1B9YA

Structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TRANSDUCIN)
publication title A molecular mechanism for the phosphorylation-dependent regulation of heterotrimeric G proteins by phosducin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 100
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1999-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1b9yA00
5FXYA 2GC7A 2XYIA 3JB9L 3EMHA 4A0AB 2QC5A 2I0RA 5FQDA 4OWRA 4ERQA 5I5MA 4EWRA 1JMXB 3C99A 2HYEA 4A0BA 2CO0C 4MK0B 1P22A 4QRJA 4LG9A 4JSVC 3I8CA 4NSXA 4X63B 4AOWA 4J78A 3DM0A 4ZOXA 4KFMB 5CYKA 2OIZA 4FWWA 1S4UX 3MZKA 2IUVA 2J57G 2B4EA 5IGOA 3AL8A 5EM2A 1U4CA 3NVNA 4GM3A 3AFCA 5EMJB 2OK6A 3BG1A 1JMZB 2O9KA 5EARA 5EMKB 4I79A 4JT5C 2B5NA 2P9IC 1TYQC 3GREA 2CN2A 2HJ4A 4QL1A 4BUJC 5K1CC 2PM9A 4CI2A 3GFCA 4D6VA 3I8EA 3UKRC 4CC9A 2H68A 5FKTA 3A0FA 2PM6B 2P9NC 4L3HD 1ERJA 4X61B 4PXWA 4Y5RD 1NR0A 3JZHA 4PNKB 2P9LC 4XEIC 4A2MA 3JROA 5HE3B 2MTAH 4LGNA 4G56B 5CXBB 2H9MA 3RRMC 3U4YA 5TEFA 4K3ID 4JSPC 3HFQA 2YNOA 5I5IA 4ERYA 3RFHA 5TDHB 3EI1A 2IURA 4TZ4A 3IKOA 3EI4A 5C2VB 1YFQA 4O45A 4A08A 2PM7B 4E54B 3NVQA 4GGCA 3CFSB 2I0SA 4CZYA 5EAMA 5A2Qg 1N6DA 4ESGA 3C9CA 4U7AA 2W18A 2GNQA 4XYIA 1QNIA 5TF2A 2OJYA 3UVMA 3OKYA 3EWEA 4U1EI 3L4OD 2P9PC 1XHMA 2Q7QA 3SBPA 4A2LA 1SQJA 2P9SC 1A0RB 3DWLC 2UZXB 1GP2B 2H9NA 3UVKA 2HXCA 4J8BA 2G99A 2IWKA 4UI9R 4PBZA 4FHLA 4A11A 3PXWD 3V9FA 2I3SA 1GOTB 3I7KA 3OL2A 3OW8A 1N6FA 2AGYA 2YNNA 3OL2B 5AMSA 4A0BB 2AH0A 2OVQB 5HYNB 5H14A 1PBYB 4J82A 3RSEC 4ES0A 4FA9D 1VYHC 4FA1D 2IWFA 4ZOVA 4A7JA 1XKSA 3EU7A 4N14A 3FM0A 5IGQA 5CYKB 4CZXA 2AH1A 3NVXA 4IMMA 3AL8B 5EM2B 3MZLA 3EI2A 5GSAA 3I89A 1MG3A 3K26A 4Y7RA 3KRWB 3SN6B 5FLXg 3MKQA 2H9PA 2HESX 5JWZA 1SHYB 4H5JA 3P4FA 3I7NA 3IJ1A 2AGZA 1TBGA 2OVPB 4BL0A 5EMMB 4A09A 2AGWA 2PM9B 2UZYB 4AEZA 2H9LA 3JZGA 5IJ7E 5KDOB 5THAA 4E5ZA 1MG2A 2CNXA 2XL2A 3RLMD 4CY1A 1PGUA 4CY2A 5K19A 3IJCA 2H47A 3MXXA 4O1QD 5AFU3 3RN1D 2P9KC 2Z2OA 4PSXB 4J0XA 3C75H 4PC0A 4GMBA 5TEEA 4XYHA 4JSXC 4K3JB 4BH6A 2H6KA 4JT6C 4QT8A 3UKUC 4GGDA 3EI1B 3OKTA 3UR4A 3ZWLB 2H3XA 2I0TA 3EI4B 3SWSD 3K27A 4A08B 2BBKH 3DSMA 4J77A 3RMZD 5FKRA 3JAMg 3E0CA 4D0KA 4PBYA 2HJBA 2IAAA 4CI8A 4JXMA 3PVWB 3N0EA 3SHFA 1GG2B 4GQBB 4GQ2P 5B4WA 3I7HA 4GM9A 4QQEA 4FB1D 4JD2C 1RI6A 3CFVA 3J81g 3OKYB 2B5LA 5C9ZB 2AQ5A 5IT9g 3JRPA 5CXCA 5EALA 2IUPA 1N6EA 4IA9A 5C2WB 2Z2NA 3PE7A 2PBIB 5HE2B 3DXMC 1PI6A 1L0QA 3PSCB 3BG0A 4CY5A 3AH8B 2H6NA 3V5WB 3EI3A 2QXVA 4A11B 3IIYA 1PEVA 4X60B 3IJ0A 5GXIA 2H14A 3PVUB 3V7DB 2P9UC 1JOFA 3ORVD 2YBAA 4A0AA 4J87A 3FRXA 2OK4A 4JSNC 5HE1B 3BWSA 3VGZA 2B5MA 1OLZA 3PXSD 1K32A 3VA6A 2AGLA 4J86A 3SBRA 1U2VC 2G9AA 3L4MD 1OMWB 3EI2B 2CN3A 3W15A 5HE0B 4ZN4A 2Z2PA 2XL3A 2GC4A 4H5IA 4YVDA 4ZOZA 4FAVD 1JJUB 2CE9A 4A09B 3RFGA 3I7LA 3OKWA 1GXRA 2TRCB 4J8GA 2H13A 1B9YA 1NEXB 3JZNA 4CI3A 4E5ZB 2J55H 5IJ8E 3UVLA 3MMYA 4L9OA 4J79A 4R7AB 4FA4D 3VH0A 5GXHA 5SXMA 5FKSA 5EAPA 4J81A 2H6QA 4OZUA 2CO0A 3F3GA 2BCJB 5H17A 2IUQA 1Q47A 1R5MA 3B7FA 3SXTD 3CIKB 4O3UB 1XIPA 3EG6A 4ZOYA 3KRXB 3OTTA 5I5JA 4CZVA 3I7OA 5CXBA 4J0WA 2YNPA 3F3PA 4FAND 2I3TA 4CI1A 3ODTA 3SVWD 5GMKn 3I7PA 3MKSB 5H1MA 3N0DA 3FGBA 2AGXA 4LG8A 3SMRA 4Z8LA 4O9DA 3IIWA 3RN0D 4FA5D 4O3TB 2HKRA 4J73A 4ERZA 1B9XA 3DXKC 2OVRB 4E54A 4J84A 3JPXA 3SCYA 4GQ1A 3ULEC 3SJLD 2YB8B 5HQGA 4HDJA 4X3EA 4GM8A 2YMUA 3J80g 4PSWB 5FA5B 4GGAA 5CXCB 2EBSA 3SFZA 5EMLB 4CY3A 3UVOA 4L3GD 2CE8A 1SQ9A 3SBQA 3PSLA 2HKMA 2J56H 1K8KC 5IC7A 5AJAA 3PXTD 1MDAH 3SLED 3EI3B 3F3FA 3C5MA 5FKQA 2XU7A 3I2NA 4L1QD 4GZ8A 1FWXA 3AL9A 3UVNA
chains in the Genus database with same CATH superfamily
1E8MA 5FXYA 1I2MB 2GC7A 2XYIA 3IUNA 3JB9L 3EMHA 4A0AB 2QC5A 4NAAA 2I0RA 5FQDA 4OWRA 4ERQA 2XZGA 5I5MA 3IUMA 3MUOA 4EWRA 1JMXB 3C99A 3EQ9A 2HYEA 4A0BA 2CO0C 4MK0B 1GOHA 1P22A 4QRJA 3OF7A 4LG9A 4JSVC 3I8CA 4NSXA 4X63B 4AOWA 4J78A 3VI3A 3DM0A 4ZOXA 5C86A 4KFMB 3MVDK 5CYKA 2HU5A 2OIZA 4FWWA 5HDBA 1S4UX 3MZKA 2IUVA 2J57G 2B4EA 5IGOA 3AL8A 5EM2A 1U4CA 3NVNA 4BP9A 4GM3A 3AFCA 3KCIA 5EMJB 4WK4A 2OK6A 2VDLA 1JMZB 3BG1A 2O9KA 5EARA 5EMKB 4I79A 1GOGA 4JT5C 2B5NA 2P9IC 1TYQC 3GREA 3T3PA 2CN2A 4AMYA 2HJ4A 4QL1A 4BUJC 5K1CC 2PM9A 4CI2A 2VDQA 1VE7A 2EIBA 3GFCA 4D6VA 3I8EA 3UKRC 4CC9A 2H68A 5FKTA 3A0FA 3ZDZA 2PM6B 2P9NC 3ZDXA 4L3HD 1ERJA 4X61B 2VDMA 4PXWA 5M5VA 1BPOA 4Y5RD 3FCSA 1NR0A 3JZHA 1C9LA 4DNVA 4PNKB 2P9LC 4XEIC 4A2MA 3JROA 5HE3B 2MTAH 4LGNA 4G56B 5CXBB 2H9MA 3RRMC 3U4YA 3NIDA 5TEFA 4K3ID 4JSPC 2VDRA 3HFQA 4BP8A 2YNOA 5I5IA 4ERYA 3RFHA 2EICA 5TDHB 3IULA 3EI1A 4AMZA 2IURA 2VC2A 3IKOA 4TZ4A 3EI4A 5C2VB 1YFQA 4O45A 4A08A 2PM7B 4E54B 4O02A 3NVQA 4GGCA 3CFSB 2I0SA 4CZYA 5EAMA 5A2Qg 3GD1I 1N6DA 4ESGA 3C9CA 4U7AA 2W18A 2GNQA 4XYIA 1QNIA 3O4JA 5TF2A 3ZE1A 2OJYA 3UVMA 4O2WA 4BCDA 3OKYA 3EWEA 4U1EI 4NENA 3L4OD 2P9PC 1XHMA 2Q7QA 2VDPA 4Z7QA 3SBPA 4A2LA 5M5TA 1SQJA 2P9SC 1A0RB 3DWLC 3QI0A 1UOQA 2UZXB 1GP2B 2H9NA 3UVKA 2HXCA 4J8BA 4WK2A 2G99A 2IWKA 4UI9R 4PBZA 4FHLA 4A11A 3PXWD 3V9FA 2I3SA 2EIEA 3IJEA 1GOTB 1O6GA 3I7KA 3OL2A 3OW8A 1N6FA 2AGYA 2YNNA 3OL2B 5AMSA 4A0BB 2AH0A 2OVQB 5HYNB 1VZ2A 5H14A 1PBYB 4J82A 3RSEC 4ES0A 2HU7A 4FA9D 1VYHC 4FA1D 2IWFA 4ZOVA 4A7JA 1XKSA 3EU7A 1TYEA 4N14A 3FM0A 5IGQA 5CYKB 4CZXA 2AH1A 3NVXA 4IMMA 3AL8B 3K6SA 5EM2B 3MZLA 2BKLA 3EI2A 5GSAA 3I89A 3DDUA 1MG3A 3K26A 4IRZA 4Y7RA 3KRWB 3SN6B 5FLXg 3MKQA 2QZPA 2H9PA 2HESX 5JWZA 1SHYB 1K3IA 4H5JA 3P4FA 3I7NA 3IJ1A 2AGZA 1TBGA 2OVPB 4BL0A 5EMMB 5E6SA 4A09A 2AGWA 2PM9B 2UZYB 4AEZA 3QHYB 2H9LA 3JZGA 5IJ7E 5KDOB 2VDOA 5THAA 5M61A 4DNWA 4E5ZA 1MG2A 2CNXA 2XL2A 3MUNA 3RLMD 4CY1A 1PGUA 3EQ7A 4CY2A 5K19A 3IJCA 2H47A 3MXXA 4O1QD 5AFU3 3RN1D 2P9KC 3NIFA 2Z2OA 4PSXB 4J0XA 3C75H 4NBMA 4PC0A 1H2ZA 4GMBA 5TEEA 4WK0A 4XYHA 4JSXC 3IUJA 4K3JB 4BH6A 2H6KA 4JT6C 4QT8A 3UKUC 1O6FA 4GGDA 3EI1B 4Z7NA 3OKTA 3UR4A 3ZWLB 2H3XA 2I0TA 3EI4B 3SWSD 1JV2A 3K27A 2EIDA 4A08B 2BBKH 3DSMA 4J77A 3RMZD 5FKRA 3JAMg 3E0CA 4D0KA 4D9SA 4PBYA 4NC4A 3ZE2A 2HJBA 2IAAA 4CI8A 2VDNA 3PVWB 4JXMA 3N0EA 3SHFA 1GG2B 4GQBB 4GQ2P 5B4WA 3I7HA 4GM9A 4AN0A 4QQEA 4FB1D 4MMXA 4JD2C 1RI6A 3CFVA 1GOFA 3J81g 3OKYB 2B5LA 5C9ZB 2AQ5A 5IT9g 3JRPA 5CXCA 5EALA 2IUPA 1N6EA 4IA9A 5E6RA 5C2WB 2Z2NA 3PE7A 2PBIB 5HE2B 3DXMC 1PI6A 3V4PA 1L0QA 3PSCB 3BG0A 4CY5A 3AH8B 2H6NA 3V5WB 3EI3A 2QXVA 4A11B 4DNUA 3IIYA 3IURA 1PEVA 4X60B 3IJ0A 1H2XA 3V4VA 1M1XA 5GXIA 4RE5A 4RE6A 2H14A 2XE4A 2JKXA 5M5RA 3PVUB 3T3MA 3V7DB 2P9UC 1JOFA 3ORVD 2YBAA 4A0AA 4J87A 3FRXA 1L5GA 2OK4A 2HU8A 4JSNC 1C9IA 3K71A 5HE1B 3BWSA 4AX4A 3VGZA 2B5MA 1OLZA 2QR5A 3IUQA 3PXSD 1K32A 3VA6A 2AGLA 4J86A 4BCBA 4L1MA 3SBRA 1E5TA 1U2VC 2G9AA 3L4MD 1OMWB 3EI2B 2CN3A 3W15A 5M5SA 3ZE0A 5HE0B 1VE6A 5E6UA 1QFMA 4G1EA 4ZN4A 2Z2PA 2XL3A 3O4HA 2GC4A 4H5IA 4YVDA 4G1MA 1A12A 4ZOZA 4FAVD 1JJUB 2CE9A 5C92A 4A09B 3RFGA 1U8CA 3I7LA 3OKWA 3FCUA 1GXRA 2TRCB 4J8GA 4Z7OA 4QAMA 2H13A 1B9YA 1NEXB 2VDKA 3JZNA 4CI3A 4E5ZB 2J55H 5IJ8E 3UVLA 3MMYA 4L9OA 4J79A 4R7AB 4FA4D 3VH0A 4UM9A 5GXHA 5SXMA 5FKSA 2XDWA 5EAPA 4J81A 2H6QA 4OZUA 1JTDB 2CO0A 3F3GA 2BCJB 5H17A 2IUQA 4JHNA 1Q47A 1H2YA 1R5MA 1YR2A 3B7FA 3SXTD 3NIGA 3GC3B 3EQ8A 4MMZA 3VI4A 4AN1A 3CIKB 4O3UB 1XIPA 3EG6A 4ZOYA 4G55A 1UTCA 2VZ1A 3KRXB 4UM8A 1H2WA 3OTTA 3O4GA 5I5JA 4CZVA 3I7OA 5CXBA 4JHPC 4J0WA 2YNPA 2VZ3A 3F3PA 4MMYA 4FAND 2I3TA 4CI1A 1QFSA 3ODTA 3SVWD 5GMKn 3ZDYA 3I7PA 3MKSB 5FFOA 3N0DA 4WJKA 5H1MA 4BCCA 3FGBA 2AGXA 4LG8A 3SMRA 4Z8LA 4O9DA 3IIWA 3RN0D 4FA5D 4O3TB 2HKRA 4J73A 4ERZA 1B9XA 3DXKC 2OVRB 4E54A 4J84A 1UOPA 3JPXA 3SCYA 4GQ1A 3ULEC 3SJLD 2YB8B 5HQGA 4HDJA 4X3EA 4GM8A 2YMUA 3J80g 4PSWB 3K72A 3IVMA 4GGAA 2EBSA 5CXCB 5FA5B 3SFZA 5EMLB 4CY3A 3UVOA 1UOOA 1E8NA 4L3GD 2WQ8A 5M5UA 2CE8A 1SQ9A 3SBQA 3PSLA 1VZ3A 2HKMA 2J56H 1K8KC 3O4IA 5IC7A 5AJAA 3PXTD 1MDAH 1T2XA 3SLED 3EI3B 5FFGA 3F3FA 3C5MA 5FKQA 2XU7A 3I2NA 4L1QD 4GZ8A 1FWXA 3AL9A 3UVNA
chains in the Genus database with same CATH topology
5FXYA 2GC7A 2XYIA 3JB9L 3EMHA 4A0AB 2QC5A 2I0RA 5FQDA 4OWRA 4ERQA 5I5MA 4EWRA 1JMXB 3C99A 2HYEA 4A0BA 2CO0C 4MK0B 1P22A 4QRJA 4LG9A 4JSVC 3I8CA 4NSXA 4X63B 4AOWA 4J78A 3DM0A 4ZOXA 4KFMB 5CYKA 2OIZA 4FWWA 1S4UX 3MZKA 2IUVA 2J57G 2B4EA 5IGOA 3AL8A 5EM2A 1U4CA 3NVNA 4GM3A 3AFCA 5EMJB 2OK6A 3BG1A 1JMZB 2O9KA 5EARA 5EMKB 4I79A 4JT5C 2B5NA 2P9IC 1TYQC 3GREA 2CN2A 2HJ4A 4QL1A 4BUJC 5K1CC 2PM9A 4CI2A 3GFCA 4D6VA 3I8EA 3UKRC 4CC9A 2H68A 5FKTA 3A0FA 2PM6B 2P9NC 4L3HD 1ERJA 4X61B 4PXWA 4Y5RD 1NR0A 3JZHA 4PNKB 2P9LC 4XEIC 4A2MA 3JROA 5HE3B 2MTAH 4LGNA 4G56B 5CXBB 2H9MA 3RRMC 3U4YA 5TEFA 4K3ID 4JSPC 3HFQA 2YNOA 5I5IA 4ERYA 3RFHA 5TDHB 3EI1A 2IURA 4TZ4A 3IKOA 3EI4A 5C2VB 1YFQA 4O45A 4A08A 2PM7B 4E54B 3NVQA 4GGCA 3CFSB 2I0SA 4CZYA 5EAMA 5A2Qg 1N6DA 4ESGA 3C9CA 4U7AA 2W18A 2GNQA 4XYIA 1QNIA 5TF2A 2OJYA 3UVMA 3OKYA 3EWEA 4U1EI 3L4OD 2P9PC 1XHMA 2Q7QA 3SBPA 4A2LA 1SQJA 2P9SC 1A0RB 3DWLC 2UZXB 1GP2B 2H9NA 3UVKA 2HXCA 4J8BA 2G99A 2IWKA 4UI9R 4PBZA 4FHLA 4A11A 3PXWD 3V9FA 2I3SA 1GOTB 3I7KA 3OL2A 3OW8A 1N6FA 2AGYA 2YNNA 3OL2B 5AMSA 4A0BB 2AH0A 2OVQB 5HYNB 5H14A 1PBYB 4J82A 3RSEC 4ES0A 4FA9D 1VYHC 4FA1D 2IWFA 4ZOVA 4A7JA 1XKSA 3EU7A 4N14A 3FM0A 5IGQA 5CYKB 4CZXA 2AH1A 3NVXA 4IMMA 3AL8B 5EM2B 3MZLA 3EI2A 5GSAA 3I89A 1MG3A 3K26A 4Y7RA 3KRWB 3SN6B 5FLXg 3MKQA 2H9PA 2HESX 5JWZA 1SHYB 4H5JA 3P4FA 3I7NA 3IJ1A 2AGZA 1TBGA 2OVPB 4BL0A 5EMMB 4A09A 2AGWA 2PM9B 2UZYB 4AEZA 2H9LA 3JZGA 5IJ7E 5KDOB 5THAA 4E5ZA 1MG2A 2CNXA 2XL2A 3RLMD 4CY1A 1PGUA 4CY2A 5K19A 3IJCA 2H47A 3MXXA 4O1QD 5AFU3 3RN1D 2P9KC 2Z2OA 4PSXB 4J0XA 3C75H 4PC0A 4GMBA 5TEEA 4XYHA 4JSXC 4K3JB 4BH6A 2H6KA 4JT6C 4QT8A 3UKUC 4GGDA 3EI1B 3OKTA 3UR4A 3ZWLB 2H3XA 2I0TA 3EI4B 3SWSD 3K27A 4A08B 2BBKH 3DSMA 4J77A 3RMZD 5FKRA 3JAMg 3E0CA 4D0KA 4PBYA 2HJBA 2IAAA 4CI8A 4JXMA 3PVWB 3N0EA 3SHFA 1GG2B 4GQBB 4GQ2P 5B4WA 3I7HA 4GM9A 4QQEA 4FB1D 4JD2C 1RI6A 3CFVA 3J81g 3OKYB 2B5LA 5C9ZB 2AQ5A 5IT9g 3JRPA 5CXCA 5EALA 2IUPA 1N6EA 4IA9A 5C2WB 2Z2NA 3PE7A 2PBIB 5HE2B 3DXMC 1PI6A 1L0QA 3PSCB 3BG0A 4CY5A 3AH8B 2H6NA 3V5WB 3EI3A 2QXVA 4A11B 3IIYA 1PEVA 4X60B 3IJ0A 5GXIA 2H14A 3PVUB 3V7DB 2P9UC 1JOFA 3ORVD 2YBAA 4A0AA 4J87A 3FRXA 2OK4A 4JSNC 5HE1B 3BWSA 3VGZA 2B5MA 1OLZA 3PXSD 1K32A 3VA6A 2AGLA 4J86A 3SBRA 1U2VC 2G9AA 3L4MD 1OMWB 3EI2B 2CN3A 3W15A 5HE0B 4ZN4A 2Z2PA 2XL3A 2GC4A 4H5IA 4YVDA 4ZOZA 4FAVD 1JJUB 2CE9A 4A09B 3RFGA 3I7LA 3OKWA 1GXRA 2TRCB 4J8GA 2H13A 1B9YA 1NEXB 3JZNA 4CI3A 4E5ZB 2J55H 5IJ8E 3UVLA 3MMYA 4L9OA 4J79A 4R7AB 4FA4D 3VH0A 5GXHA 5SXMA 5FKSA 5EAPA 4J81A 2H6QA 4OZUA 2CO0A 3F3GA 2BCJB 5H17A 2IUQA 1Q47A 1R5MA 3B7FA 3SXTD 3CIKB 4O3UB 1XIPA 3EG6A 4ZOYA 3KRXB 3OTTA 5I5JA 4CZVA 3I7OA 5CXBA 4J0WA 2YNPA 3F3PA 4FAND 2I3TA 4CI1A 3ODTA 3SVWD 5GMKn 3I7PA 3MKSB 5H1MA 3N0DA 3FGBA 2AGXA 4LG8A 3SMRA 4Z8LA 4O9DA 3IIWA 3RN0D 4FA5D 4O3TB 2HKRA 4J73A 4ERZA 1B9XA 3DXKC 2OVRB 4E54A 4J84A 3JPXA 3SCYA 4GQ1A 3ULEC 3SJLD 2YB8B 5HQGA 4HDJA 4X3EA 4GM8A 2YMUA 3J80g 4PSWB 5FA5B 4GGAA 5CXCB 2EBSA 3SFZA 5EMLB 4CY3A 3UVOA 4L3GD 2CE8A 1SQ9A 3SBQA 3PSLA 2HKMA 2J56H 1K8KC 5IC7A 5AJAA 3PXTD 1MDAH 3SLED 3EI3B 3F3FA 3C5MA 5FKQA 2XU7A 3I2NA 4L1QD 4GZ8A 1FWXA 3AL9A 3UVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FXY A;  2GC7 A;  2XYI A;  3JB9 L;  3EMH A;  4A0A B;  2QC5 A;  2I0R A;  5FQD A;  4OWR A;  4ERQ A;  5I5M A;  4EWR A;  1JMX B;  3C99 A;  2HYE A;  4A0B A;  2CO0 C;  4MK0 B;  1P22 A;  4QRJ A;  4LG9 A;  4JSV C;  3I8C A;  4NSX A;  4X63 B;  4AOW A;  4J78 A;  3DM0 A;  4ZOX A;  4KFM B;  5CYK A;  2OIZ A;  4FWW A;  1S4U X;  3MZK A;  2IUV A;  2J57 G;  2B4E A;  5IGO A;  3AL8 A;  5EM2 A;  1U4C A;  3NVN A;  4GM3 A;  3AFC A;  5EMJ B;  2OK6 A;  3BG1 A;  1JMZ B;  2O9K A;  5EAR A;  5EMK B;  4I79 A;  4JT5 C;  2B5N A;  2P9I C;  1TYQ C;  3GRE A;  2CN2 A;  2HJ4 A;  4QL1 A;  4BUJ C;  5K1C C;  2PM9 A;  4CI2 A;  3GFC A;  4D6V A;  3I8E A;  3UKR C;  4CC9 A;  2H68 A;  5FKT A;  3A0F A;  2PM6 B;  2P9N C;  4L3H D;  1ERJ A;  4X61 B;  4PXW A;  4Y5R D;  1NR0 A;  3JZH A;  4PNK B;  2P9L C;  4XEI C;  4A2M A;  3JRO A;  5HE3 B;  2MTA H;  4LGN A;  4G56 B;  5CXB B;  2H9M A;  3RRM C;  3U4Y A;  5TEF A;  4K3I D;  4JSP C;  3HFQ A;  2YNO A;  5I5I A;  4ERY A;  3RFH A;  5TDH B;  3EI1 A;  2IUR A;  4TZ4 A;  3IKO A;  3EI4 A;  5C2V B;  1YFQ A;  4O45 A;  4A08 A;  2PM7 B;  4E54 B;  3NVQ A;  4GGC A;  3CFS B;  2I0S A;  4CZY A;  5EAM A;  5A2Q g;  1N6D A;  4ESG A;  3C9C A;  4U7A A;  2W18 A;  2GNQ A;  4XYI A;  1QNI A;  5TF2 A;  2OJY A;  3UVM A;  3OKY A;  3EWE A;  4U1E I;  3L4O D;  2P9P C;  1XHM A;  2Q7Q A;  3SBP A;  4A2L A;  1SQJ A;  2P9S C;  1A0R B;  3DWL C;  2UZX B;  1GP2 B;  2H9N A;  3UVK A;  2HXC A;  4J8B A;  2G99 A;  2IWK A;  4UI9 R;  4PBZ A;  4FHL A;  4A11 A;  3PXW D;  3V9F A;  2I3S A;  1GOT B;  3I7K A;  3OL2 A;  3OW8 A;  1N6F A;  2AGY A;  2YNN A;  3OL2 B;  5AMS A;  4A0B B;  2AH0 A;  2OVQ B;  5HYN B;  5H14 A;  1PBY B;  4J82 A;  3RSE C;  4ES0 A;  4FA9 D;  1VYH C;  4FA1 D;  2IWF A;  4ZOV A;  4A7J A;  1XKS A;  3EU7 A;  4N14 A;  3FM0 A;  5IGQ A;  5CYK B;  4CZX A;  2AH1 A;  3NVX A;  4IMM A;  3AL8 B;  5EM2 B;  3MZL A;  3EI2 A;  5GSA A;  3I89 A;  1MG3 A;  3K26 A;  4Y7R A;  3KRW B;  3SN6 B;  5FLX g;  3MKQ A;  2H9P A;  2HES X;  5JWZ A;  1SHY B;  4H5J A;  3P4F A;  3I7N A;  3IJ1 A;  2AGZ A;  1TBG A;  2OVP B;  4BL0 A;  5EMM B;  4A09 A;  2AGW A;  2PM9 B;  2UZY B;  4AEZ A;  2H9L A;  3JZG A;  5IJ7 E;  5KDO B;  5THA A;  4E5Z A;  1MG2 A;  2CNX A;  2XL2 A;  3RLM D;  4CY1 A;  1PGU A;  4CY2 A;  5K19 A;  3IJC A;  2H47 A;  3MXX A;  4O1Q D;  5AFU 3;  3RN1 D;  2P9K C;  2Z2O A;  4PSX B;  4J0X A;  3C75 H;  4PC0 A;  4GMB A;  5TEE A;  4XYH A;  4JSX C;  4K3J B;  4BH6 A;  2H6K A;  4JT6 C;  4QT8 A;  3UKU C;  4GGD A;  3EI1 B;  3OKT A;  3UR4 A;  3ZWL B;  2H3X A;  2I0T A;  3EI4 B;  3SWS D;  3K27 A;  4A08 B;  2BBK H;  3DSM A;  4J77 A;  3RMZ D;  5FKR A;  3JAM g;  3E0C A;  4D0K A;  4PBY A;  2HJB A;  2IAA A;  4CI8 A;  4JXM A;  3PVW B;  3N0E A;  3SHF A;  1GG2 B;  4GQB B;  4GQ2 P;  5B4W A;  3I7H A;  4GM9 A;  4QQE A;  4FB1 D;  4JD2 C;  1RI6 A;  3CFV A;  3J81 g;  3OKY B;  2B5L A;  5C9Z B;  2AQ5 A;  5IT9 g;  3JRP A;  5CXC A;  5EAL A;  2IUP A;  1N6E A;  4IA9 A;  5C2W B;  2Z2N A;  3PE7 A;  2PBI B;  5HE2 B;  3DXM C;  1PI6 A;  1L0Q A;  3PSC B;  3BG0 A;  4CY5 A;  3AH8 B;  2H6N A;  3V5W B;  3EI3 A;  2QXV A;  4A11 B;  3IIY A;  1PEV A;  4X60 B;  3IJ0 A;  5GXI A;  2H14 A;  3PVU B;  3V7D B;  2P9U C;  1JOF A;  3ORV D;  2YBA A;  4A0A A;  4J87 A;  3FRX A;  2OK4 A;  4JSN C;  5HE1 B;  3BWS A;  3VGZ A;  2B5M A;  1OLZ A;  3PXS D;  1K32 A;  3VA6 A;  2AGL A;  4J86 A;  3SBR A;  1U2V C;  2G9A A;  3L4M D;  1OMW B;  3EI2 B;  2CN3 A;  3W15 A;  5HE0 B;  4ZN4 A;  2Z2P A;  2XL3 A;  2GC4 A;  4H5I A;  4YVD A;  4ZOZ A;  4FAV D;  1JJU B;  2CE9 A;  4A09 B;  3RFG A;  3I7L A;  3OKW A;  1GXR A;  2TRC B;  4J8G A;  2H13 A;  1B9Y A;  1NEX B;  3JZN A;  4CI3 A;  4E5Z B;  2J55 H;  5IJ8 E;  3UVL A;  3MMY A;  4L9O A;  4J79 A;  4R7A B;  4FA4 D;  3VH0 A;  5GXH A;  5SXM A;  5FKS A;  5EAP A;  4J81 A;  2H6Q A;  4OZU A;  2CO0 A;  3F3G A;  2BCJ B;  5H17 A;  2IUQ A;  1Q47 A;  1R5M A;  3B7F A;  3SXT D;  3CIK B;  4O3U B;  1XIP A;  3EG6 A;  4ZOY A;  3KRX B;  3OTT A;  5I5J A;  4CZV A;  3I7O A;  5CXB A;  4J0W A;  2YNP A;  3F3P A;  4FAN D;  2I3T A;  4CI1 A;  3ODT A;  3SVW D;  5GMK n;  3I7P A;  3MKS B;  5H1M A;  3N0D A;  3FGB A;  2AGX A;  4LG8 A;  3SMR A;  4Z8L A;  4O9D A;  3IIW A;  3RN0 D;  4FA5 D;  4O3T B;  2HKR A;  4J73 A;  4ERZ A;  1B9X A;  3DXK C;  2OVR B;  4E54 A;  4J84 A;  3JPX A;  3SCY A;  4GQ1 A;  3ULE C;  3SJL D;  2YB8 B;  5HQG A;  4HDJ A;  4X3E A;  4GM8 A;  2YMU A;  3J80 g;  4PSW B;  5FA5 B;  4GGA A;  5CXC B;  2EBS A;  3SFZ A;  5EML B;  4CY3 A;  3UVO A;  4L3G D;  2CE8 A;  1SQ9 A;  3SBQ A;  3PSL A;  2HKM A;  2J56 H;  1K8K C;  5IC7 A;  5AJA A;  3PXT D;  1MDA H;  3SLE D;  3EI3 B;  3F3F A;  3C5M A;  5FKQ A;  2XU7 A;  3I2N A;  4L1Q D;  4GZ8 A;  1FWX A;  3AL9 A;  3UVN A; 
#chains in the Genus database with same CATH topology
 1E8M A;  5FXY A;  1I2M B;  2GC7 A;  2XYI A;  3IUN A;  3JB9 L;  3EMH A;  4A0A B;  2QC5 A;  4NAA A;  2I0R A;  5FQD A;  4OWR A;  4ERQ A;  2XZG A;  5I5M A;  3IUM A;  3MUO A;  4EWR A;  1JMX B;  3C99 A;  3EQ9 A;  2HYE A;  4A0B A;  2CO0 C;  4MK0 B;  1GOH A;  1P22 A;  4QRJ A;  3OF7 A;  4LG9 A;  4JSV C;  3I8C A;  4NSX A;  4X63 B;  4AOW A;  4J78 A;  3VI3 A;  3DM0 A;  4ZOX A;  5C86 A;  4KFM B;  3MVD K;  5CYK A;  2HU5 A;  2OIZ A;  4FWW A;  5HDB A;  1S4U X;  3MZK A;  2IUV A;  2J57 G;  2B4E A;  5IGO A;  3AL8 A;  5EM2 A;  1U4C A;  3NVN A;  4BP9 A;  4GM3 A;  3AFC A;  3KCI A;  5EMJ B;  4WK4 A;  2OK6 A;  2VDL A;  1JMZ B;  3BG1 A;  2O9K A;  5EAR A;  5EMK B;  4I79 A;  1GOG A;  4JT5 C;  2B5N A;  2P9I C;  1TYQ C;  3GRE A;  3T3P A;  2CN2 A;  4AMY A;  2HJ4 A;  4QL1 A;  4BUJ C;  5K1C C;  2PM9 A;  4CI2 A;  2VDQ A;  1VE7 A;  2EIB A;  3GFC A;  4D6V A;  3I8E A;  3UKR C;  4CC9 A;  2H68 A;  5FKT A;  3A0F A;  3ZDZ A;  2PM6 B;  2P9N C;  3ZDX A;  4L3H D;  1ERJ A;  4X61 B;  2VDM A;  4PXW A;  5M5V A;  1BPO A;  4Y5R D;  3FCS A;  1NR0 A;  3JZH A;  1C9L A;  4DNV A;  4PNK B;  2P9L C;  4XEI C;  4A2M A;  3JRO A;  5HE3 B;  2MTA H;  4LGN A;  4G56 B;  5CXB B;  2H9M A;  3RRM C;  3U4Y A;  3NID A;  5TEF A;  4K3I D;  4JSP C;  2VDR A;  3HFQ A;  4BP8 A;  2YNO A;  5I5I A;  4ERY A;  3RFH A;  2EIC A;  5TDH B;  3IUL A;  3EI1 A;  4AMZ A;  2IUR A;  2VC2 A;  3IKO A;  4TZ4 A;  3EI4 A;  5C2V B;  1YFQ A;  4O45 A;  4A08 A;  2PM7 B;  4E54 B;  4O02 A;  3NVQ A;  4GGC A;  3CFS B;  2I0S A;  4CZY A;  5EAM A;  5A2Q g;  3GD1 I;  1N6D A;  4ESG A;  3C9C A;  4U7A A;  2W18 A;  2GNQ A;  4XYI A;  1QNI A;  3O4J A;  5TF2 A;  3ZE1 A;  2OJY A;  3UVM A;  4O2W A;  4BCD A;  3OKY A;  3EWE A;  4U1E I;  4NEN A;  3L4O D;  2P9P C;  1XHM A;  2Q7Q A;  2VDP A;  4Z7Q A;  3SBP A;  4A2L A;  5M5T A;  1SQJ A;  2P9S C;  1A0R B;  3DWL C;  3QI0 A;  1UOQ A;  2UZX B;  1GP2 B;  2H9N A;  3UVK A;  2HXC A;  4J8B A;  4WK2 A;  2G99 A;  2IWK A;  4UI9 R;  4PBZ A;  4FHL A;  4A11 A;  3PXW D;  3V9F A;  2I3S A;  2EIE A;  3IJE A;  1GOT B;  1O6G A;  3I7K A;  3OL2 A;  3OW8 A;  1N6F A;  2AGY A;  2YNN A;  3OL2 B;  5AMS A;  4A0B B;  2AH0 A;  2OVQ B;  5HYN B;  1VZ2 A;  5H14 A;  1PBY B;  4J82 A;  3RSE C;  4ES0 A;  2HU7 A;  4FA9 D;  1VYH C;  4FA1 D;  2IWF A;  4ZOV A;  4A7J A;  1XKS A;  3EU7 A;  1TYE A;  4N14 A;  3FM0 A;  5IGQ A;  5CYK B;  4CZX A;  2AH1 A;  3NVX A;  4IMM A;  3AL8 B;  3K6S A;  5EM2 B;  3MZL A;  2BKL A;  3EI2 A;  5GSA A;  3I89 A;  3DDU A;  1MG3 A;  3K26 A;  4IRZ A;  4Y7R A;  3KRW B;  3SN6 B;  5FLX g;  3MKQ A;  2QZP A;  2H9P A;  2HES X;  5JWZ A;  1SHY B;  1K3I A;  4H5J A;  3P4F A;  3I7N A;  3IJ1 A;  2AGZ A;  1TBG A;  2OVP B;  4BL0 A;  5EMM B;  5E6S A;  4A09 A;  2AGW A;  2PM9 B;  2UZY B;  4AEZ A;  3QHY B;  2H9L A;  3JZG A;  5IJ7 E;  5KDO B;  2VDO A;  5THA A;  5M61 A;  4DNW A;  4E5Z A;  1MG2 A;  2CNX A;  2XL2 A;  3MUN A;  3RLM D;  4CY1 A;  1PGU A;  3EQ7 A;  4CY2 A;  5K19 A;  3IJC A;  2H47 A;  3MXX A;  4O1Q D;  5AFU 3;  3RN1 D;  2P9K C;  3NIF A;  2Z2O A;  4PSX B;  4J0X A;  3C75 H;  4NBM A;  4PC0 A;  1H2Z A;  4GMB A;  5TEE A;  4WK0 A;  4XYH A;  4JSX C;  3IUJ A;  4K3J B;  4BH6 A;  2H6K A;  4JT6 C;  4QT8 A;  3UKU C;  1O6F A;  4GGD A;  3EI1 B;  4Z7N A;  3OKT A;  3UR4 A;  3ZWL B;  2H3X A;  2I0T A;  3EI4 B;  3SWS D;  1JV2 A;  3K27 A;  2EID A;  4A08 B;  2BBK H;  3DSM A;  4J77 A;  3RMZ D;  5FKR A;  3JAM g;  3E0C A;  4D0K A;  4D9S A;  4PBY A;  4NC4 A;  3ZE2 A;  2HJB A;  2IAA A;  4CI8 A;  2VDN A;  3PVW B;  4JXM A;  3N0E A;  3SHF A;  1GG2 B;  4GQB B;  4GQ2 P;  5B4W A;  3I7H A;  4GM9 A;  4AN0 A;  4QQE A;  4FB1 D;  4MMX A;  4JD2 C;  1RI6 A;  3CFV A;  1GOF A;  3J81 g;  3OKY B;  2B5L A;  5C9Z B;  2AQ5 A;  5IT9 g;  3JRP A;  5CXC A;  5EAL A;  2IUP A;  1N6E A;  4IA9 A;  5E6R A;  5C2W B;  2Z2N A;  3PE7 A;  2PBI B;  5HE2 B;  3DXM C;  1PI6 A;  3V4P A;  1L0Q A;  3PSC B;  3BG0 A;  4CY5 A;  3AH8 B;  2H6N A;  3V5W B;  3EI3 A;  2QXV A;  4A11 B;  4DNU A;  3IIY A;  3IUR A;  1PEV A;  4X60 B;  3IJ0 A;  1H2X A;  3V4V A;  1M1X A;  5GXI A;  4RE5 A;  4RE6 A;  2H14 A;  2XE4 A;  2JKX A;  5M5R A;  3PVU B;  3T3M A;  3V7D B;  2P9U C;  1JOF A;  3ORV D;  2YBA A;  4A0A A;  4J87 A;  3FRX A;  1L5G A;  2OK4 A;  2HU8 A;  4JSN C;  1C9I A;  3K71 A;  5HE1 B;  3BWS A;  4AX4 A;  3VGZ A;  2B5M A;  1OLZ A;  2QR5 A;  3IUQ A;  3PXS D;  1K32 A;  3VA6 A;  2AGL A;  4J86 A;  4BCB A;  4L1M A;  3SBR A;  1E5T A;  1U2V C;  2G9A A;  3L4M D;  1OMW B;  3EI2 B;  2CN3 A;  3W15 A;  5M5S A;  3ZE0 A;  5HE0 B;  1VE6 A;  5E6U A;  1QFM A;  4G1E A;  4ZN4 A;  2Z2P A;  2XL3 A;  3O4H A;  2GC4 A;  4H5I A;  4YVD A;  4G1M A;  1A12 A;  4ZOZ A;  4FAV D;  1JJU B;  2CE9 A;  5C92 A;  4A09 B;  3RFG A;  1U8C A;  3I7L A;  3OKW A;  3FCU A;  1GXR A;  2TRC B;  4J8G A;  4Z7O A;  4QAM A;  2H13 A;  1B9Y A;  1NEX B;  2VDK A;  3JZN A;  4CI3 A;  4E5Z B;  2J55 H;  5IJ8 E;  3UVL A;  3MMY A;  4L9O A;  4J79 A;  4R7A B;  4FA4 D;  3VH0 A;  4UM9 A;  5GXH A;  5SXM A;  5FKS A;  2XDW A;  5EAP A;  4J81 A;  2H6Q A;  4OZU A;  1JTD B;  2CO0 A;  3F3G A;  2BCJ B;  5H17 A;  2IUQ A;  4JHN A;  1Q47 A;  1H2Y A;  1R5M A;  1YR2 A;  3B7F A;  3SXT D;  3NIG A;  3GC3 B;  3EQ8 A;  4MMZ A;  3VI4 A;  4AN1 A;  3CIK B;  4O3U B;  1XIP A;  3EG6 A;  4ZOY A;  4G55 A;  1UTC A;  2VZ1 A;  3KRX B;  4UM8 A;  1H2W A;  3OTT A;  3O4G A;  5I5J A;  4CZV A;  3I7O A;  5CXB A;  4JHP C;  4J0W A;  2YNP A;  2VZ3 A;  3F3P A;  4MMY A;  4FAN D;  2I3T A;  4CI1 A;  1QFS A;  3ODT A;  3SVW D;  5GMK n;  3ZDY A;  3I7P A;  3MKS B;  5FFO A;  3N0D A;  4WJK A;  5H1M A;  4BCC A;  3FGB A;  2AGX A;  4LG8 A;  3SMR A;  4Z8L A;  4O9D A;  3IIW A;  3RN0 D;  4FA5 D;  4O3T B;  2HKR A;  4J73 A;  4ERZ A;  1B9X A;  3DXK C;  2OVR B;  4E54 A;  4J84 A;  1UOP A;  3JPX A;  3SCY A;  4GQ1 A;  3ULE C;  3SJL D;  2YB8 B;  5HQG A;  4HDJ A;  4X3E A;  4GM8 A;  2YMU A;  3J80 g;  4PSW B;  3K72 A;  3IVM A;  4GGA A;  2EBS A;  5CXC B;  5FA5 B;  3SFZ A;  5EML B;  4CY3 A;  3UVO A;  1UOO A;  1E8N A;  4L3G D;  2WQ8 A;  5M5U A;  2CE8 A;  1SQ9 A;  3SBQ A;  3PSL A;  1VZ3 A;  2HKM A;  2J56 H;  1K8K C;  3O4I A;  5IC7 A;  5AJA A;  3PXT D;  1MDA H;  1T2X A;  3SLE D;  3EI3 B;  5FFG A;  3F3F A;  3C5M A;  5FKQ A;  2XU7 A;  3I2N A;  4L1Q D;  4GZ8 A;  1FWX A;  3AL9 A;  3UVN A; 
#chains in the Genus database with same CATH homology
 5FXY A;  2GC7 A;  2XYI A;  3JB9 L;  3EMH A;  4A0A B;  2QC5 A;  2I0R A;  5FQD A;  4OWR A;  4ERQ A;  5I5M A;  4EWR A;  1JMX B;  3C99 A;  2HYE A;  4A0B A;  2CO0 C;  4MK0 B;  1P22 A;  4QRJ A;  4LG9 A;  4JSV C;  3I8C A;  4NSX A;  4X63 B;  4AOW A;  4J78 A;  3DM0 A;  4ZOX A;  4KFM B;  5CYK A;  2OIZ A;  4FWW A;  1S4U X;  3MZK A;  2IUV A;  2J57 G;  2B4E A;  5IGO A;  3AL8 A;  5EM2 A;  1U4C A;  3NVN A;  4GM3 A;  3AFC A;  5EMJ B;  2OK6 A;  3BG1 A;  1JMZ B;  2O9K A;  5EAR A;  5EMK B;  4I79 A;  4JT5 C;  2B5N A;  2P9I C;  1TYQ C;  3GRE A;  2CN2 A;  2HJ4 A;  4QL1 A;  4BUJ C;  5K1C C;  2PM9 A;  4CI2 A;  3GFC A;  4D6V A;  3I8E A;  3UKR C;  4CC9 A;  2H68 A;  5FKT A;  3A0F A;  2PM6 B;  2P9N C;  4L3H D;  1ERJ A;  4X61 B;  4PXW A;  4Y5R D;  1NR0 A;  3JZH A;  4PNK B;  2P9L C;  4XEI C;  4A2M A;  3JRO A;  5HE3 B;  2MTA H;  4LGN A;  4G56 B;  5CXB B;  2H9M A;  3RRM C;  3U4Y A;  5TEF A;  4K3I D;  4JSP C;  3HFQ A;  2YNO A;  5I5I A;  4ERY A;  3RFH A;  5TDH B;  3EI1 A;  2IUR A;  4TZ4 A;  3IKO A;  3EI4 A;  5C2V B;  1YFQ A;  4O45 A;  4A08 A;  2PM7 B;  4E54 B;  3NVQ A;  4GGC A;  3CFS B;  2I0S A;  4CZY A;  5EAM A;  5A2Q g;  1N6D A;  4ESG A;  3C9C A;  4U7A A;  2W18 A;  2GNQ A;  4XYI A;  1QNI A;  5TF2 A;  2OJY A;  3UVM A;  3OKY A;  3EWE A;  4U1E I;  3L4O D;  2P9P C;  1XHM A;  2Q7Q A;  3SBP A;  4A2L A;  1SQJ A;  2P9S C;  1A0R B;  3DWL C;  2UZX B;  1GP2 B;  2H9N A;  3UVK A;  2HXC A;  4J8B A;  2G99 A;  2IWK A;  4UI9 R;  4PBZ A;  4FHL A;  4A11 A;  3PXW D;  3V9F A;  2I3S A;  1GOT B;  3I7K A;  3OL2 A;  3OW8 A;  1N6F A;  2AGY A;  2YNN A;  3OL2 B;  5AMS A;  4A0B B;  2AH0 A;  2OVQ B;  5HYN B;  5H14 A;  1PBY B;  4J82 A;  3RSE C;  4ES0 A;  4FA9 D;  1VYH C;  4FA1 D;  2IWF A;  4ZOV A;  4A7J A;  1XKS A;  3EU7 A;  4N14 A;  3FM0 A;  5IGQ A;  5CYK B;  4CZX A;  2AH1 A;  3NVX A;  4IMM A;  3AL8 B;  5EM2 B;  3MZL A;  3EI2 A;  5GSA A;  3I89 A;  1MG3 A;  3K26 A;  4Y7R A;  3KRW B;  3SN6 B;  5FLX g;  3MKQ A;  2H9P A;  2HES X;  5JWZ A;  1SHY B;  4H5J A;  3P4F A;  3I7N A;  3IJ1 A;  2AGZ A;  1TBG A;  2OVP B;  4BL0 A;  5EMM B;  4A09 A;  2AGW A;  2PM9 B;  2UZY B;  4AEZ A;  2H9L A;  3JZG A;  5IJ7 E;  5KDO B;  5THA A;  4E5Z A;  1MG2 A;  2CNX A;  2XL2 A;  3RLM D;  4CY1 A;  1PGU A;  4CY2 A;  5K19 A;  3IJC A;  2H47 A;  3MXX A;  4O1Q D;  5AFU 3;  3RN1 D;  2P9K C;  2Z2O A;  4PSX B;  4J0X A;  3C75 H;  4PC0 A;  4GMB A;  5TEE A;  4XYH A;  4JSX C;  4K3J B;  4BH6 A;  2H6K A;  4JT6 C;  4QT8 A;  3UKU C;  4GGD A;  3EI1 B;  3OKT A;  3UR4 A;  3ZWL B;  2H3X A;  2I0T A;  3EI4 B;  3SWS D;  3K27 A;  4A08 B;  2BBK H;  3DSM A;  4J77 A;  3RMZ D;  5FKR A;  3JAM g;  3E0C A;  4D0K A;  4PBY A;  2HJB A;  2IAA A;  4CI8 A;  4JXM A;  3PVW B;  3N0E A;  3SHF A;  1GG2 B;  4GQB B;  4GQ2 P;  5B4W A;  3I7H A;  4GM9 A;  4QQE A;  4FB1 D;  4JD2 C;  1RI6 A;  3CFV A;  3J81 g;  3OKY B;  2B5L A;  5C9Z B;  2AQ5 A;  5IT9 g;  3JRP A;  5CXC A;  5EAL A;  2IUP A;  1N6E A;  4IA9 A;  5C2W B;  2Z2N A;  3PE7 A;  2PBI B;  5HE2 B;  3DXM C;  1PI6 A;  1L0Q A;  3PSC B;  3BG0 A;  4CY5 A;  3AH8 B;  2H6N A;  3V5W B;  3EI3 A;  2QXV A;  4A11 B;  3IIY A;  1PEV A;  4X60 B;  3IJ0 A;  5GXI A;  2H14 A;  3PVU B;  3V7D B;  2P9U C;  1JOF A;  3ORV D;  2YBA A;  4A0A A;  4J87 A;  3FRX A;  2OK4 A;  4JSN C;  5HE1 B;  3BWS A;  3VGZ A;  2B5M A;  1OLZ A;  3PXS D;  1K32 A;  3VA6 A;  2AGL A;  4J86 A;  3SBR A;  1U2V C;  2G9A A;  3L4M D;  1OMW B;  3EI2 B;  2CN3 A;  3W15 A;  5HE0 B;  4ZN4 A;  2Z2P A;  2XL3 A;  2GC4 A;  4H5I A;  4YVD A;  4ZOZ A;  4FAV D;  1JJU B;  2CE9 A;  4A09 B;  3RFG A;  3I7L A;  3OKW A;  1GXR A;  2TRC B;  4J8G A;  2H13 A;  1B9Y A;  1NEX B;  3JZN A;  4CI3 A;  4E5Z B;  2J55 H;  5IJ8 E;  3UVL A;  3MMY A;  4L9O A;  4J79 A;  4R7A B;  4FA4 D;  3VH0 A;  5GXH A;  5SXM A;  5FKS A;  5EAP A;  4J81 A;  2H6Q A;  4OZU A;  2CO0 A;  3F3G A;  2BCJ B;  5H17 A;  2IUQ A;  1Q47 A;  1R5M A;  3B7F A;  3SXT D;  3CIK B;  4O3U B;  1XIP A;  3EG6 A;  4ZOY A;  3KRX B;  3OTT A;  5I5J A;  4CZV A;  3I7O A;  5CXB A;  4J0W A;  2YNP A;  3F3P A;  4FAN D;  2I3T A;  4CI1 A;  3ODT A;  3SVW D;  5GMK n;  3I7P A;  3MKS B;  5H1M A;  3N0D A;  3FGB A;  2AGX A;  4LG8 A;  3SMR A;  4Z8L A;  4O9D A;  3IIW A;  3RN0 D;  4FA5 D;  4O3T B;  2HKR A;  4J73 A;  4ERZ A;  1B9X A;  3DXK C;  2OVR B;  4E54 A;  4J84 A;  3JPX A;  3SCY A;  4GQ1 A;  3ULE C;  3SJL D;  2YB8 B;  5HQG A;  4HDJ A;  4X3E A;  4GM8 A;  2YMU A;  3J80 g;  4PSW B;  5FA5 B;  4GGA A;  5CXC B;  2EBS A;  3SFZ A;  5EML B;  4CY3 A;  3UVO A;  4L3G D;  2CE8 A;  1SQ9 A;  3SBQ A;  3PSL A;  2HKM A;  2J56 H;  1K8K C;  5IC7 A;  5AJA A;  3PXT D;  1MDA H;  3SLE D;  3EI3 B;  3F3F A;  3C5M A;  5FKQ A;  2XU7 A;  3I2N A;  4L1Q D;  4GZ8 A;  1FWX A;  3AL9 A;  3UVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...