1BA9A

The solution structure of reduced monomeric superoxide dismutase, nmr, 36 structures
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEQSTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of reduced monomeric Q133M2 copper, zinc superoxide dismutase (SOD). Why is SOD a dimeric enzyme?.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 31
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ba9A00
3QQDA 1DO5A 2AQTA 2LU5A 1AZVA 1Q0EA 1MFMA 3KM2A 4FF9A 2Z7UA 4A7GA 3PU7A 2SODB 5KBMA 2AQNA 3ECWA 2C9SA 3KBEA 1HL5A 1S4IA 3HOGA 3L9EA 3RE0A 1BZOA 1PTZA 2AQPA 2XJLA 4L05A 3L9YA 3T5WA 1N18A 2E46A 1SOSA 2WZ5A 2V0AA 2WWOA 2XJKA 3CQQA 1DSWA 1SDAB 1U3NA 4MCNA 4OH2A 4BD4A 2JLPA 3K91A 2JCWA 3MNDA 1EJ8A 4A7TA 3ECVA 3CE1A 1KMGA 3KH3A 4U4IA 1OZUA 1IB5A 3MKGA 2R27A 4OJAA 5CU9A 2VR6A 1YSOA 1F18A 4A7UA 3CQPA 1JK9A 1OALA 2K4WA 1F1DA 4B3EA 4N3TA 1Z9PA 1FUNA 1IBHA 1E9OB 1CBJA 1OZTG 1L3NA 1EQWA 3GZQA 1B4LA 2AQQA 3ECUA 1UXMA 1E9OA 1IBBA 3GQFA 1JCVA 3QQDB 3GTTA 2AF2A 2C9VA 1XTMA 1SXZA 1E9PA 2Z7YA 2ZKYA 2GBUA 2AQRA 2VR8A 2APSA 2WYZA 1Z9NA 3LTVA 3HW7A 1SRDA 1SXCA 2ZKWA 2WWNA 1JK9B 1YAIA 3GZOA 2VR7A 2WZ0A 2ZKXA 1N19A 1SXSA 4A7SA 4A7QA 3GTVA 1XTLA 3F7KA 2GBVA 1COBA 1SXBA 3H2QA 1F1AA 2WYTA 3KBFA 1B4TA 1TO4A 3SODB 1BA9A 3S0PA 2E47A 1SDYA 1XSOA 2Q2LA 3KH4A 2Z7ZA 5KBKA 4MCMA 1SXNA 4A7VA 2Z7WA 1E9QA 1OEZW 1PU0A 1SPDA 4BCYA 1E9PB 2ZOWA 1YAZA 1P1VA 3KM1A 1ESOA 1TO5A 2WZ6A 5KBLA 1OAJA 1PZSA 2AEOA 2AQSA 1CB4A 3F7LA 1RK7A 4N3UA 1IBDA 1SXAA 1HL4A 2GBTA 2NNXA 2WKOF 4BCZA 3GZPA 1E9QB 3H2PA 1F1GA 1QUPA 3HFFA 4A7GF 2C9UA 1UXLA 1IBFA 2WKOA
chains in the Genus database with same CATH superfamily
4ZZFA 1S9XB 1THAA 2R0LL 4PJBA 3TA3B 3BISA 4IIQC 2OMWB 5DK0B 4PRPE 5IB2A 1DYZA 1WT5A 5TQ0H 4M3JA 1XD1A 5GRXG 3DIFA 5MI0C 4TQIA 4I77H 2X4SA 4N26A 4NIKB 1E4XH 4GAYA 5CLZA 2O5YH 3ZE1F 3U7AA 3EHBD 2VXQH 4IGBA 3DTXB 2PWGA 5D1QC 1MRDH 4KO7A 3QPQC 3CMGA 2IGTA 4J3UA 4NKOB 1NBVL 5KVDL 1PD6A 1Q4NX 2AXHA 3QUGA 2EECA 5IVZB 4O4YL 1JGDA 3EYQC 4WHCA 1F11B 4JY4A 4M93C 1HZLA 3R06B 3F58L 2JKJA 3HCVA 4LSDA 4OIAA 1MJ7H 4XAWL 5JPMC 3QCUL 4TUUA 3ZYZA 2DLFH 3KGRA 5K93A 5F3FA 2NY2D 2WY3B 3O2WL 1OP3H 3ES6B 4D3CL 4OTXH 4GP8B 4OTXL 2WBJB 3STLA 4DP7X 3K6SB 3RVVC 2X2IA 3F7RA 3HZYA 3B7SA 4GP4B 2MH4A 4AUYA 2OMZA 3LRGA 3O8XA 5IF0B 3V4PL 4BSVB 1BAWA 2W07A 4FFTA 4NZDA 3PIQB 4LLDA 3C6SA 2X09A 2E27H 1HH9B 3NACL 3S35H 4ANUA 1ZJBA 4G8GD 3ZQWA 1JD7A 5KVDH 2XUWA 3AC0A 5DHDA 1FO0A 2CLZA 1NFDF 1CE6B 1IC4L 2YAMA 2GSMB 3S5LA 5DWUL 5LNGA 1E42A 1QSFB 1LP9E 1CS6A 2OV0A 2LTQB 4JFYB 3STZA 5AD0A 2XWCA 3TS8A 4WV1C 4XCCH 5CLTA 4HMDA 4R7XA 1NEZA 2L7EA 5CSGA 5I0YA 5EEYA 2NTFA 4EDWL 3DC0A 1ND0B 4HFWA 3EGSB 5HJBA 3RIFF 1ET7A 2QKIC 3T65A 2R1YA 15C8L 4JBSA 4PJIF 3LIUA 4X5WA 4D3CH 1EBPA 4UQAA 1OLZA 4PYHA 4FYSA 4U1HA 2F18A 5AB1A 3T65B 2ZX5A 5CCKL 5I8KL 3J07A 1KENL 2BOLA 3F58H 2I07A 5SWSE 1AZCA 3T3PE 5HYQA 5IEKB 1CDUA 4IBUA 2OJ1A 4N0FA 1HWGB 4P2OC 4F2MA 4ZW3A 3E0GA 4MAUL 3VFWB 1CR9L 4Z7VB 1D6EA 2VDLL 3LXAA 3WJMA 2MCAA 4UNUA 3O2VL 1KN4L 3GZPA 5IROC 2OSWA 4NZJA 3ZIMA 3HFFA 4OGYH 3MZGB 1EXUA 1MFAH 4OF0A 5MP6H 3ZHNA 3CVCA 2M83A 4PRAB 2KQNA 3IF1A 4G3YH 2Y2TA 4IMKA 5ALBH 4GUOA 4AQAA 5I71C 3L3JA 1FFPB 5FCSH 4PJ9C 1TR7A 5DA4A 2COQA 2QSVA 3Q8FA 1NCAH 2ZQKA 4IK6A 2V2TA 3DVFA 3QXUA 4G42B 3R19A 1U58B 5C8JB 4OZIB 4X99B 3UBXG 3L5XH 3QDJE 3K81A 5FYLH 1GGTA 3FQTA 4PRHA 3UG4A 3A21A 3PWVA 3EJTA 4YEFA 4BFGA 1XGTA 5J5EA 4HU8A 1N26A 3DXAE 1ZA3B 2IAMC 1F8TH 3JTSA 4Y1AA 2HFGL 2VISB 4WV1A 4GBXD 3NG5A 1L0YA 4NZTH 3PQYA 1MFEH 1M71A 2EEDA 3AM8C 4PI0A 1PG7X 4H8HA 4JZJC 1HTYA 5D6DA 4QY8B 3FXIC 3ROLB 1QI3A 1Z32X 4FFWD 1CT8B 4NRZA 1NUNB 4AH2B 1CCZA 1JHTA 3V6OE 2GK0B 3V95A 1KFGA 1MCKA 4W4OC 1HHJB 1QZ1A 4AY0A 5I1DA 5F3HA 4ANKA 3KPLA 1RCYA 3KPNA 2GIMA 3AACA 2M26A 4LCCA 4Y8AA 3MNZA 5JIQA 4AKOA 3CZFB 1YMHB 5D4JA 2QQNH 2ZAIA 3LNEA 4HIHA 1HXYB 1NUDA 1D9KA 6FABH 4H8WL 1XXDC 3RWHB 2QSQA 4X5WB 4BDVA 3KLAB 5C70A 5DJ6B 1P4LA 2VRKA 4WFGE 4QLRA 4LVNB 3B9KA 2WNWA 3LEXA 3GZOA 5LBSL 4EEEA 4HEME 3QC6X 4I0PB 5J6GB 1JPFA 5EEWA 5FFLA 2DH2A 3CFQA 3LIZA 4E0RB 3K2KA 3L7FA 4ZMTA 3CXDH 3BEWA 1UWYA 2QVIA 5F1KC 3V7AE 5EZPA 3DSNA 5DQDH 3WO3B 1X44A 3US0A 5JW4R 5DJ0A 2FECI 3C5JA 3G9VA 1IEBA 3QJOA 3S36L 4K94C 3GSNL 2EDYA 3W37A 1CL7H 4Z0XA 4N85A 4LLUA 3SYCA 1YMME 1BMWA 4MXWL 2GI0A 5EU6D 5K1NA 4GRLC 3HN8A 4W9IC 3FB5B 3Q1SH 4G2AA 4PJFE 3DMMD 3Q8AA 1FAIH 1ZD6A 2FDBP 1WVZA 4ABUA 4AIZB 3TFKC 4IDLA 4KQ3H 5T3XH 5CFAA 1KULA 1IJ9A 5B3JE 1JIBA 3X1EA 3RVUC 2KPNA 4JPQA 4UTBA 1P6AB 2ZPKL 1VHPA 3FFOA 4N1HB 4QRPE 5F1NB 4UNVA 4IIQA 4ZBJA 3UAEA 4NJ9H 3HR5A 1HKFA 4FNPA 3NACH 5ERWA 1OAQL 4X2UA 2VZ1A 3AG2B 1ZCRA 2XVKA 3B8YA 3EGXA 3I9IA 5CSBA 3RGHA 4BBWA 2JV6A 1UOWA 3EJJX 3JUYA 1AZVA 5DFVC 8FABB 2BCKA 3QPXL 2VAAA 1E4KA 3FDWA 3RWIB 3VFGH 4IDJL 3D69B 3D9AH 1FORL 3O2WH 3BZ5A 2FX9H 1F4WH 4AQ8C 1HSBB 4UM8B 3O45A 2H9GA 4NQQA 2J44A 1K6QH 4PJHE 2ICEB 5E8EA 2XZAL 1IIKA 3KYKL 4OCRL 2GHWB 5CNHA 1XF2B 4ZXBA 2IALB 4AC2A 1QHOA 3JWDC 5IQLA 3HI1B 2ZP9A 4H0HB 1A66A 5IB5B 1PW3A 4RGOH 1VGKB 1D5IL 1KEGL 3KGSA 2G75A 3ETBJ 1YNTB 4LVHC 1R3KB 4R7DA 2BX5A 1QSEA 4KDTA 3MXWL 3MKGA 4JY6A 3SBPA 4XHJC 4AQ1C 2DM2A 3MRNA 3SDAD 3QWRD 2VLJB 4ONFH 4UANA 3V2AR 1WA1X 3FQNA 1XIWD 4EUPH 1P4BH 3BT2L 5JXAH 2CGYA 3EH3B 2IAAC 2YRPA 5I26A 5CUSL 1AMXA 2ZSWA 2H2SC 5AVWB 3SDAC 3BP4A 2Z4TA 4GW4A 4I2XE 4TVPH 5ETUA 3W3BA 3ARSA 2H2PC 3N42F 4ZQTA 1MIMH 1H6TA 5GS2H 1QSED 3BVNB 3DUSA 4HIIA 3AREB 4DTGL 5E4OA 1Z9NA 2R59A 2YD7A 4KV5E 4XN1A 3GSRA 2X2UA 3UZVB 3K8LA 1BFOB 4TQ8A 2FO1A 1ML0A 4QUOA 2DQFA 4JRXB 5J1AA 3AU1A 2A38A 4J3OD 1OIOA 3GTVA 4JY5L 1XF3B 1OM9A 4UQCA 1ZVYA 3K5RA 1H6EA 4P5MA 3JZYA 5T1KA 3SCMD 3F83A 1NC2A 2RA1A 2ARJQ 1WLHA 4JFFE 4ZTPL 1KT2A 5C7ZA 4KGJA 1DL7L 2YGQA 2GTZB 1UH3A 1O9VA 2XLLA 3O9WA 3RVWC 3BUIA 2MHAA 3SDYH 1XH1A 4YSUA 3CDYA 3MV11 5DFVD 2VUOA 5E2JA 3RBGA 4CUCA 4JFHE 1ES0B 4AV4A 2F58L 4HVBA 3PWNB 3EYVA 2WOYA 1MLCA 2P7TB 2H6OA 1WIPA 1FNGA 4HOZA 3VWKC 1KXTB 1KTBA 3CVHA 1IM9D 1HL4A 3IFLH 4WTQA 2EH8H 3KPTA 2PWHA 3BHBB 2BWDA 3DHMA 3CZGA 2OMTA 4U1LB 3MRCA 3H9SD 3F12B 1ZANL 4N24A 1BHGA 3QEHA 3EO1A 3C60C 4YE4L 3EDJA 4M6NH 5K9KA 3MCYA 4ABQA 2XQYG 5DJXB 2A9NH 4IBVA 3MTXA 1JE6A 3HE7B 4FF9A 3P77A 1YEJH 4Q2ZA 1M9WA 1MCHA 4DZBA 1E5ZA 2OQJB 1UB6B 1Z9SB 1M6OB 3PGCA 1BQLL 2LFGA 2CUAA 3MV7D 4YHMH 3KYNB 3W9DA 5E6IA 4I7ZC 4WU7A 4BZ2H 2APXA 4GAGH 3CZLA 3KJ6H 3OB0K 5E5MB 3U0WL 4GUPA 3WXVL 4U0QB 2ZP0T 3B6SA 3AAZB 4QRUB 4QYOA 2JI1A 5FGCB 3WMSA 2K8QA 1KFAH 2EDOA 3A67L 4G8IB 1F90H 2CGZA 4P2RB 4X4KA 4DNLA 4HUWA 4FQLL 5DC2A 1SYSA 3F62A 3NTCH 1TNNA 1M05B 2OMUA 5IM7A 3DBXA 4KMQA 1ZWIB 4Z7UA 3L3DA 1KUMA 1NAML 1T89A 1EERB 2VERA 1X4YA 3B2DC 3FT3B 1OZUA 1P5UB 3QZWA 1O6TA 4YDKH 3LMJH 1WAPA 1NPNA 4X7SH 1TZHB 2NMSA 4L8BA 4P9HC 4DN4L 4LOVA 1OTUC 1UXSB 4KKLD 1QFHA 5HYFA 1SY6A 3GTNA 3RWJA 4QXTB 4XX1E 1D3CA 4TYUA 3OJDB 4NN5C 4KQ3L 4XPTH 1SBBA 1T1WA 5IB1A 3TH3T 3FO0L 1D2OA 1IAIH 4FE9A 4K9JA 4Y7OC 4Q2ZB 4R4BA 5B3SB 1MCWW 3K3QA 5FGBC 5AVUB 1XB8A 4GG8A 4I3SH 4PJ9B 2P8PB 4QRPD 1J5HA 3KJ6L 4Z7UE 4UDUB 2YOCA 1DBAH 1CL7L 4XMLL 1KPRB 4ENED 3CN0A 2VJ0A 4F1ZA 4JR9H 5CD5C 1QI5A 3ME0A 3QEHB 4GAFB 3VE0A 1SMOA 2VDKH 1CMOA 2WCGA 1IL1B 1SJVA 3KLSA 2OMTB 4QJ5B 2IC2A 2X4QB 3E9UA 1RU9H 1KIUA 2KLTA 3DX1A 4M6NL 1BFTA 5F8QC 2VH5L 2QGEA 1GYCA 1D5MA 2ODIA 4J39A 4GG6A 5CILH 3QG6B 4G83A 3L7EB 1U3HD 5ICYB 3QUZC 1RZ8B 4KXDA 4BQBA 3BZEA 4MSWB 4X5XB 3VXME 2XYBA 2MKWA 3NRPA 4XZ4A 4G6ML 4YC2C 3C75A 3CVHB 4QO1B 1FNGB 1MOEA 3RNKB 4RVBA 3SGDH 4BWUA 1B3IA 2MNWA 4PJAB 1Q9KB 5LG6A 2EE3A 5IROD 1F4HA 4ZOBA 5AG8A 4IU2A 2NX5E 4UDUA 3F3HA 1PNDA 4RSVA 4BSWB 2XKSA 2P8PA 1KYOK 2RFXB 5DZJA 4TLSA 2C7UA 5GHWH 2XQBH 3CU7A 5FEBA 2WKOA 3V9CA 4JPVL 4F7TB 3QQDA 1N7MH 1WPCA 3V6FA 1RUKH 5DHVA 3V8OA 2DM4A 5KSUB 3UYRH 4XNAA 1A1MB 4ZS6D 3LKQB 4LHJB 2APBA 1CFTA 3FB7B 4D9RD 3IXAB 2GY7B 3AU1B 5BUGA 3ARTA 1OSYA 5LGKA 1JWSB 2X3AA 1GCYA 1CTNA 4LASH 1HILB 4NQVB 4DTGH 3RDTA 2OP4H 3NH7L 2CA3A 4OVVA 5CIPB 5D5MA 3L5WA 5IFJA 3L5XL 3ARYA 1NEPA 1ZPUA 2AGJH 2B1OA 2OMUB 5HDBF 5KYXB 2OI9B 3RUGB 2CCWA 1EGJL 4GAJH 4GOSA 1URIA 4KDTC 3RFZC 1R3KA 3KWUA 3BDBA 1RH8A 4RISH 4MQSB 3O2DH 3FQWA 4JFQA 4CRPA 1PF3A 1WGOA 3AT0A 3LKPB 5C0BA 1T1ZB 3MBEC 5C0JB 1KN4H 3CFEA 2AERT 1RZKC 2WLLB 1M1XB 1RIVL 2YOAA 2VLME 3LEYL 3QJRB 4LVHB 5BRZE 1B4LA 4TVPE 3O41B 5HGDB 1AY1H 3N85L 3ZW3A 2XY1A 4JFDB 2XWJB 2CBOA 4OLYL 3VGHA 3UP6A 2DQUL 1A5FH 2H9GB 1AO7B 1CZ8H 4RESB 3G04A 3M17B 3BT2H 3S3PA 4B60A 5JXAL 2QPFA 3P2DA 1OAKL 5GGTH 5C0GB 4J6IA 4H88H 1OP5K 3SDCD 1FC1A 1ORSB 1SZNA 2K3HA 2NW3B 3BQUA 4QYAA 8FABA 3QPQD 5KW9L 1COBA 4DP2X 2CO7A 4YFEA 4QCIB 2WWMC 3WTSA 5ABZA 3V0AC 4BK5C 5ILTL 4YN3A 4ALAC 1EVUA 1RMFH 3P54A 5CEZE 2QDVA 3PABA 4K5MA 2DQDL 4AIZA 1OY3B 4BZ1A 5D2NA 2OA9A 2AJ3B 2NX5D 1IC5L 4ELMA 4LLVA 1TG8A 1JRHH 8PAZA 2ATPA 5IZ7A 5ELIA 1H9VA 4UT9A 2FX9L 2VXSH 3QIBD 5KS9B 4TULH 4LZKA 4Z78A 1OT1A 1S7SA 2AJVH 5GGQL 3TVMC 1EHLH 4FFYL 3KXFE 5C6TL 3VI4A 4MB4A 4Z7NE 4HIIB 1ACZA 2B1AH 1R5WB 4M48L 4BHUA 4R7VA 4ZFOL 3RFZA 3ARGD 1J9SA 2CPUA 1ACYL 2YA1A 4OCMC 4K7PY 4PJCB 4FA8A 4N0YL 4Q9CA 2EIMB 5CKGA 3AT8A 3ATEA 1UQSB 4NGHL 1LEGB 3OKEB 2A4EA 4I87A 4FXLA 3TVMA 5CBAB 5GGVH 2BK8A 2PR4L 2EXYC 1IT9L 2AQNA 3D2TA 5LVEA 4KJQD 4OFYD 3JXAA 4ZODA 4YOKA 3BCFA 5AW1B 4K2UH 5TJWK 1WEJL 3UC2A 3T0DA 1LK2B 4ERSL 3HE7C 1E4WL 4FI7A 4M6AA 4BXVA 4BK8A 1P4LB 5BRPA 4YH6A 3MLXH 1CLOH 4PAZA 4UT6A 4OLWL 4MQXD 3VM5A 2CIKB 1HXMA 1FAIL 4QHMA 4R4ND 1SDAB 2AMGA 5BO1L 3KD4A 1IE5A 3T77B 4NRZB 4M6OL 4ZMYA 2RJMA 1T1YA 2OLDA 5SV4A 2YLKA 2VNCA 1MPAH 1H9DA 3X3FL 4UV4L 1E40A 5SX5K 1EAPB 1KJMB 4PGEA 3CXDL 4JVPA 1I7RA 3GKZA 4NT6A 4PRHE 2XX1A 4M5TA 4C4BA 4GBXB 5BRQA 3US9A 4YSCA 3WN5B 2X2JA 3QE5A 4AMWA 3ULUF 2WNGA 1EFXD 4OBSA 3QNYB 4NOFA 1FL6A 2QDWA 5DEFB 1P9MC 1G1OA 1UT2A 1SN2A 2R0WH 5IESL 2EZ0D 2G60L 4X8CA 5HYSB 1M7UA 4MNQE 3KYOB 2JJWA 3MBXH 3LRSA 3QJUB 4GXUN 2I69A 3IFNL 1P7HL 1MZZA 2HPOA 3MPCA 5F7EL 5B1JC 1NWOA 1GIGH 1Q0YH 4KK8D 1AVAA 2DDQL 4E36A 1IGYB 5E4AA 3OG6B 2F8IA 4PJEF 2B7DT 2C9AA 4P0DA 1HAWA 1ROCA 3RB5A 5IUCA 5FFOA 3PPEA 1JZGA 4Z7VE 3MRFA 2EYSA 1WS7A 4AL8L 3U83A 2H3KA 3D2UB 3WJJC 4YHLH 3M1BA 4BE6A 2X4TA 5GGRA 2IOOA 4FLHA 4NQEA 1JN6A 2BNQB 2AJYH 3VFWA 2N0MA 3OBAA 5GRJL 4OGAD 2YK1H 3UBFA 4NP4L 2KMWA 4N0FB 5DUJA 1SM3L 3OLIA 3OMNB 3ILQC 3UO8B 2FYYA 3EYOB 3VRIB 1BCIA 3PWPD 1NCAL 3WTVA 3UPRA 3MMEB 1G1KA 2QADB 1NWPA 4XNYL 3VJ6B 5AFAA 3GXMA 1MPAL 4MD4A 1FRGL 4AYGA 2VLJE 4Y5YA 5LXGL 5HHQA 4PD4J 1H15B 4HGWA 3T6XA 3U46A 1BVKB 3QO1A 4WEEA 3QFJA 3O3DA 3PDOA 4JFEB 3KPNB 2SODB 2L8AA 4HJ1A 5GRVK 2EZ0C 2OTUA 4JM2D 4PREA 3S2AA 2GK0A 5I1DB 4ZO6A 1IC4H 3FYIB 3LNDA 3ZDZF 4QNPE 1FJ1B 2A9DA 2XTSA 4C56D 3N40F 2GAZA 3GO1L 3RZCA 3VTAA 3V4UL 2R29A 2WBJA 5EMYA 5LGHL 5SWQA 5KJRH 4K23H 3MRDA 1GOHA 5L2JB 3MRDB 4ODTH 4PCKA 1AHWC 4LEOA 5IVNA 1K5NB 4NWTH 1MXDA 1OANA 3D39A 5EA0L 4CN1A 4XB8A 2ALAA 3L3IA 1RKRA 1MVUB 2W9LA 4KI5D 2E7LC 3WFCH 5I1AA 5DTFB 1OPGL 2CBQA 2EXYD 5F7UA 3GPEA 2EE2A 4LPUA 5IK3B 3SDXE 1BVLB 1FHGA 2Q7NA 3RWGA 4ZMOA 3QO1B 1OCOB 2AZAA 1J0JA 4OCLC 1Y1DA 2MEJB 1E65A 4PJBB 1JGLH 1NGPL 5CZRA 2B59A 5HGHA 3NFPA 4G1EA 4I77L 4N0YH 1L6XA 1U91B 5KAQF 2XZQL 1N19A 2E75C 1TOXA 3PQYE 3GINA 3E2HB 4ODTL 1TQBC 1WT5C 4BEIA 2I07B 3KBFA 1LVEA 2DLFL 4EOWH 5CKAA 4CMMA 1EHLL 2CDEA 1A6ZB 2NY1D 3QDGE 3HE6C 4LLQA 4YHIA 3IB4A 3K2MC 4JL2A 4BKSC 3MTRA 4TNGA 4PU2A 1U8HB 3QW9A 4G7YH 3VWJD 3WGVB 3Q05A 1TLMA 5MI0B 4Z8FL 4Q9RL 1OGAB 4D0CA 3WFBH 2QHLA 4XPGH 4BFOA 5LWYL 2UWEA 2HRPL 4L4JA 4OGAC 4IOIB 1FZKB 4KTEL 5IMKB 3H4HA 2X38A 2RH0A 3CLFL 3QR1A 4Y89A 3U4EA 4A7GF 5IFHL 1R5VB 2A83A 1LK3H 4B9YA 4EIGB 3L54A 1IGJA 4LGPB 3WD5L 1RURH 2KYIA 4MWFB 8CGTA 5IQ9B 2MPAH 4Q9BA 2O6EA 3HJ0A 4Z5RA 4Q6YA 1CGVA 3NCCB 2CR0A 1DQML 5A2CA 1K4CA 4CNIB 1JDCA 3I75A 4L1TA 5DK2A 4BSVA 2HKHL 3OX8B 1WD8A 3EFOB 4UQEA 4XH2B 3WUWB 1I3UA 5I17A 1ET5A 1RLBA 3RAJH 5J3HD 4L4TE 4QIRA 5GRJH 3HBQA 5A6LA 2MOGA 4DP5X 4KOBA 4XXDB 4Z77A 3N06B 3O3EB 1FL6B 5DEFA 4LAQH 2J4WL 2WBXA 3CQQA 2BNUB 5D70H 2TSAA 5I9QB 5FKAA 1Q9LB 1GGBL 3EYFA 4BD4A 4C55A 1LE9B 1DVQA 5E7FA 5KVEL 4ZX5A 3T04D 3PAVA 3Q2WA 2FH6A 3IJEB 1T1YB 4QRPA 3MGOB 1XEUA 4OF8A 3N0AA 5DJ8B 4AGQA 3BKYH 4JM2C 3WGUB 1QQDB 2P5WD 3V8CA 1F1DA 1T5KA 2ZJSL 3GIZL 1EMTH 1ODUA 4LF3B 5DUMH 1A4JB 2VM9A 3HLAB 4HWUA 3IFNH 1KYOJ 3QVAA 3NUKA 4KUZL 2CAKA 2WLLA 1LMKA 1U4EA 4PS4H 1D5RA 3T4AA 1AD9B 4L4TB 5C0BB 2A7BA 2EINB 5EU3A 4XO9A 3AY2A 5E6RB 2WLIB 3OKYA 4MNHB 3SE3A 1AZBA 1FZMB 4JQVC 1UFGA 5CP3A 4URTB 3MJ7B 3QUZA 4AMKL 3MNWB 5DZNA 2YJQA 4G59C 5FW6A 1T0PB 2BM3A 4W9HC 5AKRA 4JQXA 4JPVH 2RALA 3G08A 1RZKL 2QPSA 4H20L 3G6JA 5BVPL 1G7LA 5B1KA 3MLWH 3D39D 3OC8A 3VXPA 3DVNB 1A6VL 3COOA 1SJHB 1TQWA 4JPWL 1LEKA 4H25A 3VXQA 3S0PA 4CVZA 5IOKA 1DQTA 2YPVH 3BPOB 3VD9A 4OLZH 5BO1H 5CEZD 3QP3A 1I7TA 3FH8A 2WXFA 4U3XA 4PWKA 3BESR 2MSPA 1H8NA 3QQ3B 2X4UB 1TTAA 2EDRA 1FFNB 2H1XA 2B39A 4HWZB 5EU6E 4YFDB 1S7RB 3FO0H 3O0LA 3I6LD 4TN9A 4G72B 4F3FA 2XN9D 4BA0A 2RFXA 3B2MA 5L2KA 1AC6A 4AM0B 3PGDA 3A24A 4OLUL 3L8QA 4WW1B 4FCAA 1P7KB 3DSFL 4JJOA 3TBWB 2BY0A 3PHOB 3CSYA 1Y07A 3TA4D 5LKNA 5IJKC 4JAMA 3HG2A 3V0DA 1ACYH 2QT6A 5C0FB 3N9GH 2N7SA 2F08A 4GKOA 2KC0A 2R4RL 3BP5A 4R96A 4NPJA 1BD2D 3VXUB 5JOFB 3ARVA 3UTPE 3P9WB 3FTGA 1MHCB 2AQ3A 1E2ZA 2UZPA 4JQIH 2VZTA 2IH3B 4D0BB 2WXMA 3UABA 1HEZB 2OMVA 4IS6A 4B97A 1Z3GL 1FP5A 4O58L 5T1KD 4NPYB 3FU8A 3QC5X 1EHXA 3F7YA 2N0KA 4OSUL 1TPXB 2ICWA 1AIZA 1RJLB 3K8KA 2XACC 4PWHA 1ZK9A 3VFNA 3E6HA 35C8H 5D71H 1MWAB 3QDJA 1E2WA 2QV2A 3MR9B 1OTSD 1CGYA 1C5BH 1W8OA 2HG5B 2H1PH 2QGDA 2XV2A 3FUNA 1HCVA 2GYSA 2W94A 4JKNA 4XC1L 5CIPA 4YXKL 2B2XL 3UZQA 3ZN6A 2HRHA 1U95B 3MLRH 3U0WH 2FNWA 3G5VA 2BC4A 2ZOTA 4OZFH 3UP1A 2B15A 4NNXB 4X4XA 1U93B 5B39G 3SKNA 3QUYA 4MA8H 3MFFA 3ROOA 1VZHA 4OAWB 4Y4FB 4YWGH 4Y19E 2YPVA 1ZTXL 4G6JL 3BKJL 4RDQF 1UD8A 1DL7H 1A22B 5BZDB 2VDNB 4TS6A 1NL0H 3DBXB 2DF3A 5K33A 5F9JA 3QIBC 5ACZB 3LEVL 4HUWB 3LEVH 2YQGA 1TJXA 5DYFA 3DTUB 4M7ZB 2KZKA 3LJ3A 3Q2VA 4MNGE 4N6RA 5D1XE 4ZS6C 5C07B 2M1KA 1T3FA 3Q5TA 5CP3H 2BNUA 4TPRL 2YC1B 4PV1C 3FJTA 3AS3A 4IU3B 5HJGA 3THML 5DS8B 2NNAB 1RSFA 5B1BB 1CE1H 3WLBB 4KVPA 4X6DB 4NPKA 4K7PH 3U0PA 2BH0A 5EZLB 1F00I 1SPDA 3MLRL 5KZCB 1WHPA 2CLVA 3BZEB 3B7TA 1J05A 2XXCB 4D0BA 1PG7L 3WIIL 2A9ML 3EFOA 1S5HA 1G0YR 5ANMB 1CICC 4FQ2L 4OQ1A 1USQA 3LDBB 1B0WA 1ETA1 1P4BL 4PY8I 3EOBB 4TLUA 2FX7H 4JGUA 2JCCE 2GVYA 1JFHA 5JPMA 3ULVL 2OZ4A 1MZYA 1U33A 1PZBA 4MJIB 2HPTA 3WJJA 1OD9A 1BVNP 3FQRA 5AOMA 5HDRA 5D7JA 3I9GL 1R5VA 3S3SA 4JO8A 1IM9B 3X14B 1MRFL 4KO6A 4HX1A 4MXVE 4PJ7B 2Q3XA 4G6JH 1Z3GH 3NA9L 4OIFA 5AW4B 3O6LL 2OULB 1K8IA 5EFIA 3C87A 5FW7A 4WNSA 4F1SA 5JPNC 3IMSA 3FT2B 2PXYB 2RD0A 1QKZH 4ZT1A 5C0IA 5CUSH 1XIWC 2OXGB 5AW2B 3TBSA 1CFQA 2WLIA 1C5DB 4I5BB 4XC3H 2XPGA 4J4PD 4AGPA 2R56H 3OLGA 2IDSA 3MCKA 1V3MA 1A6ZA 4R5TA 3T4AB 2CLRA 1AZNA 3NIFB 3UZVA 1T7WA 5JHDA 2H8PA 1Q8MA 1BOGB 3RDJA 2NX5A 1YN7B 3JWNC 4O02A 1QQDA 2DQJH 1QRKA 4P5KA 4HSQA 3TCTA 3DX2A 1SYSB 4NFCA 4BFEA 1D9KD 2IWGA 1RZ7H 4PBWD 2IF7A 4HKZB 1OQXA 9CGTA 4IBWA 2PTVA 4A2GA 4FKHA 3MBWB 4FHJA 3UO1H 2ISDA 4DW2L 1TZGL 4G7QB 1BD2E 5E7BA 5IK3A 3C12A 1QTYT 5KSAA 4H2CA 3VGGA 4J2XA 4JM2B 3RA7H 3VXSE 6PCYA 1VPOL 2ZOUA 2HMID 2QFRA 4DGUA 4ODUB 2X4NA 1U8JA 2O5XH 1SF5A 1S9VB 2LAAA 3L1OH 5SWSB 5K9QI 4XP4L 4FG4A 5JZ7C 2XRAL 4EVNA 4XH2A 1RUPL 2FSEA 2QQKH 1JV2B 2BVUA 4LPVA 4CW1A 2L7QA 3K46A 2ZOKB 3F7KA 4HWBA 4JGMA 3LRMA 5ESQA 3ZTCC 3WYRA 1Z5LA 4A38A 5C0CD 5FFGA 5E6ZA 4N8CH 5IV2A 1EWHA 4IW4C 4QXVA 5J7CC 2CSPA 5CEYA 4G70B 3LZPA 1NDGA 3IBEA 2BOBA 3Q1SL 2W65B 3MUJA 1DQDL 4P2QE 1J86A 1E9PB 3OPUA 3GSWA 4YHML 5IQ7L 3B9AA 2GT9B 1A6VH 3FFCE 5ID1B 4HUXB 4N8PA 4YXHL 4BRJA 4DOHE 4LKCB 3MRJB 4FFZA 3EFFA 1PFOA 2YGVA 1FZJB 5GPRA 5GRUL 5H37H 3MLZL 3WI9A 3TIDA 2Z92B 2D7OA 2R29H 4XGZB 3D0VB 2FYYB 3U4EB 5HDWA 4HPOH 3TYFA 4G82A 4R90L 1UCBL 4NN6B 2A1WL 4JE4B 1K4DA 3IJSA 2QQNL 4FYTA 4NOBA 3AU0A 1E8XA 4WEUD 4JREB 3OHXC 3QXAA 2V3EA 1J8HB 4HWEL 4JRYE 4AZUA 5F7DB 3FQUA 2DB8A 1NFIB 3N2JA 1JPGB 1A7OH 1OCCB 3IU4H 3IAPA 3OJ2C 3TONA 3S7GA 4HKBB 4NO3A 2CHWA 2VDQL 3IFOB 3S88L 3VI4E 3D39B 1RD6A 3CLFH 1CXLA 4S11A 4FNQA 1WA2X 4E9SA 1HHKB 2ZICA 1UADC 3FCUB 4MD5B 3ZK0A 4QI3A 4IRZL 4BDVB 5KSBE 2PYEE 4ODSH 1GYAA 4MASA 2VC2L 5EO0A 2KL6A 2X4OB 3TBTA 1IRAY 4FQJH 4OBRA 1J8KA 4N2CA 1BVLA 3FAWA 4JRYA 2OL3L 2D9QB 2Y1VA 1XDTT 5F96H 3CK0L 3RIAK 2F5AH 5KSBB 1JJUA 5DQ9B 1DJXA 3VFVA 4QHLB 2J56A 4NFDA 1AR1D 3GXTA 3C9NB 4HT1L 4H8QA 2OTUB 3DYMA 1FHNA 2VQ1A 4G7VH 2J2ZA 4TSAL 4KI1A 4YDJA 5DVMA 3UIZA 1A4BA 2QKIA 4CVWA 4F15C 3HC4L 1UWGL 2VZSA 1RV6X 3TT1H 3OR7B 2IH1B 3K6FA 5I8CA 5JTWA 1LMIA 4F8LA 5F7YC 3DX9B 2VSMB 2WXJA 4DGVH 2X89A 3PWUB 1JF5A 4QHPA 4P2OB 3MMEA 1BGXH 5I0DA 4P3CL 3QEGL 5I19H 1ZHKB 1DUYA 4P2CG 3SCMC 3GMPA 4G7YL 1W15A 2AFNA 5DZVA 3ARZA 1GS7A 3B7UX 3VGBA 1H6FA 3FRUA 3RTQA 2GC7C 2NY0B 3K4AA 1LP9A 1PQZB 4JEGB 1IM3D 3D09A 2JJVA 4UMSA 1XF5A 4TNWK 5KVDE 5IW6B 1VF5C 1XCTA 3GC3A 5FYLE 4QHNB 5BZWA 3EF7A 2A77L 3LB6D 3O8XC 2EYSB 3AS0A 5FO2A 2WNXA 4ALAH 1R0AL 2XZQH 1OGAE 3VXRB 4ZUVB 1R5WA 1QWUA 3NFSL 2OCFD 2AK4E 2H0EA 1OO2A 3C6LD 3QUKA 4DH2A 4G43A 5EF0A 4JMXA 3X1BA 2YKKA 3HG1B 4GJTB 4WW2A 2A6IA 3DOSB 3HG4A 3WKYA 2E0PA 3QIWA 4X6BA 3S4SG 3NIGB 4GMSL 1OT4A 2HLAA 1D5XA 3KPRD 4S1SL 4YLCA 3WO4B 2QJDA 1AXTL 4JZJB 2WV3A 4ATWA 3ETSA 3NZ8B 4YDLC 2J8UE 5DHMC 3ZRFC 2KZ1B 1E4XL 1QEWB 2XDHA 2VQ1B 3O6FB 3WFZA 4HHGA 1T66C 2RHEA 5CS7A 5IGXH 4XBGB 2Y7NA 3KWXA 2CO7B 5I1IH 1AJ7H 2MRYA 2W1NA 3JV4A 1HL8A 4MX7A 4FJZA 5DD5L 3CC1A 3LY6A 2VIRA 3QCUH 3ELQA 3WIFB 1PG7W 2X6BA 3ETBF 3I50H 4LFHG 1HHIA 3IVKA 3WHXA 4WFFE 1Z5LB 1MDTA 1Q72H 2NY5C 3DI2B 2F0CA 2IQ9L 4XE0A 5LBSH 3JVFC 4MBRA 1ZT7A 1JUFB 2ZOKA 3QZWG 1ETZA 1EEQA 5SWSD 4X6DE 4N2LA 1E9OA 1UT1A 1FI8C 2X70A 3GM8A 5FAAA 1GH7A 4XNZC 4BQ8A 2Y1YA 1U58A 2VLKD 1IGML 1S9YB 3WNJA 2V2TB 1CDGA 1D7DA 1H3UA 1OF0A 1INQB 4BM7A 3L81A 2WWNA 3MJ6A 3T6QC 4U1SA 1UTDA 3IF1B 5TQ2H 3LOWA 4FDWA 5BRZA 1OGPA 2BVOB 3U9UB 1PZ2A 3LN5B 4N2FA 3QXAB 4NM4L 4PRBA 1TQUA 4NKOA 5IHBA 1JZ6A 3QARA 4FL4C 1AANA 4HAKA 3WJMB 5CR8A 3U9PH 3ABGA 2YPLA 4HUKB 1I3RB 3VFMA 4M6ML 2OCJA 4NZTL 3B2VL 4MJJA 3PJSA 4Z7NF 2L4OA 5FYKL 5C6WH 3QQNA 2Z7WA 1HSAB 2J1ZA 3A5VA 5JHDB 3DX3A 3QULA 3AWFA 4R9HA 1OOAA 4YXLH 2WO4A 2CLRB 3TWYA 1W16A 1G84A 2VDRB 5BS0D 1BPVA 1EZLA 3ZHDA 1TO5A 2EJ1A 4AL8H 4MDJA 4F7MA 2HMIC 3KPQB 2OFQA 1KTLB 3FT4B 1DBML 1LEGA 3OKEA 3PV6B 4X6CA 1GJWA 3GBNH 4P49A 3IDJA 1T2XA 3OJMB 4M6OH 1KCLA 3BKMH 4PTTB 1JG9A 5CINL 6PAZA 5J12C 4FTVE 5FYJH 5EOCH 4LCVA 1F45A 1ORSA 5GZNC 4EUPB 5B38G 4KUCF 2BHUA 4NDMB 5C0GA 2HVBA 5IV2B 2XSKA 4GO9A 3OLEA 3HOGA 4HGKC 2EIEA 4DUVA 4NQTA 4R2GC 5C07E 3VMNA 4WWID 3U6RB 4X8JA 5GGVL 2OJEB 1JWMB 1SHWA 2P4AB 1GZHA 1MCLA 1FNFA 3IDXL 3Q8EA 4JDZB 1Z66A 2F74A 4KROB 5FCUL 4MJ2A 2EAEA 2MTAA 1KYFA 2ZXDA 2R7EA 3Q9QA 1ID2A 3DJZA 4JDTL 5D2NB 2JKWA 4NEHB 3U1SL 2X1XR 2W38A 4D0DB 5C9JB 3QJQB 4NP9A 2K7PA 4NSKA 1B3JA 5DJYA 3FRPG 4YAQA 3RHWF 4QF1A 2O5XL 2WJ7A 2NPLX 5C0CB 3HCVB 1T1ZA 3DIVA 3LB6C 4RMBA 3RGVB 4EDWH 5C0JA 3UTSE 3V9EA 1FG2A 1KIQA 1MCPH 1NEZG 3IPBA 4PJ8D 4MMZC 3FQWB 4GT7A 5DFWH 2X40A 5H35B 3D0LA 2EIZA 3E38A 5E2TH 3DUUA 4UINH 5FC9A 4AYFB 2VOTA 3N41B 3H85A 4IGBB 2DQIH 3LZRA 1T1WB 2CKBH 4YK4B 3MFGB 4BH7B 4AIXA 1UUNA 2IG2L 1RPUA 2W9DH 2Z9TA 4PIBA 4X4MA 3QI9A 4AKQA 5EIIA 5AVVB 4A6YB 3VW3H 2XA3A 3HRZC 3ZKXC 1JOIA 1KCVH 4M29A 3FTSA 4X4XB 1RERA 3IXAA 3AMKA 2BFVH 4P2OD 3V4VL 3VD2A 4AYEC 4M8RA 1J18A 3C8KA 1Q9WB 4OCYH 5D7HA 4XC3L 5GS1B 5L4FA 5HDLA 3U2SB 3L3DB 3EXJA 1F1AA 3UMTA 4HUNB 4G9FD 1MRCH 2P5WA 4NAJA 5I73B 2HUEA 2A6JB 1RVFH 4OZGE 1U8CA 4NO5B 4CADB 4UU9B 3RUGA 2Q8BL 3I3EA 3VWKB 1WBXB 1SN0A 2BMKB 3SQRA 2R4SH 5LDUA 1ILSA 1V7MH 2Z1PA 4LCWD 4I4WA 2Y36H 2CGRH 5C0RH 3HRPA 4PB0L 2IXQA 4XN4A 4A04A 4CMHC 3F7LA 2V5TA 1VLXA 5CGBA 1O6VA 1SXAA 2W9DL 1OAYL 3C6LB 3CQFA 3O2DL 4UTCA 5D72H 5LQBH 1YMMD 2FX7L 2BSCA 3BDXA 3BGMA 2V8LA 2G9KA 5JNYA 5K9JL 5KZCD 3DO7A 2C1OA 3BUDA 1L9QA 4BRVA 4HJGB 4F2ME 4B3VA 1AE6H 5K59E 1MREH 5EZLA 4HJTA 2FSDA 4XPAL 2LHAA 1KJ3H 1ORQA 5CGYD 5C0FA 2VERN 3SZKC 3BGAA 3AROA 2NLJB 1MWAL 5C3IA 4GQ9L 4LASL 3RVVD 4YHOH 1UB5A 3MSPA 5DD0L 3CN2A 2AXFB 4DP6X 4YHKL 3TBYB 2AQPA 2O93L 1UEYA 3KVDD 1ZLSH 3IN0A 4XPBL 3LVEA 4KXBA 3K5SA 4GKZB 4X5XA 3KAAA 5BUAA 5F9OL 3MKKA 3QISA 1J0ZA 1A02N 1J1XL 1U2HA 3OGCB 5D9SA 1YYLH 2EIKB 3ZE2E 5AW6B 4J7RA 4WY7H 4URKA 2MNUA 1I1AA 1B9ZA 1BZQK 4XNUL 2VDNL 4F58L 2IPUK 2WTRA 5C2BH 1DZ0A 4YEEA 3P0GB 4ZPVA 3EOTH 2FD6L 3NSJA 2BVQA 1O0VA 1ZGLA 4G6MH 1JMXA 4HBCL 2B5IC 2HG5A 3VXMB 2QGCA 3D7PA 3Q6FB 1M7DA 5EU7E 5L88H 3WUZA 4RMSA 5CO1A 3UAAA 2EDFA 4NUMA 2C9VA 3D33A 1CQKA 1UGKA 3PV7A 5HDOA 1WG3A 2XN2A 3F6JA 1QNZL 2P8LA 4PQXA 2G3NA 3EOAB 1FAKT 2B4CH 1QX1A 3L4ZA 1AD9A 1N7ML 2D31A 1YDPB 3DV4A 1ULVA 3BX7C 4DP8X 1HHGB 2ITDB 3O3AA 4YXLL 3PNWA 4O9HH 5JA8B 2GSGB 3W57A 1HEZA 4I3RL 1XQ4A 3QCTL 4Z7UB 4AMXA 4O2FB 4HGMA 2UYLB 3CJJA 3S3JA 4G6AC 2NZ9D 3MRCB 4ZYKB 5AALA 5SX4I 1KTKE 4YFLF 3V5KB 1YHPA 4Y1SA 4P5RA 4U6VL 2H6PA 3UAJD 1U92B 1RHHB 5E6YA 3T8VA 3N9GL 3HG5A 4PJCE 2WQSA 3PHOA 4PWIA 3CHXA 3NABH 4F2EA 4BFBD 2XXMB 3EYVB 3NIDF 3RWIA 5ESVA 4PMEA 3JZ7A 4BK5A 5AYUH 2PWFA 1P9MA 2CIIA 1W2KT 4HXBL 1DQJB 2CPCA 3SGKA 3MLSH 5ALCH 4XXCA 3K8MA 4G80A 2D4FA 1YECL 2CQVA 4Q89A 3D34A 4KKBC 1PLGH 4X9IA 3ZKSD 5I9QC 5K9KB 3FO2A 5AYQA 3HR5B 1U8MA 1WICA 1IAII 2VDKL 2E9BA 4FQLH 4S1DD 2DWXA 3P69A 3MA9L 4J28A 4P2QA 3T4YA 4AVIA 1QSFE 2WOBA 1E7VA 1A14L 1QI4A 1L9SA 5AOLA 4IRSB 3OD3A 5IMLA 3LZOA 4EDXA 4JRXA 5J1AB 2FQFA 1JHKH 2WM0A 2WUBH 3RL2B 3SO3B 4DCQA 3EO9H 2HVKA 4KPHL 3G5XB 4NUJB 3L3KB 1YEJL 3ESVF 5EEUA 4N2AA 3EH4B 5IR1A 2W0FB 1BG9A 3HS0C 1TTGA 1ET8A 1OGAA 2XYCA 2CRMA 5J3HC 4NQED 2AV1B 4ES9A 5JQ6H 2WP3O 1GJUA 4JNXA 1JYNA 3FU6A 1AZRA 3N50A 4LHUA 4KZDL 1OAUH 1EEYB 1UJ3C 4IMLB 3S4SA 2ZWNA 3MLUH 4GKNA 1YO4A 3CFTA 4M7JH 1NC4D 3VXSB 1W72L 4JY6B 1EO7A 1S46A 2NCEA 5CN3A 3KPSA 4QXGL 4NENA 4I18A 3MODH 1PKQE 3GZQA 3SDXF 4R26H 1VFOA 5GS1A 3DMMB 1JXFA 4R83A 3VAEA 1KGJA 4BWTA 5HYIA 3VFSB 5DJ8A 4WGVB 3V10A 2ZUXA 3TA3C 1NMCB 3FQXB 3BP4B 3PHAA 2KQMA 4I0PC 4QOKA 4WU5A 2ZSWB 3K71B 2EXWC 4PRBB 4XRCA 4H4NA 1W6LA 2FR4A 4DEWA 3EOYG 5DS2A 1NLDL 1C16A 3VGFA 2WZ0A 5DD6B 3C09C 5KSVB 3N1QC 3TURA 5DRZA 2YWYA 4KZ0A 2I7SA 1DBJL 2ETWA 4LSPL 4ANVA 1O75A 2CD0A 4AYFA 2FT6A 4KUCD 3W39A 4K5NA 1A7QH 1JFQL 3HPJA 4J1UA 5D6CA 4DIXA 4DERA 1KPVA 2K45A 3KPOB 2BY1A 2UX6A 1ECYA 1ZTXH 5E94B 4LEXH 4TUOB 5D2NC 5DD0H 4B50A 4BYHA 5A16B 1KIQB 2NUPB 5IP4A 3NJKA 3GUTA 4HJEA 3CFIC 1DO6A 4HG4J 1XBDA 4HOXA 4ZMQA 4PRHB 2ZXQA 2MQ0A 3P40A 2BP0B 4WSJA 3I02A 4KRLB 7TAAA 1C08B 2C1PB 3GM0A 4G42A 5C8JA 1W0YT 1JDAA 4OZ4A 4ONHA 3MV9B 1G7JB 5GISL 4TVSa 2W88A 1RIUH 2XG5A 3T8XA 2EDBA 4XVUD 1INDH 4WAFA 4JY5H 3ZHLA 4F2FA 1D5IH 4OLVL 4KK9D 3F6LA 5I1EH 1YNLH 1TQCB 3Q3GA 3QHZH 4H5SA 4Y9CA 5IY5B 1QBLH 2D03H 2MFNA 1PX4A 2B16A 3FCBA 3EF4A 4E0RA 1BZ7B 4YMPA 4X9HA 1G7HB 1MEXL 2OSLA 1ZLUH 4Z3GA 1KJ2B 4XMVA 3DJRA 5KG9A 2P1YA 1OE2A 2X41A 3GSNB 1CFBA 2B14A 4G6KL 3QUKB 4JB9L 5J6HB 3QFJE 4R0LC 2A2QT 3GBLA 3AABA 4UAHA 3FTUA 3K6OA 3L17A 4YR6A 5LAPA 4GI8A 3D3VD 1XL4A 1KWKA 4EQ2A 1U3NA 1GS6X 4MCNA 1B2WH 1T6WA 1AQHA 3SSGA 1IGTA 1HI6B 1F56A 2VDOB 4JFOB 4J3TA 2HFEA 3REWB 4JMNA 5A2JH 3II3A 1BV8A 4XN7A 3VX0A 1R3LB 2XN1A 4R90H 2V2XB 4HPYH 3RTQB 4HPOL 1XGYL 4AH2A 4GW1A 1A7QL 1JFQH 4XNDA 1TFPA 3FQYA 4APQA 1AKJD 4AV0A 2HH0L 1YVLA 4XNXL 1JYXA 3RJQB 3ZSTA 3O4LE 4HXAH 1AS8A 2APWA 1H3GA 1MFDL 3FQ4A 3FZUD 1GHFH 2VDPL 3GMOB 1T22A 3RU8H 3WEXB 4HPHA 4R97B 4R3SB 3ISYA 5E9DA 1RZIB 4JFFD 1NGWA 2VLMD 3DHPA 1QO3A 3MROA 4XAKE 1YEFL 5L0QB 3FBKA 3WNPA 3HZYB 3V4PA 3DPDA 1BBJA 1GKOA 4HDIB 2NY3B 4KY1L 5EO1A 3C9NA 3L2NA 5FA4A 1H5BB 5K39A 5I1LA 2HJLB 2JWYA 3REVA 1TTCA 3IDXH 4NQXA 3ZJAA 2YMXH 3BXNA 4HK3N 3SDDA 1SVBA 5GGRY 1FO0H 1EIBA 3N40P 5L7XL 1JGDB 1JNJA 3FOMA 1KTRL 2HUHA 4MA3B 1EAPA 2JJUA 4PGEB 1HOCB 4JHZA 1HHIB 5HDBB 4MZ3A 2ZYRA 4MNQA 4QR7A 1CD1A 1FPTH 1N2RA 2DPKA 4M61A 5JIHA 2DJSA 3JV4B 4X0KA 4Y5YC 5FPIA 1PVHA 1BJ8A 1MAJA 1YPZF 2MIZA 3I2CH 1E5YA 1PZ5B 1DANT 4OM0L 1MVFA 4PVMA 5DVOA 1XGZA 5LXGH 2D7TH 1UASA 2CO6A 4U6YB 3ASNB 3UTTA 1ACXA 3ZUCA 2WZAA 3HJEA 3OMAB 2OMWA 3INUL 1W0VA 2K9UA 4QXUH 5K5YA 4FKEA 4JZJA 5JIPA 1NBCA 2Y06L 3FN0H 1HINL 1AIFA 3SQBA 4ZNEA 3W0WE 2P49B 5DRWA 1ID5I 2YK1L 4TSBH 1O7SA 2AJYL 1SOXA 5A2FA 3IPFA 5D7LB 5IHZB 3W2DL 3SJVB 4Z7WA 5AVRB 4APQB 1KBGL 4ZDHA 3F85A 5T1DL 1RULL 4JFYA 2DQJL 2WVVB 4ESKA 5FIEA 5TK2A 5JMOC 3TEYA 2AAVA 1NIDA 5IJVA 1RZGB 3GXUB 2DZEA 4FFVC 5J1TC 1L9RA 3VI4B 5IEKA 2ENPA 3IDUA 4PB9H 3D0VA 3W11C 3EZ8A 5AZUA 4UMGA 1A21A 1SYVA 2VABA 3B3IA 3C08L 2Y9RT 3ZBMA 3FHQA 1AXSB 5HHNB 3FU7A 3FRUB 3LS4H 4OH2A 3QAQA 6CGTA 2Y5EA 3ZVVA 2ATPB 3P9LA 4PGZA 4RAVA 1HOEA 1NKGA 4WKXA 4TSCL 5T1JA 3SKMB 1E28A 4G5ZH 1UACH 2VDLH 1WE5A 2Q2EB 3FQ2A 4YSDA 3QEQD 4G8FB 2IIJA 2H3NB 4X0KB 5KS9F 1UH4A 4KKCC 4UM9D 4Q9RH 3BQUB 4PUBL 3BEVA 4RAHA 3QDMA 1CC3A 2A74C 2K6YA 1JZEA 4MNQB 5I6MA 3ZDYB 4JFVA 2WWKO 1AACA 2J2ZB 5C0CE 1I7ZA 3PY9A 4AJWA 5MHSD 1HZHH 3MCG1 4NKDA 3LHPL 4P06A 2KZBA 3HAEB 4I48A 4AW4A 3KS0H 2L0DA 3T77A 2ZF9A 1UEMA 4G7SB 4ODWB 3JWNG 2V7HB 2W0LA 2VDQB 2NQCA 3ULVF 3OF6D 3I02B 4Q0XH 1BOYA 4U3SA 2XA8L 3C5ZC 3QNXB 4ZUTB 4HUMB 5TE4H 5I1HH 3GXPA 1SXBA 2GJRA 2DS4A 4K7PX 1AHKA 5EHFA 3ZPDA 3GSXB 3QXTA 1JPEA 2WUCH 5D5MF 5HDBE 4TPRH 1L5GA 4GMSH 5E5UB 2BNRB 3C09B 3SDCC 4MD5A 4UQ2B 1UCTA 1G9MC 1TCRB 2E8ZA 3KPOA 3Q0HA 1BXAA 2YUVA 1GGIL 1H0DB 4XP6L 1QASA 1NGQL 1PYWA 2YLHA 2OL3B 3MLVL 1UFUA 3CX5K 3MYZA 1JZFA 3P3TA 4LCYA 5E95B 4YLQT 5DRZB 4MVBD 2QGBA 4D7PA 2W9EH 1LWJA 4PJGA 4AE0A 5IWLC 2CJTA 1GJIA 2X4SB 2GIYA 3CV5A 1MAMH 3DGGB 4TNWF 2KLRA 4P59H 2NR6A 2WTPA 1AAJA 4X4YA 3D51A 2DEYX 3V5HA 5C6TH 4XRCB 4Z76A 1P53A 1AQDA 4XAWH 4AI7A 3TA3A 1YC7A 4IHOA 3IGAB 2I25N 1JTOA 2CHZA 2YA2A 3TOPA 2VDMH 2E74C 4ABWA 5EWIH 1MCDA 1SFHA 3MBED 3HAEG 3GZKA 4X5RA 1O5PA 3L3GB 5C0NC 4WTZA 3B7YA 1MRDL 1OAXL 2AABH 3IRPX 4JG1L 1IC5H 3SJVE 1YEGL 2Y2WA 2VXQL 4WWKA 5D7SL 2FATL 1G7HA 1OE3A 3HZVA 4XBPA 1BZ7A 5ITBL 1QR4A 3SPVB 5FDWA 2VLLA 1W6WA 4GIPD 4JN2B 4QRBA 2X2HA 5IHUH 1OTTD 3WJLA 1QLFA 4HD5A 4JPIA 7FABL 4L8CB 1LDPH 4PJIA 2VMFA 3TEWA 3CG8A 5D7JB 4PW9A 5D1ZD 1YN6A 4X42A 1DLHA 1ZRUA 3WUWG 2CM5A 3CXHJ 1CGTA 1KB5L 1KCKA 2J5WA 43C9B 1R33A 1MCBA 3T8XB 1G6RB 4DUXA 1SQ2N 4RA3A 2X88A 1AQKH 1FIGL 2PP8A 4WKZA 5F9WC 1I8KA 3X1GA 4NS0A 1AGEB 4P04A 4A1RA 3BP7B 2PKDA 3V79C 1NJ9A 3QG6A 3VB8A 3RVTC 4PJEA 2IBZY 4ZOCA 1LO3L 4YL4A 5IB3B 4ZW5A 2H32A 2UY7A 2V9QA 5I8EB 1JPTL 1O9WA 1JK8A 1XF1A 1JGIA 4OF5A 1A7RL 4ODSL 5C08D 3FPXA 2VLKE 4ZMLA 1BREA 4N2GA 1DVSA 2YZ1A 3BVWA 3MGTA 3OMIB 3VMOA 2W60B 1YEDB 2FJSA 3SDDD 1FVEB 1I53A 3P02A 4QT5B 3W39B 1TEFA 4GG8B 4PJ9A 4S1RH 2WZPD 3NZSA 2X1PA 1FYTD 5DVKA 4P4KB 1IKNC 1OSPL 1UD6A 2F19H 4MCZB 3P3YA 3TN0C 5BZDA 4U05A 2H26A 3QRGH 1QPXA 3QUHA 3RWJB 5C0BE 5JW4M 3L3OB 3H2QA 5E9DD 4M7KH 4MA7L 4L9LA 4ETQA 2YD2A 2O61A 1VZGA 2VO5A 1UCBH 3HC3H 3ZKNC 1KGCE 3QQXA 1IBGL 3UJTH 2R69A 1U95A 2CCVA 1OP5H 1PSKH 2ENSA 5L4JA 1PZUB 4NHCL 4QKTA 2AVGA 4PRPA 5AOIA 4ENEC 1FFOA 3P1VA 4H20H 1URLA 1FVDA 3BVXA 1YEHH 4IRJD 1ESOA 4QRRB 2JELH 1T20A 3LXCA 4ZSOE 1ZLVH 4EI0A 3S48A 3K6NA 3H9HB 5F89B 3SJVD 4WU7B 4PJAA 1QBAA 3U2JA 3WNOA 4TOYH 2XWTA 1QR1B 2ZCLH 4RAUB 5GZND 2BNQD 2BZCA 5K9OB 4GSXA 2FJGB 5C9KA 3CMOL 5I66A 3D3VA 1OTUD 4BFKA 1HWHB 3HPLB 4M7KL 2DJUA 2GQHA 1O7VA 3MREB 5F1IB 3UZEC 5DDHB 4C83A 1MFMA 5DUBB 4EXPX 4PG9A 4HCFA 4RX4D 1VJSA 3RJDA 1L3WA 1X5MA 2BVQB 5F21B 2XQ0A 3BKYL 4CU8A 4ODVL 3TFBA 1BF8A 4K3JL 5FB8A 4KNQA 1CTMA 3QDGD 3X3GL 3CZNA 3FU5A 3LV3A 3SKOA 2GITA 3CGTA 1CLYH 3E8UH 5BMFL 4L48A 3R8BB 2P43B 1CFNB 1DFXA 2LOEA 4JFFB 4JZNA 2V0AA 4L29B 4AC4A 1JNHB 3FSZA 2QQLL 3SIKA 2HT4C 2Q8AL 1MLCB 2P7TA 3UTZA 4JKPH 3V5DB 2A9CA 2Z8WC 4YUEH 1WJ3A 4Q58C 4LOEA 2OSYA 3F6IA 2E4FA 1MJUH 3UADA 1KLGB 3EJZD 5F6IC 3IDNA 3VO0A 5C0DB 5T3ZE 3O6FC 5AKSA 2E4TA 4YHOL 1KT2B 5CU9A 5DFAA 3EZJB 5EOQL 4YNYA 1Z9PA 3APDA 3C60D 2X1WL 5PCYA 2VW7A 3GMMA 3QQ3A 3U9WA 5KBPA 3ZDXB 3BRFA 3WNIA 4DEPB 5D5ME 4NO2B 3EBAA 3QIUD 4PJDE 3NAAL 4AGOA 2DQFB 1AH1A 1JCVA 4JO5A 2LVCA 1LEKB 1SJHA 4HJGA 3VXQB 3F7VA 1FVDB 1BECA 2G3MA 3C8DA 4XPFH 1GCFA 1ZEAH 1RMFL 1R3HA 1VRSA 2FGZA 4PG9B 4M56A 3MJ8B 1A4AA 3ILDA 5I6XB 5IT2H 3PWPB 1JSYA 1KGCD 5TDPB 4ZO7A 3D3VB 5DD3H 5IVXA 2N3JA 1V7ML 2GIXA 5IKCB 2UZYB 4D9LH 4M5YL 5BZZA 1KB5B 4ZX4A 1HNGA 3WDIA 5CU5A 5T3ZH 3A4FA 3GMRA 4EIZC 1VCBC 1GRWA 5CR1A 4OLYH 1HH6B 2BP5M 2Q87A 1ZPLA 1CIDA 2E6PA 4KZEL 5GS0D 4X4ZA 4JFTA 1AFVH 4OFVA 3S5ZA 2IBBA 3EG9B 4BFNA 4UUJB 4OF3A 3KPSD 3K74B 2JH2A 2ICWB 3I9GH 3UTSB 3N1GC 2ICEA 5AZ2L 2EXSA 3BVVA 1DCEA 3FSAA 4X7CC 4FI6A 4XVSL 1HDMB 3AWGA 4ORGA 1TENA 2XBZA 3O4LB 5JIMA 1T0NA 2PLTA 2VSDA 4PRHD 4IS6B 2EYTB 5BJTA 4PCTA 1VFUA 4E42B 3ECBA 2X05A 2P80A 4MMZA 1AGFB 4U2YA 5DMGD 3BIAX 3T3MB 4BFRA 4HD9A 3O3EA 1RPKA 2XA8H 5I1HL 2XX0A 1MWOA 1T21A 5KSAB 2D4DA 2EICA 2Z4QA 3FU3A 2XWEA 2ZSVB 4G8GB 3I75B 3CCHB 3QYNA 2NLJA 3DXAD 4FFZL 1W8NA 3JBG7 4P5MB 4N86A 3VRLE 1WAAF 2KS0A 5BQDA 3TO4D 4F33B 4IGBC 5D1QA 3Q06A 4YE0A 1T2QH 3QAZB 2RACA 2HTKD 3HUJE 1DSWA 4FTVA 3BAEH 2R1WA 2YQBA 4K3DL 4UZGA 1OVZA 2EKSB 4K9EL 3EH2A 4Z0BH 2XZCL 2X4UA 2OJEA 1EHKB 3BKJH 1QRNA 3SY0A 1JXJA 4Y9BA 3KL0A 1OARH 3ARRA 3HUJB 4B27A 3WMPA 1MNNA 1U8HA 1KOAA 4MA1B 1K3ZA 1T7VA 2VRAA 3L7FB 3C2AL 5MENB 4PJAF 2BMKA 1ZHLB 3BKML 1BQHA 1PBYA 3FH5A 4PTTA 3LZFL 4Y5VC 1F4YH 4W9LC 1A7NL 4FXKC 3EAKA 1G0DA 4EO5A 4OCSL 4MB1A 2FJFB 3BP6A 1C8PA 3ZMNA 1RUAH 5HVFB 2IPTL 1HNFA 1SRDA 2HSIA 5J9PA 5E0QA 3EFDH 1L5GB 4WI0B 4UOW0 2PP7A 1AZUA 3HE6B 4L2YA 4TV3A 3GSXA 2IFGA 1SDDB 1WZ1H 3MNZB 3VYOA 1PLAA 2H32H 5EU6B 3RWGB 4PSPA 5DMKA 1HSBA 4DKAA 5BW7C 5EIIB 1CF8H 4JGJA 4ZOEA 1J1PH 4WUKH 5G55A 3RYMA 4HZ1A 5GJSH 3ATFA 2JQMA 3PJSB 2G2RA 3FH7A 3BKCH 5I5JA 2BCKB 3GGWA 4LCYB 3G6JE 1BZDA 5KBKA 1SXNA 1IQWL 3AMLA 4N1CA 1PU0A 4PYGA 1LHZA 2DDQH 3LN4B 5E2UL 4FLRA 3C08H 3MJWA 4C54A 1XGQB 2DQCL 2WIIA 1F3JB 2XTJC 3RRQA 1CJYA 4FNUA 2FCBA 1S3KH 4OFIA 2O72A 1BXVA 4BZ1L 4QRQA 5HJ3A 4GXUM 4ZUUB 5DVLA 1A3ZA 4MLIA 4FZ8L 5IESH 1G9MH 1TSRA 4DAGL 5I17B 4KC3B 5TE6H 1E28B 12E8H 3OX8A 5D7IF 2QR0B 4HW6A 3ZL1A 4UT9L 4FADA 1Q72L 3OXSA 2C26A 5HYSG 5I1KL 5B4MD 1I7ZB 4ZMXA 1IGJB 5INDB 5DMIL 1A1OA 4LDLB 1X5ZA 2RB8A 3TCLA 5JOPD 3ZTJH 1J87A 2NT0A 2JCCA 3BEWB 1TF4A 4WTXA 5DD1H 4Z1PA 2VQUA 1JPFB 4XMPL 1TTRA 1RZKH 2P3YA 1Q9OB 3CLEH 2B0SH 3FO1B 3MLXL 3PFUA 5B1JA 3O6FA 3ARUA 1E4WH 4HAFA 4HS3A 3G5ZA 1I8IA 5LNEA 1CF1A 3PWJA 4L1BA 1FL5B 5DXWA 1MCJA 3ARFD 4AQOA 2GFBA 1AQDB 5FXCH 5DYOA 1ZV9A 4S10A 4AZ8A 1YY9C 3HHMA 3RG1C 4LOUD 4EPSA 3GMLA 2BSED 4FQHB 5DO2D 1QWHA 2B77A 2R51A 3HA0A 3MYJB 4MDRA 4HHAB 3CC5B 3ILPA 3FYEB 3DX6B 4OT1H 3DVGB 3Q5YA 1MH5B 3TCLB 1BXXA 2Y7LA 3RX8A 1YAIA 1MEXH 5JHMA 5HHVL 2HTKC 3QRLA 4RFOL 1E4XI 4U1SB 2HH0H 4JPSA 1UGNA 5EIIG 2XTJD 2D73A 3NGBC 1IVLA 1AGCB 4NUQA 5I6XC 3KXFD 1WAAA 3Q1EA 2C3WA 3PUUA 1G9NH 1PY0A 1LD9B 3RAJL 3A22A 4ODWA 2W59A 1Y18A 1JDDA 3SDXA 1RIUL 2VDLB 4C4UA 3K6DA 5AVXB 1BEYL 3MOAH 1FCGA 1X7QA 1JF1B 3IMVA 5CN2A 3IFPA 1GA2A 5L6YL 5FECB 4L5FE 3KDMA 1IARB 1A3RH 1CFVL 2XT1B 1BBDL 5KYWA 4X98B 2G5UA 3VD5A 3SDDB 4P8QA 5JW3H 5DUPH 4I0CC 4HHAA 4PR5A 1K2DA 5DLML 3V52H 4GW1B 4AYSA 3BH9A 4FQHA 3G6DL 1NCDL 4ZMZA 1AY1L 2J6EL 1WFJA 2R2EA 3SHSA 4JM2F 2X53A 4LSPH 3NBNA 4GG6F 5E9DB 4K3DH 3OB0H 4L5FH 4Y5YB 4IRZH 5DI8A 4RGNB 5E1QA 1YEKH 4LEBA 2R1YB 3UDWA 5CBAA 4NLHA 3O3BB 1CICD 3AXLA 1QA9A 2OAAA 4RWHA 3SPGA 5M7QA 1IO4C 4E9QA 2I9LA 3X12B 3FU0A 1EO8L 1SMAA 4CBPA 5KG9B 1G7MB 2G30A 4TM9A 4GAJL 3K1DA 5T3XD 2Y5TB 5FO7B 2NYYC 3VSVA 2A73B 3IXTA 1QSFA 3VFOA 1ZLVK 2DWTA 3LQAC 3RPBA 4R5XA 2DWDA 1RZFL 3OAWA 4UF7C 2VT0A 1UUSA 4GS7B 2LR4A 3AQXA 4LOUC 3LPFA 4V1DD 3KBHE 4ZW7A 3EJUA 3G5YA 5INDA 1FNSH 2DQEL 1LP9B 2QHRH 1L9OA 3KZ8A 3K1KC 4ISVB 4P5TB 4L3EB 3P4LA 4N2DA 4KZDH 2NY5L 2JKRM 2PCXA 5I15H 1U8LB 5ISZA 3NJMA 1E5BA 4OT1L 2OMXA 2B0SL 4MXWH 5FYKD 4CGTA 4FGMA 3EKCA 4ZMWA 4XMPH 3N44F 4Z7IA 2BP0A 4PJ5D 2EDWA 4F33A 2FYVA 3CDFA 1B90A 1L7IH 1SEQL 2FJHB 3EJZC 3GXDA 2ID5A 3LRLA 3NESA 4LKCA 5DZAA 4AL8C 2WIIB 3LTVA 4BHUI 2NY6B 1JPSH 5E99H 3IJYA 4A68A 3FOLB 4H5SB 4DVRL 3DK0A 4UIMA 4W70A 5HHPA 3QUXB 1Z5HA 5DVPA 3LS5L 4YXKH 5E08L 4NHUB 4PJHB 3TO2A 3GO1H 1SLXA 1IU1A 2BOBB 5KOMC 5MEPB 3VGEA 3MRIA 2ZXAA 4S2SA 3KS0J 1IAOB 5DD3L 2HJLA 4KNTA 3REVB 4L1SA 2O5YL 3L6FA 3QUMH 5DD6A 4ZAKB 2QPDB 3F64A 4OFDA 2Q2LA 4K5OA 3TEUA 1LEIB 1QLEB 1KZYA 3O4LA 2VDRH 4CC0A 4HC1L 3VCLB 1TYJA 5F9AC 4G1MB 3ZOAA 4L18A 2CBTA 3S36X 3N5AA 4EUPG 5LN8A 5JW4Q 3P3SA 4J27A 1FGVL 2AQSA 4E9LA 4GRMB 2FUTA 5DEJA 1DE4A 2FBJH 2GBTA 2ZG3A 2N7BA 1T5XB 4PRIB 1UM5H 4UQ3B 2Y0SA 2J8UB 2E3VA 5F0MB 2CZNA 1SUHA 1BQHB 1WBZB 3PFQA 5ADOH 1GTFA 1UJTA 5F7DA 3RY6A 3ENEA 1TZGH 5D1XD 1JL8A 3MA9H 2PW1B 1S5IH 1W9XA 1WZ1L 1BYOA 5FO8A 2UZYA 4PRDA 2XV3A 1DVFA 5KYNA 1G6RH 3V6OA 3LMJL 3FB7A 1OB0A 3U6XA 2C3GA 2DH3A 3LKQA 4X9BA 2FGWL 3CUPA 4ADJA 1AGBA 1MHHA 3MV8D 5A2BA 1CLYL 3E8UL 5BMFH 3ARBB 3P11H 1VZIA 1A6TA 4NENB 4HIJB 3UTTE 1JGEA 4AOFA 1XB3A 2J1KA 3LKRA 3LHAA 3MBEA 2OSLB 3MUZ1 4M43H 5DZOA 3OKDB 2E86A 1KCRL 5D1QB 1XSKA 1A8ZA 3WXVH 5F7EH 2ZUYA 1EEYA 3CHPA 3NJLA 4IMLA 3SD2A 4BFIB 3RVXD 3KH3A 2VN6A 3T1FB 2NR6D 5IB4B 1IB5A 2Y1ZA 1J9QA 4HLJA 3TTSA 5C6PB 5E2VH 4RBPH 5CZKA 3U48A 1IZJA 2G60H 4U6HB 2AXJA 4JO4H 3RPIB 3DECA 3OR6B 3VD4A 4LHUG 3DO4A 4MJIE 2W65A 5C3TA 4XVTH 1NGZA 3ZTNH 4CJ1A 1G87A 5HYEA 3TBBA 5ESVB 4YE4H 3MV01 2GUOA 3CFKB 5D7JC 2FEDC 1TVHB 1SBSL 4EN3A 4IKIA 2J73A 5H94B 1AO7A 4CAGA 2IOIA 2VB5A 3IFLL 2DEWX 3QXDA 3RI5K 1WZAA 5JHDE 2BLFA 3MOQA 4W9DC 4LSRL 2HKFH 2ZKXA 1A9BA 4YBLB 2AMUA 2BIMA 1XD0A 4RWYL 1HQRA 2GBVA 4PJDA 3EOTL 2AJXH 3CBJB 2KI6A 2ZJSH 5DWUH 3O3AB 3PDDA 3IJ7A 5F97E 3CFEB 3IBOA 4J4PC 4K2UL 2DMCA 2ZONA 4WFED 3TZVA 3LKPA 4EJ1C 1ZIAA 1THCA 1MF2L 2OYMA 2VDKB 1OAYH 2GC4C 4BH8A 1UXSA 5D6DC 4DGYL 5J1SC 5DMYA 3JV6B 1YYLL 2NXYD 2AEQL 3ARGB 4RZCA 3L4YA 4OI9A 4H13C 3BZ4B 1M7DB 3MI6A 1U8OB 5AW3B 3UH8A 5E70A 2K6ZA 3NJHA 3CSTA 4KAQL 4BFFA 2PPAA 4NXKA 1IGIH 4PPTA 4AJVA 3KPSB 2WPGA 1OE1A 3ARFB 2OS7A 2YBRA 2WN3A 2AQTA 2D31B 4XMKL 1ZLWK 2DI8A 3SDDC 4XOAA 1N67A 1TJHH 4LCUA 1KB5H 5JDSB 3UTOA 3WSQL 1VAHA 2IEPA 5JO5B 2L04A 4OD1H 5CCHE 5K9JH 1F42A 2DQTL 5EFIB 5AAWA 2PW2A 1XR9B 4RRPA 2ZXEB 4X7EC 5CJXA 1ZK5A 2BZ7A 3VACA 4W9FC 4RGOL 3UCQA 1EFQA 4EI6B 1QYGL 3SKJH 3Q48A 2HVKB 4V1DB 3ZDXE 2HLFD 3ETTA 2P5ED 1RFDH 4POUB 3EO1B 3UTZB 1YEGH 1X9LA 1SY6L 3Q2CA 2DM3A 2DQHH 4UBDC 1X7TA 1JNHA 3GI9H 1GZQB 2D3NA 3NN8A 2R1XA 1KMGA 4KAQH 4XP1L 1KXTA 4FXGC 4XMKH 1IC7L 1OSZB 3JWOC 4I2XB 4LBAA 1T4KA 1DJHA 5ANMA 3OXRA 2BSRA 1N4XL 2R4RH 4N3TA 3MUHL 4YVUA 2LVEA 4R96B 1FBIL 2J25A 3WKNA 2JIXB 2V5RA 3UCRA 2VMEA 1I31A 1RXLA 2J88L 3CFMA 4HWBL 5C09D 5IJBC 1OAQH 5I6LA 1J9RA 4IBTA 4XP9H 2YC1A 2LLNA 1P7KA 1KPRA 5F7WC 5EBMA 1ORQB 5FDWB 4N2NA 3ATAA 1BXUA 4HS8H 5LGJB 3BUBA 2Q6WB 3I6LE 4F5CA 5EOQH 3QZNA 3VSQA 4M1GL 1J0IA 4U7SA 3SE9L 3MU3A 4YZFE 5EOCL 3U36B 1FLRH 4JO1H 1JGUH 4TOYL 3JV6A 5KSAD 2GCYA 4LRNL 2DOCA 3G5VB 4X4YB 2G3ZA 1G7LB 2VMCA 1CDHA 4HKJA 2ZUSA 1ZVHA 1RJZA 1GGUA 2YAPA 4K71B 2XIBA 1AHWB 4OFKA 4PM1A 5KBLA 2BVEA 1LO5B 2MQGA 3F01A 4G8IA 4ODVH 5CSZB 2G5BA 1H0DA 4GRWH 1JERA 1XL6A 2W60A 3UJTL 3BPCB 5FLUA 3WL9A 1ILUA 2QZ5A 1KTDB 1UACL 5C0AA 2XWXA 3HLKA 4PS4L 2OK0L 4FOMA 3KPPA 1JK8B 5FYJL 3UBHA 1NCHA 3O45B 4GRLA 1XO8A 5H94A 2IWEA 3FB8B 5AAMC 4C56B 2H32B 4M43L 2ZYSA 3MRKA 1BF5A 2V5YA 1R4XA 1KIPA 3TN0D 4KJWD 5I5MA 3HS0B 1U0QA 4WNJA 2PP9A 3GIVB 3VXUA 1F2XK 3JTTB 3CZSA 3OR6A 5KVGL 1S9WA 2Z34A 1BLIA 3T1WA 43C9A 4NHCH 3QUXA 4JO4L 4RFNB 3EYFB 3VFRA 3ZRCC 1HIMH 5EULV 3BWAB 4MCYA 4LT7A 2ICWI 4KH2A 1B0GA 3UG5A 1IQDA 4U6XA 5JORB 3PGDB 4B9CA 3HZKB 3BW9B 2GTZA 3TN0A 3FZUC 1NCJA 3IDJB 3QRGL 4AENA 3BSGA 4XNZB 4XT1C 1AQKL 1FIGH 4J8RB 4ZTOH 1L3NA 3BGMB 5JNYB 4Z7VF 4NZFA 4UQBA 1I82A 5HHNA 2D8KA 3RI5F 3OKDA 1R3IL 2CXGA 4E41E 5J13C 1LDPL 1G6RL 4CVZB 2NDFA 4HIJA 3JWDL 4PVLA 1UWEH 4H44C 5ITBH 2CKBA 5CEXA 3FFCB 1CR9H 1KBVA 1OTTC 2ED8A 3A4DA 3C5ZA 5AUMA 2G2NA 1I9EA 4XMWA 4P07A 3G6JF 4PJ7F 1JVKA 5FO7A 5ETUB 3V6OC 5IFAH 1AG6A 4Z8FH 2DKMA 2WQAA 4CU7A 3PXHA 1JPSL 1V3LA 1B6DA 2YGNA 1W91A 4OF6A 3U2SA 3UTPD 1NLBL 5E8OB 4DVRH 3C8KB 4ZO8A 3MLYL 4FFYA 1L9NA 2ITCA 4NKMA 4XP5H 1EDQA 3VRJA 3GJFK 3NCFB 4PH8A 2A77H 1Z9OA 4G1MA 4CMMB 4C58B 1IJNA 4JO3L 4NQDA 4K73A 7FABH 4FRWA 1GXEA 1XEDA 2V7HA 1HHJA 4I8DA 2E56A 3BUTA 5AB0A 1PZ5A 1TQCC 4FD0A 2XBDA 4FHKA 3ZMRA 1N5YH 4WO4B 5F7NC 4DZ8B 1KELL 4E5XG 1JUFA 5I19L 1CD1B 1KN2H 2E7HA 1N0LB 4P3CH 1BGXL 4Y16B 1QFWI 5DQJA 1GGCL 4LCWB 3ULVD 1XH3B 1QNIA 2XWDA 4PJ8B 3FOLA 4BUHA 4KTDH 2VISA 3UBXA 3VU1A 2LU5A 3BEVB 2VAAB 2GUYA 1JZ3A 4KVCH 3AB0C 1A4KA 1WH0A 3D85D 3HC4H 1MFBH 1KGWA 4PJHA 3ELAT 1UWXK 3OQRA 4QRRE 3TO2B 1YQVL 1NBZB 1S7VA 3W9EA 4F7CB 3KBEA 4WHTA 2R7EB 3OV6A 4F37F 4NQCE 3WUWA 5GJTH 4KMTH 3ET9F 2F74B 4HUVA 4XO3A 3S2CA 1D5ZA 1R19A 1WFOA 4BQ9A 2WLNA 4TULL 1ZT7B 5EBWA 1OK8A 1IAKA 3ZT7A 2AP2A 1U8IB 2NY1C 4HCRH 1E5AA 2K7QA 1QABA 5IQ9A 2EUVA 2VM3A 4IOSD 3CHQA 4XB3A 3ZDYE 1T04B 2WBJC 1I1YA 2P5EA 4YDNA 4D8PA 1SYVB 1HE7A 3IVKB 2A83B 5DU7A 1OT2A 2WUCL 4XCEA 1WIUA 1SVCP 2EXWD 1FJ1A 3ILPB 4H7VA 4LCCC 5D2LE 1ONQB 2J6EH 3IGFA 4NNPL 1EZVX 4WWKD 3M7OA 5TE4L 4P5TA 3TTYA 2GJZB 3GS4A 4XZUB 4WUUA 2R8SH 3C5JB 2VDQH 2I9LB 4QHNA 2J5LC 1HI6A 3PV6A 3V0VB 2XG4A 5HHQB 1A3RL 5EPMB 2HLAB 4LLMB 2PTTA 4M1DL 4F7MB 1X5GA 2APTA 5C0IB 2Y3NA 2DQUH 4RETB 1T1XA 1FDLL 4KK6D 3BPNB 1W0VB 3GK8H 1T83C 2ZKYA 3EGSA 1RZQA 3M46A 3W11D 5JYMA 3PCYA 5KYYA 1OHQA 4KXZH 4RGMC 2BFGA 1T1XB 2OL3H 4A55A 4EI5D 4KK9C 3GNMH 4EKXA 2IWKA 2PMZA 3HG0A 1UOVA 2CJUH 3F5WA 1B4JH 3NT0A 4A2HA 3H8NA 1YJDH 3KPSE 1J9TA 3PUCA 5T1MB 4Y4HA 1D7CA 5JOEA 5E2VL 3BSZH 3T2NL 3VG0H 5CZVL 1FO0B 2BRRH 4ZUSA 2MCPH 2B20A 2NY7L 1RZJH 4U7KA 1XCTB 4HJ0D 1DJIA 2IANE 2R2EB 1A1OB 4MNGB 4PJXF 2XIDA 3NIFF 3D2UA 4KMTL 3RKDD 3NSXA 3LS4L 2Y06H 3PL6D 1MI5A 4NQSB 3C6SB 4ONOA 4B5EA 4NUGH 4HK0B 2O26U 3O4OC 4YO0B 2V7NA 3WNMA 2YMOA 2YXVA 3A6CH 1DANU 4L3AA 1SLWA 5KYWB 4FMFA 3A4AA 4D8PB 4JRYB 4KKBD 1KSRA 1Z1WA 1PZSA 1MCWM 5GGUB 4W68A 1KBGH 1TMCB 2WHVA 3KPRE 1E9QB 1F97A 4YGAB 2MCG1 3V7AG 3WLWC 1XGQA 4MMXA 4EN3D 1QPPA 5A16A 2QKIB 1AG0A 3SDXB 1AOHA 4Z3TA 2UVEA 2FEDD 3KYOA 4ELDA 3AY4C 3PXJA 4PD4K 5F3BB 4NCDA 2HFTA 2R29L 5EUOF 3QI9C 1JAEA 2R39A 2CCLA 3QEQA 3QS2A 4N87A 4S1QL 1B0RB 1L7TH 4JJ5B 2IDQA 2E9IA 5F6HJ 1QOKA 1YEWA 3INOA 3QJXA 2FRGP 4NT6B 4JO2L 3QUMB 1E30A 5LBGA 1QW9A 1ZXQA 4N0UA 3CVIL 4ZI8A 2HN7A 2FR4B 1N0LA 1E2VA 4YPGB 1NKOA 3TBVB 3WTXA 2ADIB 1K4DB 1VPOH 3BD4A 4KGLA 5DJCB 2AKRB 3L13A 3L5JA 5I1KH 4MD4B 1I85C 1TKWB 4V11A 4MQ7A 5FA3B 3QUML 2DYPD 3MUGB 1EEUA 2CO4A 2UV3A 4ZFQA 2NXZB 1L9PA 4I18B 3ULVE 2JB6B 4M7LL 3DDFA 3ARDA 1S3KL 1C1EH 1BAGA 1WZMA 4ZPTA 5FUCC 3UGEA 1KEML 1VENA 2C8NA 4FX5A 1OALA 1FL3A 4QWWD 2N01B 1VFBB 1YEIL 4EN2A 3V4VA 5A3IC 3T0EA 4HS3B 5D1XA 4GP5B 1MQKL 3CSBA 3QFGA 1XF5B 4ANXA 2FZ3B 1PQZA 4XP4H 3LPOA 5CLYA 3VI3E 4X83A 1E9PA 2Z35B 1IQWH 4H0GA 2WYHA 1XH2A 2X6CA 3AXIA 4HXAL 3IE4A 3WEMA 2BRRL 5JHAA 1IAIL 4NRYA 1DFBH 1QLEH 3IU3A 3ZDZB 3QCTH 4P2OA 5KSAC 4A6YH 4HMCA 3IJ8A 4X6EA 3EFFB 4L8SB 4IRSA 5MEOB 3OXSB 2DBJA 3KR3L 4HAGA 4JFDE 3KW7A 1DJZA 1M9SA 4H8PA 1D5ZB 4PJEE 3TP4A 1AO7D 1P84J 2EADA 3VG9B 5ID1A 1ZA6B 1NSNH 1SLVA 2ZUUA 3CDZA 1Y0LB 1QD0A 1UA6H 4J1UB 5DA0B 1NBZA 1S7VB 1U8PB 4P3WA 3GSWB 4GPVA 3UAJC 4NN7B 5KOVC 5KTEH 3VH8B 3A6BH 2E7DA 1NBYA 4H88L 3MHZA 3GHBH 4NNYA 1USZA 4KJQC 1KCUL 1YAZA 4Q6IA 3PJNA 4Y1AE 4CN6A 1OCWL 2W95A 1LQSR 2BW5A 1T0NB 1XZWA 4HSCX 2PCPA 2H6PB 1P69B 4DP4X 3AS2A 1F1GA 1HDMA 1PCXA 1KY6A 1HHHA 4DZ8A 4HP5A 5ANHA 3BE1L 5FYJU 1YN7A 3MRRB 3C2SA 2OJZH 4AEHL 2PXYD 2MCMA 1PLCA 3MV9D 1OAZL 1S9VA 3O41A 3OSKA 2OTWA 3PNWB 3P30L 1S7TA 2RTTA 4LRNH 4BQ6A 2XQYK 1YDPA 1GSMA 1UD5A 1CDIA 3DETC 3HE6A 4KKQA 3I6KB 5C0AB 5ES4B 4NKMB 3ULVH 1ZHLA 4M3HA 1GVIA 5CBEA 2VR3A 3DIDA 3H2WA 3HN5A 5EF2A 4JGNA 1FA4A 1FLRL 2E46A 4ZFZB 1E5CA 2IGFL 1MFBL 3MBWA 3GJFB 4JM4H 3MOAL 3CBRA 3DX8B 5E0FA 1MWAH 5CWSA 1NGYB 4NZUH 2XCMC 4L3FA 1LXMA 2DD8L 4WJG3 5F71A 5BQ7A 1FNLA 2OP4L 1EXHA 1FQ9C 1AKJB 2DN7A 4NUJA 3FUHA 4Z7OE 4F8PA 4QXGH 4LGRB 2JQAA 1WYJA 2H8PB 1KN2L 1YLBB 1T7XA 2CHDA 3V9FA 5FKPA 2A4ZA 4N6QA 4YX2H 2OXHB 1IEAA 1NMCC 5D71L 4PTUA 4HCRL 3ZO9A 2VJ8A 1ZVNA 5F0JB 4R84A 3H55A 1JMZA 5SWZA 4UNTA 4HUXA 4YQXL 4LLVB 2DQGH 3E9TA 5F0PB 5AZEH 4PJ5E 2OYKA 4OM1H 3S9DB 4PJ8C 3QQDB 1OWRM 3AVEA 1QRNE 1KG0A 1U8QB 4XP5L 1MCRA 4OZHE 2EIBA 1VFAA 4GG6E 4LKXA 1Q9KA 1BQHG 4TUKH 4GFTB 5HHME 1EHAA 4Z7OF 3HZMB 1T3FB 1W72H 5KVFE 5I76A 3BZFB 1AI1H 4HKXA 1R6VA 1U3YA 1HT6A 4AKPA 3T3ME 5ADPL 2RR3A 3PE9A 3QBTB 2Q7YB 3V5KA 3IJ9A 2O4EA 5ESQB 3AJ7A 4ZYKA 3I74A 3G6AB 4O02H 2FWSA 1A8JH 3HS0A 4XPFL 4DKEH 4O2FA 1D5MB 4FXTA 1JXGA 1E3XA 4K8RH 1KPUA 4NRXB 4NQCB 4LDOB 1Z9LA 1OEZW 1UM6L 4XMZA 1IKFH 3FU9A 1CLVA 5CHNA 2ZOLB 4RGNC 2HX7A 4MJ5B 3RFRA 5CP7B 5MERA 2NDGA 4XMLH 4C47A 5E2TL 2YMTA 4K7FA 5D7LD 2VSKB 3FONA 4QAWA 5T3ZL 1QBBA 1LO4L 2ADJB 3IT8D