A;  3OL2 B;  3BWS A;  5CXB A;  3I7L A;  3P4F A;  3ULE C;  3L4O D;  3SJL D;  3EI3 A;  5B4W A;  1RI6 A;  2HXC A;  5C2V B;  4FAN D;  3FRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...