1BA9A

The solution structure of reduced monomeric superoxide dismutase, nmr, 36 structures
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEQSTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of reduced monomeric Q133M2 copper, zinc superoxide dismutase (SOD). Why is SOD a dimeric enzyme?.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 31
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ba9A00
2WKOF 2AQPA 1PU0A 2GBTA 3MNDA 1XTLA 1SXCA 3ECWA 3GQFA 4MCNA 2WYZA 1SDAB 3GTVA 1S4IA 5KBMA 1F1GA 3CQPA 4A7SA 3HW7A 2XJKA 1SDYA 3KH4A 3L9EA 2C9VA 3RE0A 4A7TA 2ZOWA 3ECUA 4L05A 2GBUA 1E9PB 4MCMA 4BCZA 4A7UA 1SRDA 1OALA 2JLPA 3KBFA 2Z7ZA 1SXBA 2K4WA 1YAZA 4A7QA 1OAJA 2XJLA 1SOSA 1Q0EA 3GZQA 1L3NA 4N3TA 1IB5A 1SXAA 2VR8A 1E9OB 1SXZA 2VR7A 3GZPA 4OJAA 4U4IA 1IBBA 2AQSA 2JCWA 2Z7WA 5CU9A 3GZOA 3T5WA 1CB4A 2APSA 1MFMA 2ZKYA 1QUPA 1Z9PA 1EQWA 1RK7A 2WZ6A 1DO5A 3LTVA 1B4TA 1F18A 1U3NA 1ESOA 3S0PA 5KBLA 3HOGA 1SPDA 1SXSA 3KM1A 1DSWA 1E9QA 3QQDB 3H2QA 2AF2A 1COBA 3CQQA 1CBJA 1E9PA 1P1VA 1UXLA 3F7LA 1B4LA 4N3UA 1IBHA 4A7GA 2SODB 2WWOA 1F1AA 1N19A 4B3EA 3SODB 1UXMA 3CE1A 2AQTA 1SXNA 3F7KA 3KM2A 1KMGA 2AQQA 2C9SA 4FF9A 2WZ0A 2ZKWA 2AQRA 2WZ5A 2V0AA 1TO4A 1BZOA 3HFFA 3GTTA 2AQNA 5KBKA 2WWNA 2ZKXA 1YAIA 2Z7YA 3L9YA 1OEZW 2E47A 4A7VA 1PTZA 1IBDA 1N18A 1E9QB 3QQDA 1JK9B 4BD4A 1IBFA 2Z7UA 1F1DA 1E9OA 1OZTG 2WYTA 1JCVA 1YSOA 1XTMA 2WKOA 1AZVA 1TO5A 1FUNA 2GBVA 4BCYA 1BA9A 3K91A 2VR6A 2R27A 2LU5A 2C9UA 1JK9A 1XSOA 1PZSA 2E46A 1HL4A 2NNXA 2AEOA 2Q2LA 1OZUA 3KH3A 3KBEA 3ECVA 3PU7A 4OH2A 4A7GF 1Z9NA 1EJ8A 3H2PA 1HL5A 3MKGA
chains in the Genus database with same CATH superfamily
5JHMA 4KGLA 4Z76B 1TJXA 3BSZH 1DQLL 2BK8A 1OAXL 5KWYC 2X0UA 2QGBA 4L8CA 2WSDA 1JTOA 1URLA 4C56A 3DOSB 1AP2A 2R4RH 2WLLA 5BZZA 1S7RB 2ARJQ 3GD1C 3E6FB 4KK5D 2LV4A 3TA3C 1T5XA 5L7XH 4X5LA 4X9YA 1G5AA 3MUGB 4HUKB 4L8BB 3BC9A 2HJKA 5A7EA 4WEUD 4D9QD 1YUKB 3CZJA 4KKLD 4HJGA 1PZUB 5JPMC 2ERJC 4JPWL 3ES6B 4BM7A 4MJIB 3QYNA 4YHNA 1ED3B 2EC8A 5KJ7E 3VW3H 3H7BA 4TLSA 4G1EB 2F8VA 2PPCA 2AJXL 5KS9A 3MJ7B 3N85H 1FF5A 5C07E 4H0HB 4L4TD 3D2UA 3GYRA 3L3KA 4OLYH 4YUEH 3LZFH 3QZMA 3UADA 4TVUA 5IJKC 3DKHA 1EPFA 1TQBC 2G3ZA 3A6OA 4P5MA 1G94A 2WBJD 1JZDC 2W0KA 1EMTH 1G5GA 2CHDA 4PJAA 3NCJL 4AVIA 3QO0A 1BPVA 1JPSH 3IJEA 3LN4A 4L37B 3CUPA 1NTDA 3IDXL 1E9PA 2RAMA 2C3VA 1UXLA 2F5AL 2IG2H 1NICA 3QIBB 2VN4A 1Z9LA 4BQ8A 2R23B 3KXFA 1IJNA 2GEEA 4F33A 3WXWH 4Y4FD 2I5YL 4N2NA 4HGWB 2E7LC 4Z7NE 2F7PA 4M7JH 5AWNL 4NEHB 1CYXA 2R0LH 4MJ6B 1GJUA 1RLWA 1XGTB 1OVZA 2PW1B 2X4PA 3U36B 3FB6B 4OFIA 1IC5L 5ISZD 4JJOA 3MLZL 2VITA 3WKPA 3O4LD 4CC1A 5GSVB 4X8JB 3LNIA 1HKLL 4PJ8A 4N5EC 1DFBH 3W2DH 5ETUA 3EF7A 2XFXA 4BK8A 2GC4C 2JI2A 5DLLA 5F7KC 1IC4L 1AD0A 4R9HA 4U7KA 3MBWA 1J8SA 3TCLA 4G6ML 4NWUH 1KEGL 4ZPVB 4BCYA 1JZEA 4HSAC 4JL1A 2VDML 3O6KL 3I6LE 2DY2A 1C5DB 1D6EB 1ZIBA 1KYDA 2AEWA 2DI8A 1HCFX 1I7ZB 3WNJA 3H53A 3ULAB 1KB9J 4F5CE 5E1IA 5I5JA 1AC6A 1CN4A 3MBXL 3WTVA 1QO3B 1TQCB 3T4YA 2A74A 2A1WH 4NM8L 1S9YB 3NA4A 3I9IA 4OTXH 3PDOB 4ZPTA 3CMOL 1UD3A 1NDTA 3RWDA 3S2AA 2EXWC 4WO0A 3IGUA 1D5XA 5FEBA 4L1TA 1NC4A 1X3DA 2CSPA 4X6EA 3L5JA 2NSQA 1INQB 4JE0A 3ESVF 4EI6B 6FABH 3U4EA 1OB1B 4BJLA 3KW7A 3QUML 1F1GA 1TNNA 3HW7A 4WFED 4JO1L 4GO8A 4LOVA 4YK4B 5DZPA 4KNTA 2LW3A 3TS8A 2Q7AA 1MRFL 4WGKA 1JGVL 2DMKA 2J1YA 1KBBA 3D0LB 1E8WA 3EYVA 3NJGA 2ZQKA 3I74A 1UD2A 4L4TA 4EI5A 5EEZA 4J12A 1XSIA 1SRDA 5DC0A 4AVKA 4R8WH 4OUUB 5DD3H 3LX9A 1CURA 1IGMH 2A6KA 4JM2D 1KIQA 3OR6B 4LSUL 5ACZB 3UP1A 2PXYD 4IQHA 4R7DA 3ML9A 5TE7H 5IEKA 3AY4A 4L3CB 1U2HA 4NHUA 2ZX7A 1W9XA 1HSAA 1UM5L 4HIPA 1I8UA 3U79A 4BDVB 1IZKA 2E76C 4CW1A 1F11A 5KSVB 4ENEC 1DQIA 2EO1A 3GXUB 1N64H 4JGMA 4ENZA 2ZKHL 4NRZB 5E8OA 3DGGB 5F9DC 2I69A 3S34L 1UH2A 5AW5B 2ZXBA 3OKNA 3L2LA 5KANG 1HZLA 3UIZA 1WBZB 1UD4A 4CSPA 2WBJB 4L4TB 4JQVA 4G6KL 4F8OA 3BWAA 2YIHA 2DV6A 1W15A 2YAFA 3MODH 1A7NH 2CUAA 4YL4A 1GPOL 4K3JH 3V6ZB 3QZPA 4M62L 1JRHL 3MZGB 3BKYH 1U6AL 3ZKSD 4JFZH 4AT6B 4PGEA 4PBVC 1I1AC 3HUJA 5CHNA 3WNIA 4Q14A 3I3DA 5LDSA 2F7IA 1WAAF 3K8LA 4N90D 4PRNA 2M8XA 4MA7L 1GY2A 5HYQB 5C07A 3OBAA 3V0IA 2J1XA 1EA9C 2BIHA 1IEBB 3LH2H 1JI1A 4QOKA 5D72L 5T3XH 3U1SH 2QZQA 3MV8E 4YDJA 5CMAA 3R4RA 4LASH 1IBFA 1U21A 2WTRB 3FU0A 5TDOA 1LJMA 4TSCH 2EVJA 2DQUL 3EW3B 3QDJD 3VD9A 3AS2A 4GXVL 3IFLH 1TLKA 2D7QA 3P73A 4QHUA 5F6HJ 3TVMC 1DQMH 1MSPA 2AEQH 3EJPA 1AGCB 2W65A 2W0FA 3D18B 1RUMH 1WH0A 3UTQA 3AACA 4PV9A 3ECVA 2BZ7A 1RULH 1RPQA 4HWUA 1T83C 1E27A 4NO3B 3NH7H 5DUBB 3TBSA 1IM9A 4OZ4B 4IMLB 3L95A 4RGOH 1Z3RA 2GB2A 4PJIE 3S8WA 4QPEA 4YXKL 1N70A 4P49A 3QWOB 1PX4A 2Z0BA 5E9AA 3TWCH 1AO7A 1S4IA 3N85L 4XWOC 2OMUA 4DW2L 4DO4A 1WAAA 2J6EH 2PWEA 3KPSB 1QP1A 4JFED 3PWVB 4XMVA 3EH3B 1UURA 3K80A 1YC7A 4FQIH 3ASWA 3BHBB 3FU9A 3B7RL 4M1GL 3CLFL 5F6IB 4KI5F 1IAII 4UILL 4WU5B 4WNJA 4ELMA 5LGKA 4HC1A 4GKOA 1YVLA 1G7QA 2ADFH 2B1OA 2DYPD 4MLSA 4MD5A 1WF5A 4NSKB 4YLBA 3HIZA 2W07B 1GYAA 3N55A 5DC2A 5F72S 3QXWA 3VE0B 4AQAB 1J5HA 1YEKL 3ARDD 3P73B 4NCC2 3IJYA 4AG4L 3W38A 2FT6A 3II2A 3UG4A 4NJ9H 3E9UA 5IJDC 1OGAA 4W9GC 2P8LA 1ZS8A 5EFIA 3QI9A 4OZHE 1UJ3A 4C8XA 4JCWA 4NKQB 2FBJL 3QXUA 1XXDC 4OBSA 3PG2A 2OFQA 5B8CA 3GMNA 3AWEA 4JN2A 2VXQH 4ORZC 5DRNB 2ZCZA 4PIRF 4X98A 1DQJB 3BN9C 4XCYB 3U46B 5I30L 4BELD 4AT6A 3ZK0A 3K74B 4EIBA 1D5RA 1KB5A 3HUJB 5I76A 3GRBA 3FB7B 1SNRA 2AXWA 4N87A 3QUXB 2RTTA 4Q9CA 3RY5A 4UQIM 3RB5A 1H19A 4PWEA 5A2IH 4MXVF 4PP2A 4BFOA 4GO6B 4HOMA 1BQHG 4LGRB 2Z8VC 4TNGA 4MVBD 2P8LB 3IKCA 4NO5A 1LXMA 1NFDF 1UJ3B 3GBEA 2OL3B 5DFAA 4K5NA 4FFZL 1AJ7H 2IAMD 4YK4C 4IOSD 3V55A 4S1DD 3VE0A 2YQBA 1ITCA 4KO6A 1NL0L 2BNQD 2Y7MA 2YXWA 3BQUB 3QAZC 4OM1L 5HJBA 3NA9H 4G8IB 1HHHB 2VR6A 5IEHB 3HS0B 4AEIH 1UXWB 3CH1A 3BQUA 5KTEL 4Z7VB 1N5YL 3GK8L 3ZRFC 3L3OB 4WV1B 5AB0A 3OMNB 1OP5H 1I1RA 1MY5A 1CFNB 1R5WB 4GMTL 4XWOD 1OGSA 5AFAA 3TT1H 2OMUB 3DGCR 1NIFA 1BQ5A 4MDIB 4YQXH 3LY6A 2ICWA 4XO3A 2ISDA 4R90H 4YHLH 4LESA 4NPJA 1YUHB 3RIKA 4PLKC 5D5MA 4FFYA 2R8SL 3F8UB 1WYJA 2FEEL 1NFDA 3LH9A 2K0RA 4LQFL 3SE4A 2Y06H 4I48A 3TFBA 2BC4A 2XN9A 3W39A 2X2IA 2OSWA 4AGPA 2R2EA 5ESVB 3LMJL 3SKJL 5BQ7A 3ZZQA 2ZT9C 3L4CA 4DK6A 4WUKH 4XAWH 1RK1B 3F2LA 1ZT4A 4H20H 1F4WL 4HMDA 1CPUA 1G0XA 1ZS2A 5EUOE 5GGVH 2EH7L 5K9QI 1ZMYA 5HHPB 4PCYA 3U0TB 1FL6A 2C3XA 4WFFE 3VWKC 1VENA 5ESAA 1IBBA 2FLRT 5B3SB 3OHXC 3TBWB 4BZ1H 3RTQB 4FQJL 1V7NH 3D39D 2O61A 2NXYD 3V8CA 4LCYA 1HEZA 4LLUA 4NX0A 4I3SH 4Y5VC 3F3HA 2NY0C 1MG3C 1HXMA 4RA3A 1XH1A 4HIEA 5BO0D 3K6OA 4A2LA 4UDUA 1ZLSH 2R4SL 3G5VA 3G6AA 4ZDHB 1ECYA 5DGRA 1V8HA 2HJFB 2ENQA 3CDZA 3CFMA 3ZDZB 3SQOH 1DEEA 5CLXA 3FTSA 3GIVB 2MHAA 4YPGA 4FEIA 3RGVC 2ITDA 1ZVHA 5FYLE 2PCPB 3GB7B 4Z7OF 3QXDB 3IF1B 3HC2A 4WI4A 1HOCA 1U8NA 5ERWB 3BYTA 3MUY1 3VXME 3DO4A 2CMRH 4ONGH 4X7DC 1YAIA 1JYNA 4OCYL 1CFMA 1G6VK 5IT2L 1VZHA 4K7FA 3C09C 3HN8A 3CXDL 1R3HB 1XIWC 1AGDA 2WKLA 3CFNA 3M7FB 1H15B 5KG9A 2W9DH 3ZTNH 1XSJA 3ZE1E 2WYTA 4GG6E 1FVDA 5E5MA 1J8HD 5EU6B 4NXSA 4NUJB 4O2EA 2R15A 2WLNA 4QKXB 1RUKL 1YY9C 4RMSA 3RAJL 3MRHA 1GR7A 1A6UH 2PTUA 2CJTA 1FSKC 1NSNH 4XI5D 4KQ4L 3BEWB 4Y16D 4NC1E 3T6QC 3MR9A 4CVWA 1NMBH 3QBTB 4OR1A 1JUFB 2JIXD 5DHDA 5GS0H 3GMLB 3EZ8A 5D7LB 3MJ9H 5CEYA 3IF1A 4HKBB 3TBVB 1I3RB 4HDIB 1XZ0B 5HPMA 1U9KA 3UMNA 1EJFA 3V4VH 2H0EA 5BMFH 5CAYB 3L6FB 2FSEB 3W11C 1WRFA 2GJ6B 3C5ZA 4OGYH 4HJTA 2BOBA 2ICCA 3OPZL 5CEXA 4EZLA 4ZSOA 1JGIA 3PNRB 4KRPD 4DK3A 4TUKL 5EU6D 4JL2A 1R4XA 2BVUA 4JDVA 3QPXH 2XTJC 1PNDA 4BA8A 2BSTA 4G7QB 1AD9A 5JW3H 5IB4A 3DARA 3HPLA 2ZAHA 1T3FA 4HKZA 5D2NE 5KYYB 3T6ZA 5J4MA 5F9WB 3GNML 1GZQA 1N8ZB 1MVFA 2WV3A 3TTSA 4GRLB 3HB3C 4MA8L 3DOIA 4A7QA 3ARGB 3GMLA 1CE6A 1YA5A 1CT8A 2WGXA 1G9NH 2IEPA 3QA3A 2VN3A 5JNYB 1MHPH 2C3HA 1DVFD 1HAUA 3KPOB 4FQQA 3WE1A 1CFTA 1JWSA 5A6LA 3HRPA 3LIZH 2VYRE 5K1NA 2VR9A 1ACYH 4AGNA 3D09A 4WY7L 1RLBA 3WEXA 2Y7SA 2DQCH 4QTHA 4LCVA 3ZDYB 5F7HA 4P57A 3BZEA 2R0KL 3U7WH 3VYOA 4UU9A 3MOQA 4CJ0A 1F18A 1GOHA 3FF8A 2D2CC 3ESPA 3D0AA 3BRFA 5HDOA 2FD6H 2PWDA 2EUVA 2WWKT 3E80A 2J8OA 2VZVA 4W6XB 4WUUB 1H9VA 3UZEC 1COBA 4D8PB 4EUPA 4ZS6D 3ZDYF 4O2FB 3EJYC 2VIRA 1H3PH 3MV01 3OHXB 4IIQB 4G5ZL 3BT0A 5MI0B 3S36L 2YPLE 5CKAA 3RGVD 4D8PA 2CRMA 1UT9A 1GS7A 3PQYE 4I88A 2FX7L 2AAVA 4M5ZH 4IDJL 4N86A 3S4SB 4PR5B 2WBJC 1I7RB 4R3SB 4U6VL 4FXGA 1AR1B 2X10A 4ZNEA 3MNMA 3MV8D 3O4OB 4LAJH 4R26L 4RFOH 4KROD 5GGVL 3UJTL 4B9JA 2ITEA 4M6AA 4XBMA 5TDNB 1BF5A 3LNDA 2D7OA 4YHYC 3WTWA 5IROA 3SJVE 2CK2A 4U1KB 3WO4B 1YSOA 5LBVA 2R1YA 2NXYC 5EV7A 5IOPA 2BY3A 3MRMA 5ECJE 3SYAA 5E2WH 1SY6H 5F97E 1NEZA 3MLRH 3PXLA 2OMVA 4MDJB 5BV7L 4E0RA 4G2AA 4PRDB 3ZL2A 4OGXH 3BI9X 3CSGA 4KK8C 1J18A 4JFHE 4ZZKA 4K3EL 1MXDA 2DWEB 4ZOBA 2ZOUA 3LS4L 4APXA 1MAKA 1RZ8B 4PJHB 3H3PL 2ZF8A 4Q58C 3VXUD 2XIDA 3BFOA 4QCIA 1RZPA 5CEXB 4W4NA 3WTSA 1JPEA 1LEGB 1KXVC 5DEGB 5INCB 1UCTA 1SQ2N 4HUVB 2ZWYA 2G2RB 5DD5L 3RWJA 1NA8A 1ZXQA 1CLOL 2Y4SA 1T7ZA 2DH3A 1IAMA 1VFAB 2NX5A 4FQPA 4DERA 1B4JL 2YSTA 5I1AB 5EDSA 1C08A 2IDSA 4XMTA 4ONOA 1BYOA 2P5EE 5CZVL 4OT1H 5DMGD 2Y2YA 1TTFA 5G5DB 2NY5L 4IS6A 1OGTA 3QCTH 2GQHA 3QFGA 5F0MB 4WW2A 4XPBL 4S0TD 2OR9L 4JY5L 1TQCC 1BBJA 2CDGA 1L3NA 1MNUH 5LBSH 5J1AB 3UC0H 5KBDA 1JPST 4ODVH 4HS3A 2RCSH 2VLLA 5CBEB 4FNRA 2VAAA 3MTXA 5EZLB 2ADGB 3HKFA 1P4LB 1BBJB 2CDGB 3IMVA 3U4BL 1KGCD 1M1SA 2G4EA 1WFMA 3U9UB 4L3CA 4MHHG 5DYOA 5MHSE 5I71C 3AT9A 2IBBA 4EVNB 1SXSA 4OZGB 1QPKA 2XWCA 2ZICA 5ITBL 3QDME 3VU2A 2HT2D 2XQBH 2B08A 3VD0A 3HNTL 2FCBA 3GLEA 3MV8A 2O5XH 4GEIA 3QIUA 2PUQT 4FQ1H 5D2NA 1VFAA 2QTVA 3CXFA 4X7EC 2EEDA 2WXPA 5EUOF 3FCBA 5I1AA 3ZE1F 5FHAL 1U8PB 3RA7H 4UQBA 2I60H 3EYOA 3FO9B 4MRCA 1GVIA 5D7LE 3BQVA 1SUHA 4B0MM 3IS0X 1EAQA 4G43B 4P9HH 2XG5A 1T5WB 4GG6F 1MRFH 2H6OA 4ZPTB 4OFYD 5EO0B 5SWSD 1G9HA 4PGCA 5GRXG 1M6OB 3LPGA 1A22B 5IROC 3FTUA 1KYFA 2ICEB 5F7LB 5CGYC 1J1XH 1J9CT 2DRUA 1JTTA 4ZUTA 4DP2X 3GK8H 1F97A 3BGMA 4JCLA 3AC0A 3PDGA 1H5BB 3NN8A 5E00B 5JIHA 1NCAL 3CD4A 4DN3L 3M1BA 2BMKB 4P4KC 5IK3B 3VFTA 1ZANL 3P11L 2Q1EA 2EYTB 3MRPB 3MNVA 3V10A 4XNUL 5L2JA 2PPEA 2ZCKH 4WQOA 3BPCA 4UINL 2NCMA 3F7PC 3VA6A 1KEML 2D3VA 4XP4L 2B77A 3O4OC 4Y1TA 2YN5A 3T65B 3B9KA 3NJFA 4X8JA 5FGCE 4ZX4A 1P7QA 2IH8A 6PAZA 1A6ZA 1XH3B 4OV5B 3ZRSA 3F7YA 1T83A 5C09D 1C12B 1WA0X 3MRKA 2BP3A 2B1AL 4HUUB 2A38A 2L7EA 5CXPA 3IVKA 2IADB 4JPVH 1GY1A 3WKML 4Q9QH 3FSVA 1R47A 4ZXBA 5JMOC 4F33B 2KI6A 5AZ2H 1HTYA 1REIA 4JFYB 1KB3A 2EE6A 3WTXA 3DHMA 5JW4R 1FL3B 1IM9B 1WJ3A 1KF9B 1NAKL 2DJUA 2WO4A 4IRJD 4MCMA 3C8HA 4F58L 4HK3N 4Y2DA 4HCFA 3KWXA 3F58L 5C0AA 3MFGB 3CHSA 2O26U 2NY0B 3CVHA 1J9QA 3MCLL 3MV11 1OTTC 1A3RL 1HX0A 5HGBA 4JANA 3EKCA 4QAMB 4K07A 4EQ3A 3GSUA 3SJVD 4K3DL 2Q8BL 1U91B 3UMTA 3VG9C 5BV7H 3HE6D 1WTLA 4Z18A 3MNVB 1ZLVH 1DVYA 5L2JB 1OLZA 4X6CE 4DQOH 1IE4A 4J3UA 1BIIB 1G7MA 1YPZF 4DVRL 2F6AA 5HVHC 2B16A 4OD3H 5TQ0H 1HNGA 4FZ8H 2Q86B 1I1YB 2ED9A 4Q6IC 3VFGH 1U8MA 2QKIB 1KGJA 5KBLA 3R1GH 3L7FA 1M7DA 3STBA 2AF2A 4JFOA 2AS5M 4UT9A 4N24A 5AUMA 4FX5A 3GSRB 5A2FA 2WCSA 1IEAB 2BIIA 1IBHA 3HNVL 3T0EA 4ABUA 3O2WL 2E74C 5TK4A 2W9EL 5LXGH 1UXMA 5GJTL 1T5KA 4FP8H 2CO1A 3IDYB 1XH0A 3I3EA 3KGSA 2CM5A 3FT3B 1LEIA 1Q9LA 5DFVD 3WN5C 4KUCF 3DX3A 3V6ZA 4W4OC 2L8AA 1ZGLP 4PJEE 4F9PA 4JPIA 5JW4N 3CCHB 3QNYA 1BIIA 1WBZA 2EKJA 2VN7A 1ODAA 4JDEB 2F53A 5C0CE 3VFSA 3MRIB 2FX9L 3ILEA 4BQBA 2DQFA 4Y1AE 3GIZL 4PJIF 2V5MA 5DJ0A 5MENB 2YJLA 3FQWA 1I8MA 2VDKB 1NAKH 1JPFA 1DBKL 2XICA 4ZMAT 2WO2B 5GZND 2ZONA 3GXNA 1JD7A 5D5ME 1WUZA 1EJOH 7PAZA 4OGAC 3FQWB 4LL4A 4NN7C 1AI1L 2E9BA 3FQYA 4XO4A 1QLEB 4XAKE 2CPUA 4EZMA 4S2SB 3NZ8A 3HR6A 4PCSA 5IJVB 1QVOA 2WKOF 5BZWA 3P4NA 4AQ8A 4NHCL 1I3UA 5T1KA 3H1ZA 1KPRA 5FGRA 4AKPA 3ZKNC 2EYSA 3GBML 4ZYKB 3C08H 4CC0A 4Q2ZA 4PPTA 3O6FA 1PG7L 2CR0A 3L3IB 2PPFA 4XPGL 4PRHD 4I4WA 1QSED 1TJHL 1NC4B 2YD0A 1U95B 3Q2WA 1INQA 1FRGH 4EN3B 4LRIC 4WI7A 4PV9B 3G5VB 5B4MC 1LO4L 2JXMA 5GRVL 1IM9D 5J12B 1AXSB 4RGNB 3ZMNA 1EHLL 3KPRD 2VDLB 1I9EA 1K72A 1J8HE 1X9UA 2IFFL 4P4KD 3A22A 1KGWA 1MRDH 5ANMB 3SCMC 2WTRA 4FNSA 3ZDYE 4D7BA 4PJBA 3ZYIA 1BW8A 2WTOA 3KYKH 4EDWH 2X09A 1L7IH 1UG9A 4DGVH 1S7QB 3P3RA 4RGMB 1RK1A 3F00A 1H3PL 3A67L 3V4PB 1AZRA 2ICEC 2FLMA 1MWAA 2UX6A 2WZ6A 4MXWL 5J13B 3ZGIA 1FIGH 2E27H 5K9JL 5AVTB 1RZ7L 4M7KH 5D1XC 1FFNA 1XEDA 4FYSA 4U0RC 2FH6A 4JKWA 4KKCC 3BXNB 1UA6H 4Q2ZB 2XZCH 3CX5K 2NQ3A 3LPOA 4F57H 3RVVD 5JW5B 3ATDA 1NCGA 4JNXA 1HOEA 4Y4FC 4ELDA 8FABB 1EGJH 1RVFL 5C0RL 1I9IH 3SZKC 4JQXC 2FK9A 1IBGL 4TLTA 4ZTEA 1UATA 4XXCA 3I02B 1U8JA 4WDIB 1E4JA 1CFQA 2RFXB 3L17A 3PJLA 4LCCB 4Y89A 4X6DE 3T0XA 1O6TA 4H2CA 4W9ZA 1MCWM 2C4FU 1BLNA 1PKQE 4X7SH 3ZL4H 1JNLH 2OR9H 3BUBA 3Q3GA 3ZT6A 3RWIB 1KTBA 1DVQA 4X4YA 4J28A 1EEQA 2CO7B 3CVDA 3L4XA 3P3UA 4K7FB 1YHPA 3MJ9L 1KJ3L 5IBLC 4O9HH 4ZMQA 2FD6L 5MERB 4DJMA 2X7LB 3VXRE 4L0YA 4NQSA 2E9GA 3VFNB 3AREA 4JRXB 2V2TB 4KRMB 4X8XA 2KLRA 3GSXA 2DN7A 1CT8B 3IKCB 3WKQA 4QRFA 1G1CA 2VXVL 1QUNB 1FZJB 5CBAB 4H13C 1QI4A 1D6VL 3JV5A 3QUXC 3V7AG 1VEPA 3QQNA 1NLBL 1CVSC 2B7DT 2DTMH 4P4KA 2R0LL 3M7OA 4GAYB 5D70L 2Y36H 3M8OH 1ET5A 1UB5A 1A9VA 2WLIB 3ARVA 2AABL 3ABMB 5SV3A 4YDZA 2EIMB 2EDOA 3RRQA 1QTPA 3D69B 2X87A 3GMPA 3BDXA 4P9HL 1BX2B 4TM9A 1NWPA 3VFUA 3CMGA 1H8NA 2BOLA 5SX5H 3ROOA 4V2CB 2EVHA 1CDJA 3MV7E 3CK0H 5AAMA 3MVSA 1VAHA 1OPGH 4G3YH 1MCPL 2A0LC 4LRNH 2XA8H 3C75A 3G6DH 1KELH 2XQBL 4NSKA 1J0ZA 3MJ6A 1YQVH 2W07A 4WWNA 2QQQA 4XMUA 3PWNB 5DHMC 4X4ME 3UPCA 4EO5A 2Q3AA 4PWHA 5F96L 1W2KT 5JIQA 4NNPH 4RVBA 1I8LC 2NW3B 3IDIA 3J27A 4A04A 1U33A 3O8XB 1DVFC 5DDHB 4Q8BA 2N0MA 3P9MA 3VXPA 4P5SA 4QRPE 4XRCB 2ZSVA 8PAZA 4J3OC 3IU3B 4Y5VA 4IOIA 4OIFA 4MJ2A 4WUUA 3KNBB 2YGPA 4HUXA 1OAYH 2WN3A 4M43H 5AYUH 4EUPB 4U1IA 5FYKD 4M8QB 4X6FB 2X9XA 3UO1H 4W1TA 2GJRA 3X1BA 4YC2C 4XT1C 4I0PC 3FH7A 1FZKA 4PJBE 2AP2A 1NLDL 1YN6A 1UZ6F 2W0PA 3IMRA 3DYMA 5CEZD 3OAYH 1TJGL 3BKMH 4NQEB 2FBJH 3CNKA 5C0ND 1OZTG 5CCGE 5D4HA 1EZVX 3LHPH 3WMSA 4WTQA 1B0GA 3KLDA 5T3ZH 2PYEA 2IXQA 3G5XB 1SOXA 1W72H 2OI9C 3NEOA 1EX0A 4F7TB 4RISH 5EO9A 3GXFA 1NGQL 3C8DA 1JK9A 4RMVA 4WW1B 3CFDB 5DURB 5FM5O 3QEQD 3L54A 5KS9F 1AD9B 2ICWJ 2YKKA 3FTVA 2DQDH 5IVZA 4F9PC 5HHPA 2D0FA 4JG9A 5ANME 1IQDB 2IANE 1CXEA 3DOSA 3WCYA 2HFTA 5LCVL 4FMVA 5J0BA 4LSQH 4RGMC 2IFFH 4HMEA 5GS1C 4YHKL 3QZBA 4IKNA 3UX9B 2BWQA 1I3RA 4HDIA 2EUWA 1HZKA 2CLRB 2PLTA 2P47B 2XC8A 4GRLD 2VXQL 2BIOA 3LH8A 5I82A 3PY9A 2ZOWA 4O02B 4MXWH 4PJ5A 1NFDE 1F3JB 3DVGA 3C6SB 3L7EA 5DSCB 1L7TL 4YHZL 2BHZA 3O4LE 2AV7B 4MZ3A 1ICTA 3DECA 2G0LA 3TCTA 4FHKA 3TO2A 4OCXL 1NCWH 3GPEA 2OS7A 1IGJA 4G8FB 1SXZA 1TNMA 4DPRA 4PJ9B 5FA4B 3ZMRA 1N59A 5GZNC 4HD9A 4PB9L 4QXUH 4BINA 3B6SB 1MIML 1A14H 1TOXA 3GZOA 3IGFA 3NIFF 2BP0A 2ZKYA 2BRQA 1UXSA 4N90E 5DR5L 5I15L 2FO4B 3AG3B 1FFPB 3ARBA 3SGDI 5F1IA 1RJLA 3POHA 4P2OD 2VXVH 1BF2A 3FT9A 5C6TH 1XHHA 2WYIA 4Z8FL 3QORD 3HZVA 2WN2A 4L8BA 3DMMA 3NIGF 4JDTL 5CGBA 1IFGA 3MRFB 2X53A 3ARTA 3V4UL 1A2YA 1GGUA 4PJ9C 1KTLB 2MNWA 5IV2A 2HJFA 4ZSOB 3STZA 4WTXA 4ETQB 4PRPD 1NMCB 3LSOB 1G0YR 4KDWA 5C0CB 2IMMA 3VD4A 4AE0A 1D5BA 4Z76A 4YSSA 4R5TA 4F27A 2DL2A 3CX5J 3L16A 5T5NF 5JDSB 4WAFA 1D6EA 3ALWA 5F9JA 4C58B 4M5SA 2XZAH 1PYWA 3IDGB 2BX5A 1EO5A 4H1LG 5AZEL 1P1ZA 2WOBA 3L3JB 3NSCA 2ZOTA 1FZMA 3H9ZA 4GKSA 4ODHL 4ZS7H 2Y5QA 4GSDH 5DVLA 3DHPA 3B3IA 5GJSL 1KTRL 4AX3A 3OAYK 3W1ZA 1BWWA 3NCXA 4NPYB 5EU7C 3HZKA 3CSTA 1BHGA 1RK0B 2AEQL 4G43A 3CVHB 4R97C 5DHVB 2XXFA 4LLQB 3PU7A 3STZB 3A67H 5HGBB 1DBJL 3UL4A 4UDTA 4JMXA 3KLAA 3MV9E 4PLKD 3PRZA 2VH5L 4XVJL 1N4XL 4R84A 1V3LA 4YPJA 1GGYA 2C1PA 3ECWA 5F7YC 3G6JE 4NQXA 4OKVB 4D9LL 1ACCA 1WEJH 3NUKA 2LQRA 2YPKB 2QDWA 3EDDA 3O41A 3QZLA 2JKTM 3K3QA 4PP1C 2HP4A 4N9GA 2AANA 3H85A 4U1MB 5IBLD 2IH3B 2NTFA 4HKXA 3PWLA 4XP6L 1NLBH 4KUZL 2VJXA 5TQ2L 1OHQA 3IVKB 3WHE0 3IJEB 1ONQA 4XHJC 4BKSC 2P8PA 4NNXA 4LP4A 2VUYA 4NQDB 1A0QL 5DC4B 4FFZH 1BG9A 4C83B 3L3KB 5E2JA 3CQFA 4GSUA 4MA7H 4EIGB 1A6ZB 1KJ2A 1NPNA 5DZOA 3QUZB 5F88A 5DJ8A 1KC5L 4LLQA 5LB1A 1TTGA 4BH8A 1O75A 2HRPH 1DDHB 2VXTH 3J8F7 1WZLA 3WIFB 1FRGL 3BEVA 2YOCA 1I8KB 2FIKB 4IEFB 1YEKH 2B9AA 4HS6A 1T1YB 1YN7B 2NR6C 3F65A 3N06B 1A7NL 3PHSA 4YHNB 1YYLH 4JZNB 4BIKA 5CZVH 4MJIE 1QKZL 3JQOB 1OWRM 2F7QA 1Q8MA 2CK0H 2WZAA 4TVSa 1HT6A 3CQQA 4QWWC 1KXTB 3GRWA 2SODB 4GXVH 2YK1L 3MLXH 4PJ5E 3FKUS 3AS3A 1WFJA 3BH8B 5BZDB 3SCMA 2ZE0A 5EO1A 1MDTA 3WNOA 2VSKB 2P5EA 1X7QA 2VW4A 3SDDD 4HEME 1M7DB 4AEHH 2R1WB 3DIDA 4NNYA 5FPIA 5AZ2L 5FA3B 3X1FA 3CFBB 4X5XB 2BSSA 3TN0C 2E8YA 4I9WD 1I1YA 1JZ6A 5B39G 3GIZH 1RURH 1RIVL 3IU4L 3OLGA 3N91A 3M1CA 4V1DE 2ROXA 3P1VA 2QGCA 1ORSA 2Z7UA 3WMQA 4XMPH 3K0YA 4NZTH 3MRRA 3FMGH 4KUZH 1G6RL 1OCOB 4D0BA 5HHQA 3MO1B 3VXRB 5ETUB 4Y9BA 1ZA6A 3TT3H 2VAAB 2EEXA 4TUOB 3RG1C 4H1LA 1JZ7A 4YXKH 4Z7WA 4R2GD 1W0YT 3PNWB 3C09B 4L2YA 3NABH 5DJ0B 4JFDA 4A7GF 4PS7A 3ZZ1A 3D87B 1A25A 1U92B 4LPTA 1BAWA 3D30A 1NM4A 5EH1A 4U3CA 1X9LA 2Y1AA 3QDJA 1PU0A 2NY6C 4XCFH 2NXZD 1CGTA 1ZY9A 2WJ5A 3EHBD 3DJZA 2NY1C 2R0ZH 1RUML 1MJUL 1WCBB 4KVPA 4GRWB 4JB9L 4F24A 3LQAH 2DQTH 4HLZH 4L1BA 1OB0A 2WB7A 2XV3A 4NNYB 1JNNH 5MENE 2ZOOA 4R0LB 3RFZC 3GMQB 2EINB 5L2KE 4L5FL 1INDH 5E2UH 5CWSB 1DN2A 4POZD 1P7QB 1VPOL 2XNAB 1OAYL 4BBWA 1DBBH 4H8HA 3QUYB 4AOFA 4PJ9D 4LASL 1FG2B 1HWHB 2CGRL 3GSRA 1UASA 3MUZ1 4PG9B 4X83A 3KPSD 4H0GA 4NHCH 4RAVB 5DRWB 2PF6A 5B1JA 2RQ8A 3P30L 4UB0H 4Z3IA 5LBGA 3TC9A 2XV2A 4RMQA 4KQ3H 1SEQL 4H40A 4ZXBC 3RIFF 5BUGA 4KZEH 2DEXX 1YEEL 4DUXA 2NY1B 4IRJA 1QQDA 1RJZB 3U83A 5AAWA 4MJ5B 1MPAL 4DN4H 4MB5A 4OFQA 5CJ8A 4ADJA 2VL5A 3EDFA 4U6YB 2XFXB 3AMLA 4EN3A 3KM1A 3N2JA 2ADYA 5JYLA 2GCYA 3L3HB 4N0YH 2X44D 4O51A 4XNZC 3ASNB 2OL3H 3ARDA 1KBGL 4E9RA 2EUXA 5DF0A 1F1AA 4RGNE 2CJUH 3ZE0F 3N1FC 2EXSA 1G1YA 1VCBC 1RUKH 4XP6H 4UMSA 2AJXH 2VLRD 2BP5M 2VT0A 4YFLI 3A6BL 2DBJA 4M56A 2WBJA 3N1MC 3VFNA 3TA3A 4H1LH 2V0AA 4F15C 2CNZA 1XL6A 1MHCB 2Q5BA 3BP4B 2Q6WB 4FZ8L 3NZ8B 4ZO9A 1KB9K 4WKXA 5SX5K 5AVQB 3CUPB 2FYVA 1R75A 4FTVA 4LPVA 3W5MA 3OF6A 3PABA 4C4KO 3HS0A 4A38A 4LVNB 4BD4A 4S1SH 3SO5A 4S0HA 3ISYA 4PHXA 1F58L 3LKNA 3TZVB 4I18C 1SYSB 1TDQA 5GGRB 2V3DA 4XXDB 5ITFB 5ISZA 3RURA 1XSOA 3B9KC 5T1DL 4PJAF 1JZ5A 3TX4A 2Q20A 3SBQA 1MLBB 2DD8H 1Q9OA 5DFWH 2MTPA 2F1AA 1JDDA 3FAXA 2JMRA 2H2PD 4K94H 4UTBA 3TNMA 3UBXI 1SMOA 4DVBA 3P0YH 1HKLH 1CIUA 1IAKB 4X9BA 4XNYL 4H88L 4AKQA 5C7XH 1MIEL 1ZSDA 3DVNA 3S37H 3HBGA 3CLEH 1X4YA 2XWJB 3S36H 2XKNA 3MRNB 5I76B 3MAWA 4FQJH 2CG9X 2ZOKA 3L9RB 2VISB 4XOBA 4OAWB 4N2GA 5KYNA 2X4RA 2A4CA 3O6KH 4JZJB 2WLMA 4NO2B 3KJ6L 1S7VB 3JSSA 3MRCB 4N5UA 4WHTA 5EOTA 2LLGA 2BDNH 2VDLH 5AEAA 2JB6A 5FYJD 1T0PB 4PYHA 1UM4L 5T3ZE 4J3OD 1FCGA 5GRJL 3JUYA 3KWUA 3H42H 5C0EB 2E0PA 5EFIB 3I9GL 5I18L 2V2TA 3JV6B 3KJ4C 1OP4A 1FAIL 4Z7VF 5D55A 1PAMA 4B7IA 5C0BA 4FD0A 4YSDA 4AVJA 1H3TA 3RL1B 2BP8A 3UZQA 3PPEA 4B50A 1ZK9A 5FDWB 3SKJH 3O11A 4Z8FH 4G80A 3ERXA 3AWFA 2F9BT 2WXGA 5CD3A 5B3NA 2A74C 2EDJA 4JFEB 3KHOA 3LS4H 4KTDH 5DD6B 1HH9B 1UM6L 5DD1H 4PV1C 2H32H 3QQDB 4JKKA 5D5MB 3IJ7A 4H44C 4X80L 2O72A 4A66A 4JFFA 1HESA 1UACH 4N0CD 1K4DB 1U36A 2X4QB 3FUFA 1KCLA 2HT2C 3V4VA 3NFSL 2AJ3A 4JPQA 3N1PC 1U8NB 3J2PA 4XGZA 3WHXB 4YFDB 2Y24A 3EYUH 1OTUC 4ONFH 2I07B 5C8JA 1AXIB 4L5FE 1HVXA 2HB0A 3QNXB 4WJ5B 3ULUC 1MCRA 5A16B 1MHHB 1J88A 2A73B 3WXVL 4J2XA 2NW3A 2VERA 2G9HB 5MEND 1OD9A 1CI3M 1D7FA 2VLRB 4XNDA 1OOWA 4XBGA 3FU5A 2WXIA 2G3MA 3FXIC 2EDQA 1WAAE 4JX0A 3WS3A 4JUTA 4CDGC 1KNOA 3H9HA 3MROB 3MYZA 2O93L 1THCA 4KQ4H 3NQIA 2Y3AA 3QEGH 3BP7B 3F7QA 4LP5A 1HI6B 1HWGB 7FABH 4TS6A 1NANI 4R26H 3OB8A 3U82B 4IU2A 1V3KA 2XYBA 3BESR 3JV0A 4LEXL 3RL1A 4ZFGL 3DXAE 5DS8A 4AYFB 5GISL 2P8MA 2V7HB 3PQYD 5FO9B 2Z3FA 2HX9A 4U1LA 3FQTA 2FWUA 1BFOB 1S2EA 2BZDA 3FTGB 4U3HA 4BGLA 1IBGH 1CDGA 3GMPB 5I1CH 2NY5H 4WTZA 4EQ2A 3JVFC 3UYPB 2F54E 4U3SB 4XNXH 4LLYB 5EIVA 1WLHA 1JHKH 3H9SB 3SKNA 4QTFA 3O2DH 5BOJA 4PJCA 1XF3B 3ZKQD 1AQDA 3FQ4A 2ZOKB 4RMUA 3U2IA 5IMOA 4H8VA 4TVPD 3SDXE 4MNQA 3E6HA 4QI3A 1F6AB 3MU3A 3NK3A 1J1OH 4P2RB 3U0WH 5T1MA 2XPGB 1QLFB 4DESA 1SF3A 3KDMA 5I75B 1MHHA 3CQPA 1SVZA 3MBED 5D71H 2ZUYA 3REWB 1OM9A 3LN9A 4MCYB 2O5ZL 3ULSA 3FO2A 2IPTH 3KYOB 1FV1A 4WK2B 3QULA 4E41A 2WUCH 2MOGA 1ZVNA 2PYEE 2X89D 2VN6A 1OALA 1OP3H 5SX4H 5EEXA 4PBDA 2XBZA 3VQMA 5IW3A 3IDIB 3BDBA 2FR4B 2IDUA 4GUOA 4FZEH 3ZDZF 1E7VA 3UAJC 4JFVA 3WN5B 1PS3A 4CMMA 2VR8A 4WNSA 2UZYB 1CLZH 5EU6A 4JFEA 4P99A 1R17A 1AC0A 3Q3GB 4LZKA 3QRLA 5TF1L 2Z7WA 2VJ0A 4M7ZC 3B2XA 2GAZA 3CN1A 4P9ML 5DMIH 3SBPA 5J11B 4KAQL 5IFJA 3WFBL 3WLWD 1TQVA 4FJYA 1WWAX 4OCRH 2YBRA 3U9PL 5EF1A 3RWEB 4FL4C 4M03A 3TBTA 4O02A 4J3XA 1VFBA 3KYOA 4HG4K 1IZJA 2FX7H 4PJ5B 4DGIH 3O45A 3GIVA 1OQOA 3MRJB 4H25B 4QAWA 1R5IA 4OF3A 2IF7A 5TGBA 5IB4B 5KYYA 1UEMA 3EF4A 3PQYB 3UFIA 5FYLL 2VZUA 3QSKB 2WBWB 4KKBC 1ADQH 3DHJA 4OJFL 2KMWA 5FKAA 4PJAE 3KEHA 4RRPM 5CN1A 4FZEL 1FFNB 2FO8A 3QCUH 5C70A 5DMJB 3AU1B 2X0VA 5HHNB 3LEYL 4MTMA 4C56E 2FECI 1YQVL 4M4RA 4U7SA 2E3VA 2MNJB 4HK0B 4J5VA 4DCQB 3KPSE 5HPMB 1HXYA 1YDPA 2KZ1B 1EERB 3DUHA 4Z7OE 1JS4A 1FORL 3QZWA 4PIBA 1T0MB 5CZRA 5CEYB 4U1NB 3R7QA 3FQTB 4E41B 3JTTB 3UTSE 4OF6A 3OXSB 1SEBB 1SM3L 2N7AA 5J6GA 4ICXA 3D85A 3T4AB 5FYLD 3PL6C 5HD8C 3AG1B 4FQLH 2IPUK 2KC0A 1BYPA 3LYRA 1K5WA 4R7NB 1EO8H 4PMFA 1GGBH 5EBMB 4E9XA 1MCIA 4FQXB 3KJ4B 4HIJB 3B9AA 1FZKB 2ZCKL 4C83A 4OB5H 1MW1A 3MGOB 1QSEA 5FCUH 2NNFA 5EDXA 3BKYL 2V5TA 1KENH 2NMSA 2NY7H 1G9EA 3MJ8B 3KL5A 1TZGH 4ZI8A 4ABQA 1N6QH 4YEFA 5B22A 3GQFA 3QIWB 4XP9L 5ID1A 2V8LA 1T1WA 2KLSA 3K4AA 4AENB 4JQIA 1W0WA 4WWKB 1DVSA 1FG9C 2D9QB 1RUQH 1FNGA 1NEUA 1VEMA 4KI5C 1IKOP 3B5TA 1X44A 3AM8A 2B0SL 2HAZA 3EG9B 4WI2A 3F12B 2BLFA 1T22A 1IC7L 2XVGA 2AEPH 1LYQA 1KIUA 1OCCB 1WFOA 3T1FB 3WJLC 5DHVA 2VDLL 2JI1A 1JNHB 3FOLB 5JHBA 1OTSC 4OSUH 4FQ1L 3ZZLA 3MMEA 4UBDD 4P05A 4WKZB 1JOIA 1A3RH 4JCMA 3MV7D 4NP9A 4P59L 3QH3B 1OP3K 3J07A 3BO8A 4S1SL 5ITBH 4YE4L 5J7CC 4MJIA 3TEXA 4K3DH 4CGUB 4S10A 5E99L 3D5OF 2WINA 2OJZL 3ETSA 4ORGB 4WEBL 5E8EA 1U2CA 5KVDH 2EDWA 1C16A 4M9OA 2BOCB 1LMIA 3A0OA 2CBPA 1EWHA 4HKZB 3SDCC 5LAXA 2J6EL 4UQ3A 4BZ1A 4OIIH 5MEQB 3OWRA 4MKTA 3FB8B 4HJJL 1IM3B 1CF1A 3T2OA 5CJOH 5I19H 1T5WA 1WBYA 4HALA 4CVXA 2WLLB 1WPCA 5HHMD 3F7KA 4PH8A 1T03H 4G59C 1A7OL 3I2CH 3N6YA 5L0QC 5A40E 4XPFL 5AVYB 4K9EL 3V0HA 4E9SA 5DK2B 4LPYA 1LO4H 3QS3A 4XNZB 4UTAA 3CFUA 3LIUA 3NGBB 4PJ7A 5A1AA 3NCFB 2YXFA 4OZIE 3NDZE 5GRZA 3U4KA 3V0VA 2FL5A 1UZ8A 1Q1PA 5IOPB 3ARED 5DYOB 3B7UX 1E5AA 5E4EC 3PHOA 1U4FA 1AACA 1AGEB 3GS7A 1Q9KA 2APFA 2ZXAA 4M6OL 3O4LB 3QH3A 2NY3B 2AV1A 3NEEA 3TT3L 4JAMA 3H3BC 1KGYE 4IIQC 1PIFA 2BRRH 3NSJA 1P4LA 3HVNA 1MIEH 5FA4A 4ZFOB 2XZZA 3O3AB 43CAB 1T6BX 1NPJA 4WU7A 3S34H 3SDXF 3B5GA 4ZAKD 1K8IB 5EOQL 4G7YL 4KO9A 4XNAA 3N42B 3S4SA 3FUJA 1AIFB 3MV9D 4UQ9A 1RURL 2ZUWA 3E2HC 3NRQA 5FYJU 4XX1G 4RBPH 5I74B 3HN3A 1YMMA 1WA2X 4J8QA 1BJ1H 2E7LA 3WY4A 1NCBH 2R23A 4PJ7B 4DKDC 1OGTB 3HS0C 1CLZL 3KPPA 2VMEA 1MXGA 3FCSA 2N59A 1KZYA 4PCKA 1QR1B 3PJSA 1YEHL 2EIKB 4FG2A 1U8IA 4JR9H 3KLQA 3TGXA 1FO0A 3ILDA 3TVMA 3FZUD 1DVFB 5EMYA 3RFZA 1DN0B 3NABL 1FVEB 3QUZD 3L3HA 1O6SA 4XMLH 3SD2A 4JFXB 2EXWD 3MRPA 4YDLC 3KWTA 4X6DF 4FQCH 5IREA 4YZFF 2EUZA 3AG2B 3GS4A 5GZOC 3UXFA 3ZHLA 3RVWD 2VE6A 3BSZA 1ZIAA 2F68X 4G1MA 3CFEB 2IGFH 4BCXA 4J6RH 3M1BB 4K55A 2FX9H 2O6PA 2OSLB 2P1YA 2IDFA 5T1DH 1Q9WB 1XGUB 1I7ZA 2AK4E 2HT3C 2H2PC 2JJSC 4LEBA 2BSRB 2J56A 2E6JA 4HQQL 2VE6B 5FUCE 5LWYH 4GG6B 3H42L 4BZ2A 1ND0B 3PAUA 4G1MB 3P4MB 4P46C 3WEMA 4P4RB 3BEVB 1JTPA 2PR4H 2E8ZA 1HHJB 4TQHA 4QJ3B 5FUZH 4ZW5A 3UROR 2CO4A 4HIXL 2EDKA 1S7RA 4PFEA 5DJCB 1DVFA 3ZQXA 2B2XH 4WVRA 4AL8H 3OKYA 3AB0B 4M5TA 5L2KA 1FNFA 3RX9A 2MIZA 5DZ9A 5D96C 2RR3A 4PY8I 3OKKA 1ILSA 4YDVA 2D31A 1ET8A 4CVZA 3A6BH 2P42B 5KVEH 3Q5OA 2Q7NA 4KROB 4FQCL 4JFYA 4YGAB 5IBUG 2NSXA 3X1EA 1O9WA 4OLUL 3DV6B 2GFBA 4OTXL 4KJYB 3SPIA 4RNRA 5F9WC 3DVFA 1TEFA 2HN7B 3F04A 4YZFE 3CXHK 1QATA 3FOMA 1PFCA 3NPSC 2OM5A 1BVNT 5AKSA 3WAKA 4CMHC 4Q9BA 4CU7A 3HVDA 2KDGA 2B5IB 3N9GH 5E7FA 4ZFOA 4X0KB 5K9OB 3O3AA 1F11B 2MEJB 3TEWA 2KQNA 2D7MA 4LLAA 5DA0B 1AO7E 3QUKA 4MLIA 4TULL 4W70A 1CQYA 4NQCA 1IJ9A 2PPDA 2E7MA 1QTSA 2ADFL 3BMVA 3QNZB 3VYPA 3KPTA 4DGYL 1QRND 3VFWA 2VLJA 3BWSA 2WLHA 4IS6B 2WQSA 2Y3NA 4FXKB 4GS7C 4PP1D 5KVFE 4EIUA 1G0DA 1EDHA 3NIGE 2H3NB 3L3OC 4WWOA 3HNVH 5HHOA 3CSPA 1P7KA 1GZHC 3WV0A 1T7WA 4HT1L 1JN6A 1IAIH 4A1RA 1YNKH 3LRHA 5CCKL 4L8DA 3RU8H 4HIIA 1C7SA 3JXAA 2NXYB 3JVGC 5JHLL 3GTVA 1QEWB 3LPPA 4ZUUB 2DMHA 1TVHA 4U6HB 5ICYB 3AXHA 5IVXF 2ARJA 4U6YA 1A1OA 3DVNB 1Q72H 4WENB 1DO6A 4HJUA 4KJPC 2J20A 3ULVC 3RNKB 1S9XB 4GSQA 4QRRA 1UWGL 2GSIA 5C0BE 3QDAA 2OMYB 4R96A 5I1EH 3QUGA 1LDSA 4MB3A 2C9RA 3TJPA 4Q74A 5JIKA 1L9SA 3HG1B 4PJXB 1HS6A 4UM8B 4ZUVB 4PRAB 4EXKA 2HLAB 4NQCB 4V1DB 4OI8A 4LGPB 2EE2A 1NZRA 3WS3B 4BH8B 1SJXA 35C8H 3E2HB 4UOQA 4G82A 3EFOA 1EEZB 1I3VA 1R5VB 3IJ8A 3V5DB 3D4CA 4U6XA 1WBXA 3MCKB 3B1UA 1ZHBB 3FO0L 3LRMA 3OJMB 5E4OA 2DQHH 2D7TL 3IETB 3R7RA 2OR7A 1OARL 4AV0A 3W9DB 5I0ZA 2IC2A 2PYFB 1UKSA 4OUUA 2WWOA 4IRJC 2NCEA 2QVMA 4QJ4B 4RSVA 4L3AA 5F3BB 2GFBB 4C4UA 1JF1B 5CSBA 2DLTA 1HN1A 1F6LL 2WO3B 2F08A 3QR1A 5C92A 4PG2C 2QQLL 2VDMB 3GSWB 3W9DA 2VSMB 1DQQB 4FNQA 1AFVL 4WW2F 1K4DA 3UPRB 2Y06L 1A7OH 1EFQA 3I2CL 1TO4A 2NY2B 3CZGA 1ZEAL 4KI1A 5HGGS 3FRPB 4U0QB 2FT7A 4G8GA 4JQIH 1K2DB 2E86A 4N8VA 5IMOB 1AVAA 1FNLA 4Z5RA 2ZPKL 5H35A 2CIIA 4J1UA 1JPFB 3QJZA 3UBHA 4YHIA 4V1DA 1EIBA 3X1GA 3KPMA 3DBXA 5IHZB 2BFGA 1KBKA 3HG2A 2MCAA 2Y36L 2A9ML 4P2QE 4WEMB 4RMBA 5K1VA 4YXHH 4W6YB 4FLHA 2I9TA 3HE7A 5FUZL 2KKQA 1J10A 2FJGA 2R69H 1CI5A 3FTXA 3BKCH 3MRLA 3OF6D 4Y1AB 3A4FA 3BLPX 2OMBA 4EN2A 4I77L 5BRZA 2JSFA 3MLYH 2ZUUA 1GJWA 1QYGL 4OV6F 4Y1AD 3TBBA 1KB5B 3X12B 4TV3A 5H94B 4DO5A 3J7HA 1FIEA 3IXTB 5AOJA 4LSQL 5ESQB 4GH7B 1DQQA 2IBZX 2HVJB 1S5HA 4OLUH 2C7FA 1ZLSL 1WCQA 1TQWA 4G5AA 4GG8B 1XBRA 4JZOB 2QBWA 2CO3A 4JFHD 1EAOA 1P84K 5EOCL 4AJ0A 3UAFA 1M7IB 3FN9A 1SN5A 4P2CG 3VXOB 2X4QA 2XZQH 4BRVA 3VGFA 3FW6A 5FECB 3GHBL 2AGJL 3BD4A 4AL8L 1E4WH 3H6JA 4XCCH 32C2B 1RJCA 4Z7IA 2PMZA 4U1HB 2TSBA 5KSVA 1KXQE 2JKXA 2P5WA 1N10A 1F4WH 1S9WA 3K7UA 3PWNA 4I0PD 2ZUXA 5IEHA 3NZUA 4I2XA 5GS0C 4BFRA 1XEUA 2WTPA 3F6LA 1A4KA 3EOAA 1K8DB 4LVHB 1XCXA 1UQSB 5I1HL 2EADA 3UACA 4YHYB 1QI3A 1IBZA 1L0PA 4PJHF 3AM8C 5AOIA 3S0PA 4X5PA 4AEEA 1E9QA 1UWEL 3RAJH 4M43L 2XIBA 2DQEH 1YY8B 2BCKA 2YD2A 3DI2B 3D69A 5C1MB 5H4YA 2X2HA 1N19A 4H8PA 1LO0H 4JHWL 1JPGA 1NGQH 1RL1A 2LTQB 4XXWA 5EZJA 4ZDHA 1FLRH 4LOEA 4M7LH 3NJXA 4APQB 2IAMB 4P5KA 1YRKA 4OLWH 3LKSB 4OZIB 2Z8RA 1IGYB 4U3SA 2X9ZA 2DWXA 1JGDA 2NNRA 4FERA 1MWAB 2WXLA 4U3XA 4QXTB 4QHKJ 4D3CL 1IBDA 3ARBC 4AGOA 3EGSB 5C09E 4YDKH 5BJTA 3VXSB 3QDGE 1CVRA 1JK9B 4WW1A 5EORL 4LRNL 2C9PA 4YHKH 4KK8D 1OAUL 1P7BA 3C9NB 5KVDE 2VR5A 4RZCA 2EEFA 3KS0H 5DHYA 1AANA 1M7UA 5LCVH 1YDPB 4IHOB 1T4KA 1ECZA 3NJKA 4X6DB 1E0OB 2XWEA 1RIUH 1QKZH 3LKNB 3TZVA 2CA3A 3GXPA 2OA9A 3TNNB 2ZG2A 1YPZA 2IAMA 3FBQA 4W68A 3VGAC 2X4NA 3TIEA 1F5WA 3ZQ9A 4JHVA 2EDMA 1MFBH 2XV0A 1WT5A 1JGEA 3II1A 3WIAA 4BUGA 4JO4H 4ZFFA 4R7LA 3D25B 4S1DC 1PZDA 2YPVL 1FO0L 2IGLA 3PAYA 3KPSA 2R7EB 2DWYA 1RZIB 1RPKA 1KN4L 5FYKH 4L9DA 2D73A 1X4XA 3BQUC 3QAZB 4G8AC 4IOIB 2BCMA 3LZRA 4E9LA 1JHLH 3D3VA 3N40P 2APBA 5KVGE 2MCPL 2P80A 4HBQA 4Y4KC 1OTUD 3T8XA 4WRLA 5AD0B 3FUKA 4Z3FA 2OK0H 4QHLB 3BIBX 3VXRD 2OQJA 5C0CD 5JOEA 4J39A 4X4XA 2IAND 3SY0A 1RQ5A 4MNQD 4N22A 5HGDA 2YQ2A 1OTSD 1FN4A 1FYTA 2J73A 2OTWA 3GZQA 3O2DL 3QDMD 5HYIA 3TNNA 3PWUA 1NCCH 4JO3L 3W37A 3I3BA 5DHYB 1HWWA 4K7PX 4YSEA 3MKKA 3R06B 3QG6B 4CADA 5T3XE 3OB0H 3KVQA 4HU8A 1QSZA 3BPOB 3HUJE 1P2CB 2CMRL 1CTNA 3O8XD 4N8CH 1QA9A 2M1KA 3UDWC 2O5ZH 3Q1EA 5C0GA 1T89A 2Z4QA 4FYRA 2ZXEB 3OMAB 25C8L 4PWJA 4QRQA 2CHNA 5JZ7C 3WENA 3HZ3A 4RBPK 4X6CF 2NW2A 5JUEH 1XWVA 4POUB 1KWGA 4JVPA 2JK5B 5ENWA 1P1VA 2YGOA 2F19L 4LK4A 3W39B 1DEDA 1D5IH 3GHEH 2H7WA 2ZJSL 4ODHH 4P5KB 3S97C 1KLUB 2P7TB 4GBXC 3RI5K 5ID0A 4XBEL 5KBPA 1CR9H 1N0XL 3MX0B 1YUHA 4KQ0A 6PCYA 4P9MH 3LN5A 2H47C 4FN0A 1NMAL 3OC5A 3KR3H 4HPOL 3FHAA 3BH4A 5FUOL 2R29L 2BIMA 4JRFA 1QSFA 2WINB 3T0DA 1ZGLM 1BXAA 1MWOA 3IWVA 4HCRA 1MUJA 2XPZA 4MBOA 1Z5LA 2QTEA 3B9KD 5EIQA 2PYEB 3G5XA 1JMXA 1FSKB 4YXLH 4A63A 4MZRA 3S7GA 2HTKD 5I8EB 1F02I 4GB9A 2WBXA 2ZSWA 3QEUA 5EG6C 5KVMC 3S35L 5I73B 2H5UA 3MN8A 4WHYG 5E5MB 3IKKA 1CGVA 1YEFL 5C9KA 1Z5HA 1JPTL 5IF0A 4LDCA 1E28A 1A3LH 3P2BA 5D6CB 1CDBA 3X14A 3MOBL 1RV6X 3GI8L 2B39A 1B2YA 1OZUA 4LCCA 4M8QA 4PS4L 4X6FA 3WGVB 4CMMB 3QIWD 4XTRD 2GTZA 5IWLA 4YHPB 2CIKA 3K6SB 4NIYE 4YC2B 1FH5L 5DURD 1H8SA 3P02A 5CD5C 5IGXH 1E2VA 1M4KA 4ILDA 1X6NA 3N43B 4NQTA 4XZUB 1C08B 3GGWB 5GS2D 1XXFC 3WYRA 5FFGA 3FQNA 2AJVL 1VKXB 2UZXA 4PS3A 1JXGA 4CSSA 2WXOA 5J1SC 2A83B 3CBJB 4DGUA 4NAJA 4P5MB 1BAFH 3IGLA 4UQCA 4F2MB 3RIAK 4P2RA 3DX8B 3MGOA 1D5IL 3WFDL 4JM2F 3O6LH 5D4JA 5KOVC 3AW5A 3VXNB 3S88H 1HEZB 3UAJD 1IT9L 4IKJA 4WWPA 5F0LB 2ZF9A 5DD0H 4ZUTB 2OMNA 4DT2A 1JAEA 3GMOA 3N0PB 1E4WL 15C8L 3QZWB 4JZNA 4XCCL 5B1KA 1H5BA 3NN8B 3VG9B 5CN3A 3ES6A 1Z66A 1BZ8A 2WYHA 3Q8AA 4KH9A 5JPNA 4UT6A 3T77B 3LS5L 4FHBD 1ZE3C 2DLFL 4AIEA 1T89C 4M7LL 43C9B 1RUQL 1MHEB 2NQCA 5A3ID 3GBMH 2CA4A 1OAQH 2MSPA 2UXFA 2YEZB 1VRSA 3NT0A 4N1HB 5FWQA 5L8LB 2C7UB 3TH2T 2MJWA 5AOKA 1DN0A 2R69L 3EGXA 5IV2B 2H4EA 2X4OA 2A9NL 4G9FA 3EOTH 3WJJA 5D71L 3SDAC 1LD9A 2VLMD 1KTLA 3L6FA 4GXFA 2F53D 1YNLL 3MREB 3CHXA 2L04A 1BQRA 1N0LB 1U8CA 2DIEA 4LPXA 3MRGA 2AERT 1CDUA 2Z1KA 4KK6C 1ZHNA 2YAEA 2Z8SA 2PR4L 4NI3A 2X4UA 3P4LA 1VFOA 4QRSB 3SGEH 3TJEH 1MFCH 1XSKA 3PCYA 1G43A 3FNKA 3M45A 3NSYA 1PG7H 4MMZA 5CGTA 4I9XA 3CHRA 5F0JB 3MODL 1MCSA 3RGVA 3SBWC 5CBEA 2JTDA 4OCNC 3AUWB 2V7NB 1F4AA 1TENA 4NP4L 4PJEA 2NY4B 3B3BA 4N68A 5E1HB 3BMWA 3E3QE 5PCYA 4FFVC 2R27A 3FOMB 4MNGA 3QIBD 5GHWH 1N9PA 3ARUA 5IQ7L 4L0ZA 1RULL 3JTTA 2EO7A 2IV9A 2NTSP 1MI5E 3IDGA 3QFDA 5LHDA 4BGDA 2W60A 1QFHA 3P30H 4UB0L 1X5IA 3U1SL 1I9IL 1UEYA 1Y0LA 1T7XA 3O3EB 4W9EC 4GP5B 1A66A 5CSGA 4XX5A 3X3FL 4OD3L 3BUDA 3N0AA 1E4KC 2OTUB 3OGCB 5HJ3A 5C0IB 4G9DA 3BH8A 4CSZA 1R0AH 1QWNA 3KGRA 4LFHG 4OM0H 2PETA 3DO3A 4LSTH 1KV3A 3LH2L 1BZEA 5DJAA 2E9WA 1PDKA 2JELH 4LARL 4KZEL 4U0RB 4G9DB 3P4OA 3IDUA 3EH1A 2CO6B 3QARA 3HS8A 3IDNB 5HI3C 2W0LA 4ZMVA 1LP9F 3IFLL 2YA0A 1DSFH 2VRAA 2JVUA 1U6AH 1XGRA 2YAPA 4MJJA 2F1BA 4IU3B 2WJ7A 3W0WD 5FK9B 3G6JF 3CN0A 4ODTH 1AZCA 3UTTD 1DBAL 4G42A 2PCXA 2AK1L 2PO6C 5DJ8B 4Z5RB 3G08B 2P9RA 2HG0A 1VSCA 3SDAA 4LHUA 1SFHA 4LAQH 1FH5H 4BFIA 4R0LA 1LWHA 3QHZH 2VLKB 3RNQB 2QMKA 2R0ZL 1JP5A 3HMXL 1RZFL 4KVCL 3KXFB 4PJDB 5EIIA 1WGVA 4QT5A 2WP3O 4KK6D 2EYSB 4M7ZB 2D4DA 4ODSH 2Z92A 4YBLB 5FGBA 4Y2NA 3SJVB 2VLKA 4PBXA 1LP9E 2WLYA 1Z3GH 2CRZA 4MNGE 5L4JA 4B9PA 1T1ZB 1DVTA 1EHNA 5F0PB 3K6DA 3LKPB 3B4NA 2H6PA 2XFGB 3QXVA 3CFCH 3MI6A 2LABA 4HC1L 4PTUA 4UDTB 4WHDA 5DJCA 1Q0YL 3B2PA 4GQQA 2OSYA 3QS2A 3BZ4B 3CPLA 2UX7A 4LSDA 3PFQA 4U1GB 4X7TB 3GSVB 4RAHA 2AZAA 4G1EA 2X4TB 3EZJB 3GF8A 3HI5L 2EDDA 2DWEA 2Z64C 5CEZE 5KS9B 2JELL 3FN0H 3SDCD 3BWUC 4GBXA 4MCZB 1JXDA 1JFQH 2X2UA 4FFTA 2A6JB 3EDJA 5GGVY 3VI4A 3IMTA 1TQSA 3P9LB 3WNNA 1FWXA 1XF1A 4QRAA 2QV2A 4YDJB 3IJ9A 3WUWA 3CFKA 4A2HA 1VADB 3MJGX 5FA3A 5DLML 2Q8AL 5D1XE 1BD2A 2W1NA 5IM7B 1A8ZA 4PCTA 2VISA 5C86A 2K9UA 1A1MA 25C8H 5JTWA 1WO2A 1X5ZA 3R18A 4X6BB 5CWSA 1G7IA 1VERA 1IRAY 1SXCA 3HBZA 2XNAA 1DYZA 4MCNA 1OANA 2Z91B 3NCYS 3OG6B 4I4WB 1EEUA 3VWJD 5BV7B 4XC1H 1YZZA 3H9YA 5SWZB 3ZHDA 3VXQB 4YGVA 5F21B 2JQMA 4MD4B 3N1GC 1DQVA 1RZFH 4KVCH 3RBSA 3N44B 1NUGA 3GSOA 3K2UL 5J8OA 1ZPLA 5I8KH 2AMGA 1U92A 3MC0A 3ZE0B 4BWUA 2VERN 2YUVA 3Q13A 5EZLA 2ZD0A 3VFPA 1Z9MA 4F3FB 5K9OA 3BUIA 1U2YA 4MD5B 3H55A 5DD0L 1E4XH 5JA8B 4LKCA 4NQVB 2OMTB 5I1JL 5DHXB 4GKNB 2D8KA 1IGTA 4X42A 3U7AA 3MJ7A 4AMXA 4UQEA 3ZHKA 3L5WA 1FHNA 5FF6B 5CJ5A 2XBTA 5K9QG 4MS6A 1QWHA 3LTVA 3MLTA 4JRYA 2NY1D 5HDBE 1GSKA 5DQJB 1K6QH 2ATPA 1MFVA 4MD4A 1KFGA 1M7IA 4FNPA 5GGTH 3ZDXE 4ZS6C 5I1EL 4HJ1A 4L8SC 3RILA 3VYNA 3LKQB 2XIIA 5F2FA 2CLZA 2ATKB 2Z91A 2EH8L 1HILA 1XGYH 4JKMA 3PV6A 3CDGB 5E8PA 3ZHNA 3VQ2C 3WIHL 4X6EB 5IB2B 3EJCA 4BZ1L 1L7TH 2WXQA 2AXHA 3L5HA 3SY6A 3H54A 5K59F 1QEWA 4ZUUA 1KCUL 1AQMA 3MNWB 5DYFA 3S96B 1IQWL 1AGBB 3QFJA 4EOWL 4YEEA 5D1QE 2OCCB 4KTEH 5IQ9B 3U7WL 2OP4H 1ZSDB 2EYTA 4F92B 3DV4A 2R69A 4KH2A 2LLNA 2Q86A 1NIDA 3SGJA 1WC7B 3LNFA 2A6JA 1E6JL 2H9GB 1LDPL 5DR5H 3QCVH 1G9MC 1X5GA 2EDNA 3UTTE 4K23H 1B6UA 5DQDL 1YC8A 5AOMA 1FFOA 4RMWA 4PREA 1MFAL 2GBAA 4FGMA 4NZUH 1U93A 4YHIB 4NQCE 1NBYA 2XN9B 4L2LA 5HVWA 3ENEA 1K2DA 3LKSA 2APVA 3GUTA 5E51A 1H8OA 4LLWA 2E9IA 4HXAH 5GSRB 5CUSH 1XMEB 3EO9H 2G9HA 4LHUG 2B4CH 2APWA 3ZRCC 4BQ9A 1OK8A 2YEQA 2WUCL 2ZCHH 1E8ZA 3UTSD 3RKDC 4C47A 5F9AC 1GYVA 3VD3A 4OCSL 2MOVA 2YHGA 2YMXH 2ZCLL 2Y2TA 2MKWA 3VXSE 1UWXH 2QVIA 5MP6L 3BW9B 3X3FH 5CJQL 3QDHA 4FOMA 1GHFL 1XGQA 3CHOA 3UYOD 4Z3HA 4IMLA 1BMWA 4Z7WB 3D12B 2VKXA 4K94C 5H37H 5AZUA 3OAZK 1RUAH 1WFIA 4JFDB 2MOQA 1UXWA 4HBCH 4UMGA 1DLHA 1DE4A 4HX1B 4UAOC 4ZAKC 2GJJA 3VXUE 4ZX5A 3X17A 2CGYA 3WS6A 3BD3A 2AJVH 2UZPA 3VSQA 4LLWB 1FO0H 1SXAA 2EYRA 2A9AA 3FU7B 3EBAA 2KBGA 3SDDB 1BD2E 3QJXA 5KEZA 4TNWF 1A6VH 1JNJA 4R7VA 2AVFA 1QFPA 4MMXC 3QEQE 1DBJH 2FGZA 3K8KA 1UJTA 3AREC 3AWGA 4FQHB 4QD2E 2ZAIA 3LRSB 1QSEE 3V4VL 5FHBH 1RZQA 1S8DB 3KPRA 3PXJA 1QABA 5C71A 2VABB 4W93A 2IDQA 1Q9LB 5TF1H 1XB8A 4GAGL 2WIIA 4ODUB 4ZS7L 4CUCA 1KCWA 1DLFL 2WVTA 3WFCH 5ESVA 3FFCE 2I85A 1B4LA 2VW7A 5DZLA 2UUDH 3TP4A 1SM3H 4JE4B 3UPAA 4M93B 4GAYA 2VDKL 4KROC 2AW2A 3RWGA 3F5WB 3ZTDC 5EEUA 3ZBMA 1W72L 3L3IA 4XCYA 3NSXA 2A9NH 1JPGB 4NQCD 4XH2B 1M42A 1MWAH 2G3XA 4XMLL 4CL7A 2G5BA 5E2VH 3VCLA 2YFOA 5DJ2B 4Y16A 2J1WA 2WY3B 3T2NH 4IBSA 1CK0H 2YEVB 4HFWA 4PHZA 2NDFA 2JIXA 2DWTA 1OE3A 2Z1PA 2AEIT 3C60A 4XPHL 2AEPL 1QHQA 1E9OA 3V0JA 3RP1A 1JV2A 1JCVA 2VWEC 3ULUH 3QVAA 4DW2H 4GSXA 5BRQA 4I0CC 1N59B 1YQ2A 2QADD 4I2XB 1H15A 4JUSA 1EGJA 1XR9A 1KNOB 3H9HB 5CO1A 3UTSA 1OK0A 1T0OA 4XAWL 4MQSB 2XACC 3M6DA 4DH2A 5MEPA 3I6LD 4QHLA 4LLMB 1QBML 1M1XA 2XTJE 4X4XB 2OBGA 5I8EA 1GW6A 4NAQA 4FA6A 3T71A 2CD0A 1M71A 1TU2A 4NN5B 3VRIA 4RA0C 4AQ1A 3KBPA 5C0JB 4A37A 3EXJA 3IPFA 4QXGL 3QULB 5JUEL 1PZ5B 4ZW6A 3VXPB 3IWUA 4D0DA 1NCWL 3V4UH 4AUYA 3NZSA 1DJWA 5E2VL 3W0WE 4ABVA 2CE6A 2WUBH 1YYLL 3DSFL 3S8GB 3L95B 4O58L 3IPBA 3EYSH 3QI9C 1IUZA 1CR9L 3PWPB 4O4YH 3SN6N 4WO4B 5C6TL 1DVXA 1KENL 2BHYA 1TZHA 2C9VA 3VH8G 1CGSH 1ET7A 2ODIA 3EGXB 3IXTA 3QPKA 1OL0A 5DS2A 4PS4H 3E6HB 4L9LB 4G9FB 4F7CB 5C09A 4U33A 3CG8A 1ILUA 1EUTA 1TQUA 4K94L 3UTPE 1S5IL 1DVZA 5E2TL 4YFLF 3TM6A 4AM0Q 1RZJC 2Q87A 4M6ML 1RHHB 1DCLA 3MCYA 1ZGLB 1VACB 1S7QA 2AQ2A 4Y4KA 2NOYA 2WXNA 4P23C 3LRSA 3ARYA 3W5NA 1CE6B 1GGCH 4OQTH 1XT5A 2ITCB 1X5HA 4I77H 1KIRA 4AIOA 5AYUL 1B0GB 1GZQB 4C4BA 3PGFL 4L1DA 3IJYB 3CJJA 3OAUL 3SCMD 4QXUL 3QORB 4NUMA 3ETBF 1P6WA 1L9QA 1YYMH 3ABZA 5J9PB 1MAJA 2D2OA 2WLIA 2WGNB 1AOZA 1OAKH 5I16B 2GUOA 1CBJA 5KBNC 3OZKA 5L6YH 4U1IB 5IHWA 15C8H 4FA8A 1OPOA 2FX8H 4M61B 5EU3A 2GIXA 2X1QA 1JYWA 4RETB 1XQ4A 5HVGB 1DCEA 1ZHKA 2EC9T 1PQZB 4JREC 3D3VB 3LKRA 3IU3A 3MLWH 4NOBA 1T6WA 3TLRA 4FFYH 4XX1E 2UUDK 1PJ9A 3PUUA 3NESA 4DAGL 3FCGA 4HWNA 2Y22A 5E4IA 3AXLB 2WUBL 3DSFH 4MA3A 2YS4A 4R8WL 5E0QA 3ULUF 1XR9B 2YA1A 4PJAB 2BIPA 3GFUA 4BK5A 3F62A 1FPTH 1TO5A 2Z93A 4FQXA 3SBWA 1G4MA 3TO4B 3MACL 1K3ZA 4U2YA 3VD5A 4Q9RL 4M1DH 1Q0YH 2AXGA 5A2JH 1V3JA 3EFDL 1YMHA 4M7LT 1ZV2A 3BD5A 2Y6SD 1IVTA 1JDCA 4XOAA 4JHWH 1T66C 1ZHNB 1TKWB 1JVOA 2A5UA 3LKRB 1F90L 4LNRB 2FIRT 4EN3C 3H0TA 1MQKL 1UOVA 5DK2A 3VWKD 2DQCL 1KLGB 4ODSL 3EH4B 4Q0XL 4NKIL 3WFZA 1HCVA 3WG7B 4AIZA 3MXVL 3BAIA 1KB5L 4YN3A 5I8CA 4X9FA 4A2EA 1U8OA 4KRLB 1T2JA 2P7TA 2QVKA 4MDRA 2WYZA 3FH5A 3SCMB 5DEGA 5INCA 2R9HC 4KNQA 3DETC 4A67A 3BOVA 4QCIB 4A7TA 5DJZB 5DQ9A 2BOCA 1U8OB 3AAZB 4NN5C 5M7QA 2JK5A 5EBLB 5ENWB 3UYPA 4HA1A 3KE0A 1ZLDA 1RJYB 1X5LA 3RJDA 3V0EA 2KPNA 4DOHE 5LN8A 4DTGH 4F37F 1MFDL 1QFWL 2NZIA 3FC8A 3HLAB 4ABWA 1XGUA 3QUHA 2ITCA 5HHVL 2GIMA 4ORGA 1CICA 3CFQA 1XGPA 1J1XL 1E3ZA 3U25A 2Y7QB 2E9JA 5EEYA 1KUMA 2F58L 4CC4A 2J8UF 2VM4A 4HEMA 5GS1B 5GGQL 4P3DA 1A47A 3QUZA 3Q8CA 2APSA 4R2GC 5F89A 3T09A 5FR3A 5J56B 1BIHA 5ILTL 1WA1X 1U3NA 4AZUA 2BW4A 3NEXA 4BFKA 4R5VA 4FL4B 3KNBA 3W82A 4JY4A 2C9AA 1MCFA 2J57A 4KHXH 4MX7B 2BIQA 3IJSA 4OU3A 4AQ8C 4JO2L 1NGPL 2D7PA 3RVUD 1PPIA 4N9GB 4HEPG 2KT6A 1FNEA 1AQKL 4NQXB 3GM0A 1IAIL 1XCQB 4UUJA 4G11A 3O6FC 3SDXB 4HUCA 3BE1H 1DEEB 2QPFA 4N0CC 1M57B 1UUSA 3HFMH 3ILPA 4ZMPA 3KYKL 4YPGB 3HC3H 1H8LA 1KFAH 2AQNA 4X99A 4XVSH 5IVXE 1ERNA 1BG1A 1LQSR 5L2KD 3PGCA 1EZSA 4QIRA 5F89B 1IIKA 4X6BA 4LLVA 2WXKA 3D1MC 4DP8X 5B1BB 1FGNH 1FNAA 3I50L 1JHLL 4QHNA 3VGHA 3SE8L 1INDL 4J2QA 5AKVA 5H37G 4P46D 5E95B 5A2BA 4MYWB 2ILLA 5I6XC 1P4BH 4L29A 1S7UA 2WQAA 2IWKA 3EO9L 5MEPB 3QWNA 5TF0A 3V52H 1Z5LB 1F2QA 1KBGH 2K70A 5KYXA 1P1ZB 2AFNA 3BGMB 1J5DA 4Z23A 5GRJH 3HC0A 3TEZA 3MUGA 5B3JE 1EZUA 3IBOA 4OVVA 3IDNA 1PLCA 4LEEA 3D6GA 4X5RA 5EOCH 1UOWA 4HJ0D 3KH3A 3EFFB 5I9QB 5D6DC 1C8QA 1LTXA 3U4AA 2F53E 3CH8A 3X2QB 5C0CA 2CJUL 3FO0H 2DLGA 3PGCB 3C60C 1H6UA 4PVLA 4LFHD 5DT1L 4HBCL 1FO0B 5D1ZA 5D2LF 3DIFA 4TSCL 2VUKA 4Z78B 1CICD 1Y0LB 3GMQA 5I30H 2VO5A 4Y2OA 5CEZH 5I6XB 1L9NA 1TZIB 1B3JA 1R6VA 4XBPB 2YWZA 4L4VB 2QKIA 4NZRL 1VFUA 1YNTF 2CNYA 3C5SA 5DQJA 2FJHB 2GY7B 1ZV5A 3ZYJA 6TAAA 5BCAA 1OSYA 2D7TH 2VJ8A 4HH8A 4L5FH 2NUPB 5E2UL 4AK2A 4YJZL 4Z7AA 4KX8A 1AS8A 2FVNA 1S9KC 3JWNG 1H6EA 4ZTOH 4YS4A 2YK1H 3MLXL 1X5FA 1CK0L 4S11A 3U0PA 1ZVSB 1RSYA 2I25N 2FWLB 4U31A 2V33A 4JQVC 5F88B 5KSAC 3RHWK 2OMWB 3A4AA 1OO2A 4AEHL 4Z7OB 3PL6A 3QUMH 3PS6A 4E41E 2Y1VA 2ATAA 4Y5YC 5B39A 4UQAA 2OYPA 4W81A 3OTTA 1JZ8A 1W16A 4YL9A 4N2LA 3ARQA 3MO1A 4P2QD 3UDWA 4ELKA 2HN7A 1ZVSA 5C3TA 3IFNH 4AZ8A 1IM3D 3M1OA 5HJGA 5IR1B 4WFHE 2VL4A 2EIDA 4HLZG 2MRYA 1N5AA 5FB8B 4BFJA 4YWGL 3L9BA 1AFVH 4HUNB 2FJHA 2IOMA 1PBYA 2HJKB 5FM4A 3ZHFA 3RHWF 2R59A 5KZCB 4I8DA 4OKVA 4JQIL 3ZL1A 4RWYL 4Z78A 4RIRA 4JVUA 2W94A 1E8YA 1AS7A 3C08L 4OZGF 1ZLUH 4DKEL 4O51B 4P8QA 1FAIH 5FFOA 1TVHB 3ULUE 3SDAD 4WGWB 4XVTH 2DQHL 4E5XA 2N7SA 1MCKA 2ZKWA 4ZNCD 3GUTB 1I1AD 3VRJB 2B3RA 2Q8BH 3ARXA 2NLJA 3LQAC 3KL3A 1MEXH 5IM7A 3P4MA 2G75B 4AK1A 3LXAA 4LSPL 3W3BA 1JNLL 3I75B 3P2DA 4OLYL 4WSJA 4YUEL 5D93B 1CF8L 3SPVB 4A2MA 1QO3A 3T4YB 5KYXB 4I2XE 4F7MA 4DKFL 4WJKB 5H2BA 4HKJA 4OLXL 4C55A 1JVKA 1NFIB 5E6RB 3VFWB 4AC4A 1QRKA 1KGCE 3TOPA 3QIWC 4PRHB 5F6HI 3R0MA 5E1AA 3DVIA 3VXMD 1RIHL 1FVEA 3OXRB 4ZQKA 2VDNL 4JFXA 5AW1B 5FXCH 4PTUB 4PUBH 3SE3C 1BQLL 2GKIA 4ZTOL 4POZC 3OR7B 2J5LB 4KHXL 4E5XB 4PWFA 3FB6A 2QZ5A 4KK9D 1AR1C 1MI5A 2WW8A 5L9DH 3W0WB 4JHUA 4YH6A 4BSJA 3KPLA 3FRPA 2GBTA 5E1GA 3H9SD 4GLRH 1J0YA 5DRZB 4RIRB 1AGFA 2CUMA 3PWVA 4HKXB 2WBKA 2VLKE 2Z31A 4KAQH 1PZ2A 3CZSA 5ABDE 1KULA 4PJDE 2NY6D 3DURA 4I1RA 3EIFA 5EN2B 3II3A 2X38A 2D03H 4ZO8A 4HUUA 3VMNA 1AGFB 2DLEA 4P5TC 1FC2D 1ZHBA 1E9PB 1NCJA 2ZP9A 1WD9A 3IETA 4K8RH 1UYWH 5J3HD 3BZFB 2R56L 5IFHL 4N2MA 4WHCA 1I7TB 2CDFA 3OR7A 2DKSA 3VWJA 1JZHA 4UV7L 1F2XK 4U1SB 1Z7JA 4OF5A 3CXDH 1M56B 1LMKA 3LXUX 3SEPA 1I8MB 5BXFA 1XR8B 4MSWB 4LF3A 4ZQTA 5EOCJ 4LCIL 5DZNA 3OR6A 3VFTB 5C0BB 3EUUA 4HGKC 5I2IA 3IE9A 2LVCA 3HG1A 4UM8A 1FJ1A 4NKMB 5INDA 3UTZA 4PP2B 3SQBA 2WZPD 1LQBC 1SLUA 2NZ1A 5AW0B 1JK8A 3H2QA 2OZ4L 1S9XA 1G9NC 3IDJB 4QRRB 4DFIA 3RZCD 4AITA 1BEYH 4ZOCA 2J2ZA 1HJCA 5DHEA 5CHNB 5I0XA 5FS5A 1X7QB 1D7DA 3C5XA 3ARSA 4PRNB 2ZYIA 1L0QA 4OCXH 5DUPH 2OXHB 5AALA 3WEOA 3VRJA 3ZE2E 1ZTXE 1YJDC 5C2BH 3FSWA 5HGAB 5AUMB 5DRXB 4GRMB 4QWWD 3WL9B 4I1NB 4YFEA 1AQKH 1BD2B 3N5AA 1HFUA 1U8PA 3MRLB 3PHAA 1F3RB 3D85D 4IK7A 3E0GA 1SVCP 3GSXB 3SDCB 2P44B 5IHUL 4F7PA 1S8DA 3KPRB 1E3XA 1IFHH 1I7UA 5I2IB 1KYOK 1KT2A 1QZ1A 1M9WA 3FONB 3V5KA 1RZGA 3H6AA 1L9MA 4XVOA 1U0QA 4J3OH 5BXFB 4J3TA 3CH1B 4UIKH 1PZCA 3N42F 3SE8H 3VMPA 5CLYA 4NBZB 3CPLB 4G6KH 5CEZL 1T20B 1VA9A 4YBQC 1I1CA 3VO0A 2OMTA 2DQDL 4TTDD 3E8UH 1CLCA 3EBHA 1ACYL 4W9CC 1HAWA 2HXAA 4XPTL 4ZFQA 4WU5A 1SYVB 1WD8A 2WXHA 4Z7UB 5I19L 1FVCA 4FS0A 3UZEA 4IBUA 5ERWA 3TA3B 5DHVH 4HS8L 3WELA 1JZ2A 1N64L 1YPZE 4NO5B 1KYOJ 1MHCA 1XTLA 4F7PB 2FEEI 2E7BA 1X5JA 2XWZA 1IEHA 1N8OE 1OSPL 2QPDB 4OZ4A 1F90H 2JKJA 2DI9A 2DLFH 3MV7A 2YPVA 3ETBJ 5HYJD 2J4WL 1N0XH 2YA2A 4HUWA 3HI6H 2YR3A 2XLLA 5KUKA 1GCFA 1JRHI 3ABKB 2QVTA 2UZIL 3D18A 5G4MA 5AB2A 5K59E 2Y9RT 4Z95H 4LPUA 4AEFA 4L4VD 3ZIYA 1FL5B 1G4RA 1GAFH 3O6LL 1QQDB 1RJZA 3JV4B 4UOZA 4U6TA 2X9YA 1NUDA 3QPXL 1T0MA 3NACL 5JHDE 1HZHL 2EILB 3LB6C 2ORBH 2AC0A 3OPZH 3Q5TA 1EXUA 4EI5B 4S1QH 2KDYA 3S2CA 5ANMA 2B14A 5DZJA 4OVUA 1SMDA 3EO0B 1MEXL 1U4EA 3MRQB 2CCVA 2ESVA 4I48B 3HOGA 2O1AA 2NYZA 1DSWA 2WCGA 4GJTB 1SHWA 4F7CA 2COVD 1S7WA 2BY1A 4NZDA 1HSBA 1V05A 4LEXH 4HH9B 5LBSA 4Y8AA 1HKFA 2OQJB 4HOZA 1SVBA 2JLLA 2WIMA 5FKAB 5B1CA 1D2PA 5BOZG 4OQ1A 4YSPA 1NDGB 4QF1A 3UJTH 4I87A 1JPTH 1P4IH 3VXSD 3RWHA 3KDPB 4TNEA 4ATWA 1S7TB 4XVUC 3NQKA 4IW4C 4WY7H 2EO9A 1DZ0A 1TKWA 2WZ5A 2O6DA 4YR6A 2YD9A 1ZJBA 5DDHA 3SO3B 1X5XA 2OV0A 5I15H 4RRPA 1TJMA 3V0WL 3ZSSA 4WV1C 4OJYA 1TSRA 3LEYH 5ISZE 1OEZW 3EHBB 4JBSA 5CS7A 5E99H 3V6OA 4APQD 1OSPH 3QGVA