1BA9A

The solution structure of reduced monomeric superoxide dismutase, nmr, 36 structures
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEQSTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Solution structure of reduced monomeric Q133M2 copper, zinc superoxide dismutase (SOD). Why is SOD a dimeric enzyme?.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 31
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ba9A00
2Z7YA 1SPDA 1COBA 1HL4A 1OALA 1Q0EA 2AQQA 2E47A 2VR8A 2WWOA 3K91A 1ESOA 1TO4A 4BD4A 1XTMA 1PZSA 1IBFA 4A7QA 1FUNA 2XJKA 3QQDA 3MKGA 3KH3A 3LTVA 1IBDA 2NNXA 1YSOA 3KH4A 3QQDB 1P1VA 4OH2A 2E46A 1RK7A 3ECVA 2C9SA 1Z9NA 4A7GF 1OAJA 1E9QA 1PU0A 3L9EA 4N3TA 2C9VA 3KM2A 5KBKA 1IB5A 4U4IA 1PTZA 1SXNA 5KBMA 1XSOA 1OZTG 2ZKWA 2JCWA 2Z7UA 4OJAA 4A7VA 3GTVA 1QUPA 1YAIA 1UXLA 2SODB 3CQQA 3F7KA 3GQFA 2GBTA 2AQNA 3GZQA 2Z7WA 3GZOA 1F1GA 1JCVA 1SXBA 2JLPA 2WYTA 1DO5A 1SXAA 3S0PA 2R27A 1BA9A 2WYZA 1EJ8A 1E9QB 3MNDA 4BCZA 3ECWA 1F1DA 1CBJA 1SDYA 1E9PB 1BZOA 1SOSA 1N19A 3SODB 4A7SA 3HFFA 4A7UA 2AQSA 1JK9B 3L9YA 2AQPA 1OEZW 1CB4A 2WWNA 2XJLA 2WKOA 1U3NA 2WZ0A 2Z7ZA 3ECUA 2LU5A 3RE0A 2AQRA 1L3NA 1AZVA 2AF2A 2WKOF 3PU7A 1Z9PA 2V0AA 3CE1A 2VR6A 4MCMA 1MFMA 2Q2LA 4MCNA 1TO5A 3KBEA 1E9PA 4N3UA 3CQPA 5KBLA 1KMGA 1B4LA 2VR7A 1F18A 2ZOWA 4BCYA 3KBFA 1UXMA 1JK9A 3F7LA 2APSA 3H2QA 1XTLA 4B3EA 3GTTA 2AEOA 1F1AA 3HW7A 3KM1A 1B4TA 1EQWA 2C9UA 2ZKYA 1IBBA 2K4WA 1SXSA 1IBHA 1S4IA 1SXCA 4FF9A 3GZPA 1SRDA 4A7GA 1E9OA 1YAZA 2WZ6A 2GBUA 1E9OB 1OZUA 4A7TA 2AQTA 2ZKXA 5CU9A 2GBVA 1SDAB 3HOGA 1HL5A 2WZ5A 3H2PA 1N18A 4L05A 3T5WA 1DSWA 1SXZA
chains in the Genus database with same CATH superfamily
2Y07H 1FP5A 1OALA 5DEFA 1HL9A 2ENYA 4C83B 5DSCA 4PJCF 4PJGF 4HIQA 4M1GL 4C58B 4KHXL 5IW6B 1C5DA 2G30A 1CI3M 4TUKH 1G9ML 4XP4H 3BSZH 1TPXB 3M8OH 2I9TA 1P2CA 4YBHA 5JHLL 4MJHA 3WFBL 4KZ0A 3QJTB 4Q14A 3W0WA 2DMGA 5KSAB 3RVTD 1HJCA 2BMKA 3WKYA 1JAEA 5KBPA 1JFQL 1A5FL 1CMOA 1I9IL 3ETTA 3IE9A 1I8MB 1HH6B 4W9EC 4GI8A 2GHWB 5DVLA 1AS8A 1DQQA 1OZTG 2WLNA 1I1AA 1KBVA 5KANG 5KS9F 4P9ML 5GISL 3T0BA 5I1CL 2JQZA 2MPVA 4N5UA 2QSVA 4D9RD 3ARFA 1GJUA 4G7SB 5KWYC 2DQDL 4PP1D 4K8RC 4AG4L 4M56A 5FA4A 2H0FA 5GSVA 4U6HB 4OGQC 4WWID 4H8QA 1HHIB 4UNVA 4S10A 4ODWB 4OCRH 1CZ8L 1F1DA 1RJYB 2Y5TB 3BP5A 4U1NA 2GIMA 3AITA 5I0WA 3L5WA 5J11B 4JQXC 1UB5A 4PRNB 43C9A 4X42A 2J3SA 3MCKA 5ISZB 2NY1D 2QFPA 4JO3H 4R7VA 4NRXB 3U48A 5FECA 3B9EA 2OKMA 1HHKA 4XCFL 1U8NB 1PZAA 1JOIA 5E8NB 4MS8D 1PLGH 4XB3A 1DANU 1GSMA 3S8FB 1QABA 4FX5A 3WIIL 3SKJL 4QO1A 4PJ9A 4LLUA 1PZ3A 2GSIB 5IVZA 4GAGL 1CVRA 5HVWA 1NJ9B 3OQ3B 2ZOWA 4LSRL 2PETA 3GDBA 1QATA 1RIUH 2P42B 4XVSL 1N5AA 3FDWA 4ADGA 4AEHL 1RUAH 3KM1A 4IRJA 5AYUH 5HVGB 3GIVA 4HKZB 4Z0BL 3QW9A 1ADQH 3DLQR 3SJVD 3PJSA 3UC2A 3CFJA 4K07A 4KO6A 5I6KA 4YPGA 2E6JA 1MCIA 4UIMB 4PJ5D 3FB8A 1B88A 2QZ5A 3BPNB 3CX5J 3VFSA 4KHTH 1OOWA 3K2IA 3KPRE 3HHSB 4MXVF 2XXCB 3MSPA 5EZIH 4PUBH 4NCDA 4YQXH 1MFUA 2A83A 2Y3AA 3QXTA 2CU9A 2WBKA 2YXMA 3H9ZA 1TMQA 3X13B 1I1FA 5B8CC 2PYFA 3GKZA 4PRIE 1PFOA 4HAKA 3HIZA 3L1GA 4P99A 4R2GB 1A02N 4K3EH 1DTUA 2W65A 4NQDE 2ZUVA 2FLRT 4KKAC 1ESOA 2AXGB 3PUCA 2XY2A 3AS1A 2P49B 3F7YA 1RZ7L 3NCYS 4ZFOL 5E6IA 1OSZB 2ETWA 3ZO0A 3A24A 5C0CB 1IBDA 3PS6A 2HRLA 4LPCA 1G9HA 1O75A 3MZGB 5AEAA 4XBGB 1QI3A 2P3YA 4NWUL 2DYPB 1EV2E 4HCRL 4NNYB 4Y1AE 3SO3C 3CN1A 1TITA 2X1QA 5KJ7E 3O3BB 3AMKA 3P3SA 4CC1A 1OF2B 4OR1A 4I0PC 4Q89A 2DTML 4B3VA 5AZUA 5EEYA 1PJ9A 2X0WA 2Y7LA 5E99H 2YUWA 1G7LA 3CFNA 4OZFA 2VLRD 1NDMB 3PDGA 3REVA 1OB1B 4Q6IC 2W0FB 5KOMC 2BO0A 2J88L 2WNXA 1V7NL 3FT2A 4QY8A 3MV7D 3CD4A 4ODVL 2PO6A 3BH9A 4WO4B 4XPFL 5DR5H 1SOKA 2C3WA 3VG9C 2Z31C 2CDEB 4N2OA 3STLB 5FK9B 4G3YH 1N8ZB 3FUMA 1LO4H 3VVWA 2D3NA 1AO7B 4NBZB 3WMSA 2OM5A 1FV1A 4XODA 3D2TA 4UV4H 4DQOL 1AZNA 3G5YA 2HG0A 2X1XR 3GBML 1FFPB 3HG1A 4Z8FL 3QRFM 3MPCA 4XGZB 4U1HA 3EGSA 2ZXEB 4OLYL 4LCCB 1TQWA 1MSPA 2J7LA 4Q2ZB 1MG2C 3RGVB 5HHXL 4OFPA 4DZ8B 3MNVA 4DVBB 4KPHL 3EG9A 1VJSA 4ZFFB 2YGPA 5DJ8B 2A77L 3P4LA 3DSFL 4PAZA 1RZKH 3H9SA 3WHXA 2PTTA 4XX5A 1KCWA 4DZBA 3JWOH 3KS0J 1E4XH 1GW0A 3FH8A 5IV2B 4MJ2A 3MRRB 4G7QB 4LSVH 4XNQA 3ULUF 1YQVH 3NCJH 1H3XA 4OZGB 1MCOL 5HYQB 1WCBA 1P4IL 1PG7H 3CMOL 4JFOA 2JKLA 4N9GB 4JY6A 4Q9QL 3U9WA 4NQUA 1XO8A 1A1NB 1V3LA 1SEBA 3B3BA 5GRUL 1UD4A 3TV3L 2DIAA 1N2RA 2OMXA 1NC2A 1L7IL 2BDNH 2AABL 5KZCB 1AJ7L 3V4VL 5H37A 3BZFA 3RWGB 4NI3A 1RPUA 3HTLX 4KY1H 4TQPA 2UVEA 2HYMA 3L3JB 3TO4A 1IC4H 5B7FA 4Z0XA 2VLLB 1FIEA 2Z0UA 1BAWA 2Z91B 5K93A 3HZVA 3T1FA 1A3RH 4JKKA 4ISVB 2XQBL 4OFYA 1TKWA 4HH9A 2R51A 3TS8A 3NPSB 5DJDB 2OK0L 3UJTH 1WZ1H 3QCUH 4YLCA 2DIJA 2H0PA 1J5OH 2WXIA 1BLIA 2HX9A 2ZCLL 3WL9A 2ZCHL 2A9MH 3LQZA 1DBBL 1JMXA 3CFCL 3QUYA 2XNAA 2XHNA 1EFXB 2AVFA 4GO8A 3K2MC 4DP6X 4XP9L 1WA2X 1WG3A 2MTAA 5F0MB 2UXTA 5CLYA 1UASA 3DRTB 1UURA 4IGBB 2B0SL 1N4XL 1IZJA 3MROA 3SY0A 2OMUA 3IKCB 5KVFH 4IOFC 3EFOB 1ROWA 4TVPL 1GH7A 5IW1A 3ARXA 1ZT7A 4EI5B 4N6QA 4P2OC 4DTGL 5LWYH 3A4DA 1E0OB 3AT8A 1E3XA 3BVUA 1FGNL 3ZTNH 4FQ1L 4C57C 1SJEB 1E9PB 1FNHA 2O6CA 1AGCA 1FC1A 2YBGA 2XBDA 4YNYA 4QRRA 2CO6A 1KEMH 3TH2T 2VDNB 1JGLL 3D2UA 5D6CA 1DVTA 3WELA 1PQZB 3BAYA 1DZ0A 1HOCA 1HYSC 2EYTA 2IBBA 3GSNA 5AW1B 3RIAK 1S8DA 3UPCA 1T83C 3II1A 2GEQA 3P3YA 2OX5A 3I84A 2IH1B 3UTTD 1RHFA 2APVA 2XETA 3DVNB 3F5WA 4GG6E 4GW1B 4X5RA 5LGYA 5JTWA 3R7RA 4LU5L 2R56H 1KLGA 2WY3B 4H8UA 5ACMA 3VA2C 2DDQH 2VR7A 4PRPE 1Z9LA 1INDH 5T3XD 4Y9GA 1CI5A 5HHQA 3TZVA 4G6MH 4F7EB 5ACLA 2EYRA 4GG8A 4YDKH 2QQNH 1M53A 3VFUB 1Y18B 4R7DB 4GSUA 4IJ3B 3FUEA 5DJZB 5KJRH 4GBXC 1J0KA 1KIRA 4UDTA 1IKNC 1CGWA 2YRLA 4GS7C 4TUKL 3KPRB 1SRDA 4MXQC 4WFHD 4ZPVA 3ARWA 2NY4B 5IP4A 1FNGA 4XP4L 3BSZL 3D39D 3M8OL 3NJIA 4OZ4A 1BWWA 1CLOH 3KEHA 4R4ND 5GGVH 3SDDC 4BXSV 4PRIB 2DJSA 2EDMA 5GGSB 3EHBC 1CDCA 1IO4C 2JI3A 4NQDB 5EOCH 4HHAA 2BNRA 2GB2A 4NSKA 3HN3A 3KGTA 3L9BA 1DVFB 2DQUH 3CZGA 3LKQB 1LE5B 3W0WE 3TA3D 4DKEH 1P53A 1XAUA 3UBGA 4GQ9L 3NA9H 1GKOA 4Y19E 5FW6A 5HDWA 1PZSA 4GKZB 3GNMH 4NQVA 1OGTB 2HUHA 4QJ5B 5CJOH 5FLUA 2R23B 1RUPH 4Y1AB 3SOBH 1MCBA 3DX9A 2XYBA 4OCRL 3QRBA 1FYTE 1T1ZB 3HKZA 1WFOA 1ZWIB 2Y22A 3S96B 4NPKA 3CUPA 3TJPA 5T3XH 4UQ9A 1UQSA 1P7QA 4KJWC 1E28B 5SWSA 5IMOB 2NY0D 4G7VH 1AIFB 3LMJH 4BQBA 4WWKD 4IU3A 1XV8A 4LPUA 2IADB 4JO3L 1S9XB 5CSGA 4PGCB 1GA2A 4MB3A 5H4ZA 1T20A 2V3FA 3PWPE 2KPWA 1A9BB 1N64H 3IETB 1WO2A 1IZKA 4QOKD 2X89A 2P8MA 2IWGA 2A3TA 1PLGL 5T1MB 2H3NB 1KIQB 3T8XB 3TN0D 2WLLB 4Z3IA 4FLQA 2CGRH 1HHHA 1FYHB 4XI5D 3CGTA 4ONGH 5ADPH 2WXHA 4JPKH 3W5NA 2VWEE 1INEH 1RIUL 1BZOA 1DZBA 1G94A 1T7VA 1XL6A 4I1PA 4UF7C 2GEEA 5CGTA 1ZDQA 3G5VA 5AYUL 3O6KH 4QJ4B 1IAIH 1ADQL 1I8KB 4HGWB 3S8WA 5I1DA 2GC4C 3RWJB 1S7WA 5GGTH 3TVMC 1QHPA 4RMVA 4GXVH 4JFTA 2KI6A 4FXLA 4ODBD 3W9DA 5AVQB 3ME0A 1AZVA 2OCJA 5KYWA 2HH0H 4KHTL 3IDIB 4XWOD 5ANHA 4E68A 1OP3H 3VWJA 5HHPA 3UBXI 1ZVHA 3EUUA 4JKMA 5IB2A 2QSCH 5E9AA 4PUBL 5EZIL 5GPRA 3RTLA 3TASA 1AHWB 5IESH 1QTSA 4HJSA 1XTLA 4JLRA 4J4PA 3GD1C 5I2IB 4PCSA 1GZQA 3PIQB 3GWJA 3T4YB 2JLLA 2BXYA 2AV1A 3EYQC 4K3EL 4N6RB 3V5DB 4EN3B 4TYUA 3K3QA 1ZAGA 4APQD 4DESA 3FRUB 4M93C 3TFBA 5KSAD 3BIKB 1O9WA 1MN4A 3OGOE 4NEHB 2RBLA 2FYYB 2WUBL 4OF6A 3I9AA 4YDMA 4DEPB 4CN1A 4Z77A 3F04A 1GGUA 4EOWH 5IMMB 3VFRA 3QNYB 4FJYA 5BV7H 2EE3A 2NTFB 3WN5C 2X10A 3V0AC 1WZAA 5E2WH 3X1FA 3L81A 3KW7A 3LPPA 1JDCA 4X6DA 1OW0A 3QZBA 5CZKA 3WXWH 3FB5A 1U8CB 3TYFA 1A6TA 1OVZA 5HGHB 3IMRA 3MLTA 3EO0A 5HY9A 3P4OB 1SZNA 1DQJB 4U49A 4UOJA 3FN3A 4D7PA 2G5BB 3FHQA 2YO3A 3JWNE 3MRMA 1UB6B 1A1OB 2H8PA 2NY7H 3DTXB 1N3NB 5DR5L 5EU4B 4DGUA 4CUCA 1H8LA 3VSVA 5C0GB 5ISZD 2G2RA 2JF1A 4LIQH 5BJTA 1D2OA 1XGQB 3HVNA 4G3YL 3IGAA 4OLVH 2FD6H 3R8BB 1LO4L 1C7TA 3JTBA 4U1JB 1CGSH 4JCMA 1CE6A 2ORBL 4UV4L 4WFED 5T1KD 4WFFD 3SBQA 1Z9SA 4S2SA 3OZ9L 3I6SA 4EI6A 4P5SA 4Z3FA 1AE6L 3F2LA 1W0WB 2FO4A 5IBLC 1FZKB 5DK0A 2ENJA 2B59A 1AXTH 3PGDA 4A68A 1W8OA 1WZLA 1P5VB 2ZWKA 4NAJA 5AB0A 1F4AA 3WFDH 2PR9A 3PY9A 4BYHA 4OBSA 1MAKA 5J13C 5EUKA 3TONA 2VLKA 3T3ME 1TMCB 4QRTB 1TZGL 3WS3A 3P77B 4QYOB 1DSYA 3JUYA 4X6EB 5FYJU 1R1CA 3R0MA 1RZKL 4GMTH 5FUOH 1MI5E 3AB0C 4GB9A 4CBZA 3JWOL 1KSRA 1R5IA 4N0CD 5LGKA 4PN6A 3WGUB 1DN0B 4GG6B 4LSVL 5IMKA 1QBAA 1EJFA 3L95B 4A2MA 1FZJA 2BHUA 2WKOF 1NWOA 4LCWD 2BNUB 2I69A 1YJDH 3H9SE 4PRPB 4Q9BA 1PG7L 1TQCB 2FBOJ 2J1WA 1BSIA 4R2GD 1T6WA 3VFWB 1YY9C 4N9OB 1YMME 5HI3C 2FGWH 1JF1B 2VMJA 4JGUA 4Y88A 1ETA1 4ZUWA 2JELH 1MLCB 3QQ9C 2DBLH 2W07A 2BDNL 4ZMPA 4DP9X 5C0CD 4WTQA 2VOTA 4KY1L 3W3BA 2ZKYA 1T7ZA 25C8H 3BAXA 3WNKA 4A2DA 1RAMA 2BVYA 4GRWF 2DYPD 2K78A 4P49A 2QLVB 2D03H 3NBNA 5DA4A 3VXQA 1TZAA 2E56A 2VQ4A 1A3RL 1A7PH 5KAQG 5A7BA 4JX0A 1IEBB 3UJTL 1WZ1L 3QCUL 3ULUD 4HULB 3PQYD 1J5OL 3W0WB 5ABDE 5FOJA 2D2CC 2BMKB 5B7MA 1RZFH 1KDIA 3QJRB 4Y19B 4P57A 3GUTA 2A9ML 4UQAA 2EVHA 5I28A 4K2UH 4UCFA 3IK2A 4E9YA 2EXWC 4WO4D 2VDQH 2VDMB 2OPCA 3U2IA 4NBXB 2C9PA 2PPDA 3EF4A 4WW2A 4JDZB 5KVFL 1FYTB 4MMYA 3ARFB 3N42B 3FTWA 3Q2VA 2ED9A 4R97C 3QHZH 1SN2A 1AO7D 2DI9A 2VDKB 1C1EH 5HHVH 1GS8A 4HS8H 5HJDA 5LWYL 1RZJC 5GSVB 3NEXA 1CBVH 1TDQA 5TJWK 4YE4H 4KDVA 3RJOA 1A4CA 4PSRA 1NM9A 4HUUA 1KB5A 1EZLA 4B0MM 4DGWC 3K1KC 5CP7B 4B50A 3PWPB 3O0RH 3BP5B 1KEML 4M4RA 3VW3H 4WHCA 1RUMH 3L5WB 4FG0A 3L5HA 4XVOA 1UB5B 4UIKH 3RGVD 2HXAA 3MCKB 3NACH 4NB7A 4OCNC 1IM9B 4WNSA 3FUKA 2VUYA 3IN0A 2EP6A 4TQIA 3FB7B 3CDGA 1VZIA 5DGRA 2X05A 4QRRE 3IGLA 2OR9H 3TT3H 3RU8H 2DQMA 1XVSA 2R27A 5E6RB 1T22B 2R56L 2E7BA 4BFRA 4DOHE 4LOEA 3OMIB 4UMGA 2QPEB 3KR3H 2BVTA 3ULUH 4NWTH 3RWCB 3KYNA 3EYSH 4G6ML 4B95C 2YGQA 3C5SA 3K8MA 4YDKL 2QQNL 4RVBA 5EU5A 1A21A 2AQPA 2X6UA 1E5UI 1N5AB 3EXJA 4GKSB 5FOBA 5KJRL 3V4PA 3MCLH 4IRJB 3GIVB 4JDTH 5EZPA 4MNGE 5JIIA 3QDGA 1I1YA 4MMXA 4BK5A 3PJSB 4KVNH 3HI5L 1E5CA 3CFJB 3GINA 1JD9A 3OX8A 4PY8I 2GC7C 3WKPA 1W72A 4YPGB 3MUZ1 2EDRA 2YD1A 3FB8B 4ZS7H 5KZCD 5GGVL 3VFSB 2C7FA 3G5XA 4HGMA 4I13B 2I32A 4W1TA 3ISYA 5EOCL 1HXYB 1ZVYA 2X1OA 3IM1A 2E0PA 2UX7A 1B0GA 4JPSA 3BT0A 2DQUL 3KPNB 5TFSH 3WTVA 4DKEL 1DBMH 1I1FB 1BFSA 4BWWA 2XN0A 4K94C 4KXBA 5CGMA 1H6FA 5AZEH 3CFDA 4KXAA 3THMH 2W65B 3GNML 1JWSA 4R7XA 4KVCH 2BNRE 4FZEH 5CJOL 5F89A 3P0VH 4KRPB 5E6IB 1JZEA 4X9HA 1RUPL 3MV8A 2RD0A 3SOBL 4KROC 4XMLL 4X98A 1AC6A 1JPST 5MEQA 3O3AA 4LGSB 1IGMH 4CGUB 3I50H 1EFXD 4YO0A 1RULH 3IDXL 4HBCL 2QPUA 2UZYA 5C0BA 1DO6A 1VIWA 5T3XL 1UT2A 3GMNA 1AR1C 2DMHA 2EH8H 4G7VL 4IGBD 4KQ4L 4GXUM 4XN1A 3PAVA 5GZOD 4AI7A 2AJ3A 4EI5D 4GW5B 1G6RB 5SWSE 3HUJF 3RDTD 3O4OB 4OGZA 2ODIA 3RVXC 3U1QA 4RFNC 2CGRL 4TULH 3QH3A 1EHAA 1P4LA 2QPSA 3G9AB 4OZFB 1JI1A 3REVB 1N9PA 2F5BH 3FT2B 3OKMB 4QY8B 5F1OB 5ADPL 1INEL 3QJFB 3PHOA 3BH9B 5JPNA 3PXLA 4W4OC 5DZNA 1S7TA 2XWXA 3O6KL 4K7PH 5FUZH 1IAIL 3U82B 1H8NA 2O6EA 2JNZA 3WEXB 1X7TA 1N0LA 4LLVA 2QADC 2FK9A 5GGTL 4FA7B 1FV1B 1FJ1B 1F56A 1OTTD 1B0IA 4NFBA 3G5YB 1P5UB 3BCFA 1O6SA 2WLZA 4F2ME 1KN2H 2NMSA 2HH0L 3NSJA 4A2HA 2CQVA 3PWVB 3EDDA 5GJSH 3T3MB 4U1HB 4R4FH 3K2UH 3KPLA 3MJ7A 2QSCL 3EGSB 3N5AA 3Q8BA 4IBWA 4XPTH 1KV7A 1NCIA 1GJWA 2W59A 1RHHA 5G4OA 1MI5B 4G6FB 4XCCH 5IESL 2VDLB 4JEGB 4ELKA 1KLUB 3KHQA 1GR7A 1D6VL 3KPRD 3MNVB 2CJ3A 2NY4D 3L9YA 3AG1B 3EG9B 2QELA 1J8RA 2FT8A 4MKMA 4KU1A 3HLAA 3WHXB 3H9SB 4Z78B 4BUGA 1ONQA 5IMLA 3QA3A 4DZBB 4PRID 4JGMA 1JSYA 1YMMB 3A3YB 4NQDD 5BV7L 2CIIB 4LHUG 4XNQB 7FABL 4H8WL 5IQ7H 1F4WH 2VDNH 4UYPA 5DJYB 4P23B 3VRIB 1WCBB 3FH7A 4JFOB 4NGHH 2G2PA 4ZW7A 5BQ7B 4JY6B 4EUPA 4HA1A 4DO4A 2HKHL 3OC5A 1QLFA 4NUMA 2QQQA 2W9EL 1SEQH 2E27H 1KCKA 1LJMA 4ZQKA 4Y1AD 4ABVA 3GMPA 5CJBA 4M1CC 3RG1C 3QI9B 3QVAA 1BF8A 3Q3GA 5AW5B 2V3DA 3U4EA 4QWWC 1CFNA 3BZFB 5KG9A 1RY7B 2BVEA 2EIMB 2NY7L 2WZ6A 3VTMA 5DYFA 3TO4B 4NZ8A 4Z0XB 3UO1H 4LIQL 4FKHA 3AQZA 3HZVB 3T1FB 3WFZA 5IJCC 5GJTH 4XC3H 4J6IA 1TKWB 5MHSD 5AW0B 2A9DA 1QKZH 4L05A 4W70A 1W16A 1SF3A 3QHTC 5AOJA 5D1QE 5LBSA 2CBPA 1COBA 3WL9B 4IRZA 3WYRA 3LQZB 3R1GH 4LAQH 3BWSA 2XNAB 2D0HA 5DUJA 1OTUC 3QDAA 1DJGA 1G4MA 4XNUL 2GG1A 5HJ3A 3H7BA 2ZX6A 2GIXA 4YHOH 2ICWA 1LO3H 1AXTL 2Q7AA 2VERA 3FTUA 3NP4A 4XNYH 5JNYA 4YSCA 1CLVA 1CFSB 2Y2WA 4JRXA 2AS5M 5IEKA 3C8HA 3SY0B 3MROB 3WFDL 3EOAA 3IRCA 4Y4KD 2OYLA 4KK9C 5E4EB 4LL4A 1ZT7B 5B4MD 2IF7A 2C9VA 2O61A 1D7BA 1JZJA 1B6UA 3D07A 1ZLUK 3VWKA 1BZ7A 3IDUA 5SV4A 5FUOL 4B9PA 2CRZA 4BZ1L 1AGCB 1MFAH 3ETSA 4OJAA 2YHGA 1RH8A 3CFBA 1CFTA 2CO6B 2VLKE 4QRRB 4N2AA 1ZGLA 2WZPD 4FFVD 5IQMA 1X9LA 4DOHB 3CSTA 3ZJAA 1YJDL 1HOCB 2FSEA 2NSMA 3BH4A 3RGBA 5FEBA 2EYTB 3GSNB 5J6GA 2FQEA 4I3SH 2D7MA 2OX5B 4P4RA 3KLHD 4YZFE 3N91A 4EN3D 2FGWL 3F5WB 1CIUA 4JJHA 2WANA 3HZKA 3NAAH 5CCKH 2CNYA 1G7PA 3L3DB 2C3GA 2WTRA 4HIHA 1BJ1H 1IAMA 4MNGB 1U8QA 3HRPA 3QWRD 4CDGC 2EYRB 4N8VA 5F44A 5FYLE 3HJEA 2X5PA 4FQIH 1J0YA 1PLCA 2V8LA 3ESMA 1P6AB 3QFDB 3ZPDA 3NJNA 3CN0A 1O7SA 3P0GB 2WCPA 1KIRB 3IFNH 3ES6A 4HKBA 1CL7H 4UDTB 3CHXA 4N8PA 1A7PL 4ZPVB 4MAYC 4UYQA 1CTMA 2CUIA 2XV2A 1BEYL 2E75C 1CGXA 3BISA 3F6LA 5JIDA 1MJJA 5EULV 3SDAC 4OGYL 4I48A 4G82A 1FHGA 2GTZA 1GKEA 2XRAH 1HS6A 1RZFL 4ZUSB 4DIXA 2EICA 3GTTA 4TQHA 2FIKA 4K2UL 4MDRA 1OAKL 5IJKA 3GXMA 4HHAB 2BNRB 4NAQA 3UMTA 2C9XA 3LQAC 3NJFA 3NJVA 4PBDA 1MZZA 2GPZA 5EN3A 3L4VA 3VFMB 4HWBL 3QHZL 1PBYA 4JN2B 4J3OD 4NQVB 2EDJA 1C1EL 2R2EA 5HHVL 3OKKA 1E9OB 1ILSA 5TDPB 1CBVL 4TLTA 5JA9A 1XIWA 4YE4L 4C56A 1M05A 3DMMA 3DX9B 2EINB 3N06B 3WIHH 5GS3A 4FG6C 5I8KH 2VABA 3NJMA 3O0RL 3VW3L 4Y0GA 3ZTJG 4N0YH 4NNXA 1RUML 1UQSB 1P7QB 5CUSH 5MEND 5SWSB 2IAND 3QORB 2YRBA 3DX0A 4UIKL 3QFJE 4QLWA 2NY5H 2XACC 3NACL 3O11A 4IU3B 3WFCH 3MJ9H 4J39A 3DVGA 3Q44A 2AEPH 4OCXH 4A2LA 3D1MC 1PX3A 1SYSA 5CJQH 1T20B 3O2WH 3TT3L 3LTVA 3J07A 3M88A 3H9YA 3RU8L 4FZ8H 2XZZA 3KG5A 4XMPH 4CW1A 1MIEL 4LCCC 1R5VA 1T7XA 5D1XD 1M1SA 3ULUL 3LQAL 5ITBH 3UZQA 4TM9A 3MI6A 4UT6H 4P07A 4ODHL 2GTWB 4OD1H 4UB0L 2X3CA 1IQDA 4H0GA 4Z95L 5ICUA 4YMPA 1HXMB 2IGLA 4V1DD 5TGBB 3CFKA 4C55A 3VYNA 4ZTEA 3X1GA 5B3SB 4F2MB 3MCLL 3G5VB 2WO3B 1BXXA 4JDTL 2FT6A 1WD8A 5F3BA 2BY1A 4HJTA 4KVNL 4N2FA 5I1AB 5I1DB 3K5SA 4PWGA 2X4TB 4YVUA 4AYSA 1PX8A 1TXKA 4EIGB 4J3OH 3W9DB 1HAWA 1NCBH 3ME0B 4NAMA 4ZS7L 5KYWB 1RLBA 3RFZC 2OXGB 3UDWC 3U30C 4GRWH 4X5XB 2YA2A 5E95B 3H3KA 3EJZD 1OKEA 1IGYB 3QDGE 1UKSA 4GYBA 4CVZB 2P8LA 3BPLB 1DBML 3WKQA 1YYMH 4JLRB 4J3BA 3GO1H 5AZEL 1K9TA 1KPVA 3JZYA 3VGAB 2K3TA 3THML 3KYKH 3CVDA 4FZEL 2EO7A 4PD4J 3W0WD 1IBZA 4HCFA 5JW5A 3HN8A 4OKVA 1NGPL 4Y19D 3NRQA 1WSST 5ANME 1OP5H 1XF2A 5LHDA 1IGML 1MFMA 1M7IA 3I50L 3LKOB 3VFRB 1RULL 4BA0A 5MI0C 4PJDA 1I7RA 1NANH 1U8PA 4N0FB 1I8LA 5FKPA 3C5ZA 2EH8L 1AD9B 2ARWA 4YSRA 4K7PX 1TQBC 1FYTD 1PL3A 3ARFD 2N7BA 3FB5B 1WC7A 4AM0A 4CKVX 3RWEA 4PQXA 1LILA 3ZQ9A 3G9VA 4LLQA 4NFCA 3EO0B 5ICYA 1SXCA 5HY9B 1ACZA 2ERJB 3HC4H 2XOTA 1WA0X 1SMAA 4MB1A 4DN3H 2WXOA 1U58A 2OP4H 2O1AA 4BK8A 1O7DE 1OHQA 4G9DB 4RGNC 1U8OA 2F5BL 4ZFGH 1M2OA 4X99A 5D1QB 1T0PB 1NKOA 2G2RB 1Y07A 5EO9B 3IU4H 5HYSG 4NC1C 3D5OF 4LEOA 2AZAA 1CPUA 3FQ4A 3BZ4A 5F7NC 1RK0A 1X3DA 2DYRB 3L4CA 3LB6C 2BINA 3QPKA 3RRQA 3MRGA 1HNFA 3VXNA 1CE6B 1YN7A 5I19L 2HKFL 1Z9SB 8FABB 3RKDC 4PJ9D 4EI6B 4U31A 2W8CA 5ETUA 3O3DA 2FO4B 4EXPX 4PYHA 4GUPA 3MGTA 2EEDA 2DWDA 3K2UL 4R4FL 5DK0B 2EH7L 3L1OH 5D2LA 4HJ0C 2YOAA 1K4DA 2VXQA 2C9SA 3QQNA 2HJFA 5F7UA 3UYRH 5E5UB 5J1TC 5J12B 3QS3A 4IRJD 5BZWA 3Q5OA 1L9SA 3RVWD 3NTCL 1EDHA 3PGFH 4OGAC 2PWFA 5EUKB 4PS7A 2VLKB 5KSBA 1SLUA 4F5CA 4OIBA 4X6DF 2VIRB 4X7EC 4NHCH 4L8DA 3WI9A 3V10A 2WVVA 1JWMA 3P30H 5CZRA 2ZXWB 1ORSA 4N68A 5GS2H 5IMKB 3U6XS 4IKJA 3WJLC 1FZJB 1F4WL 3DPDA 4MQXD 2VDNL 5CLWA 4NGHL 1T5WA 3MRJA 4XZUA 3E8UH 1ACYH 1SEQL 2E27L 1U36A 4KRPD 4ZUWB 2FQDA 1KCBA 5E6ID 5GS0D 2NOYA 2J5LC 3VE0A 5DD1L 1DVFC 1FRGH 3AWEA 5AB2A 5TQ2H 1F8TL 1Z0MA 4AIXA 3NDYE 3ZOAA 5K9OA 3NCWA 1K4CB 2XZAH 4XOEA 2AQ1A 5IJBC 3PABA 3MBEC 3WD5H 1XZ0A 1MVUB 5AOMA 4WKZB 3WDHA 3VXQB 3QG7H 5IVXA 4BINA 2VJ0A 5FLVA 3NP3A 4G8FB 5GJTL 1AZBA 4OF7A 4R96A 4RAHA 4XC3L 4MYWB 1QKZL 4C59B 1KXVA 4XH2A 2AXWA 4ABWA 1UM6H 3U0PA 4Z7VA 3MXVH 4Z7NF 4FKKA 3GUTB 2EXSA 4LAQL 2MOQA 2R8SH 1SXSA 5I5MA 3QCTH 3QZNA 4JFUA 4KDWA 2PO6D 1QPXA 5IHUL 1PD0A 1LO3L 2V5TA 3GSOA 4XNYL 2KYIA 3FHEA 4JZNA 4MCZA 2WBJA 1DDHB 3QWNA 2BVOA 4PJFA 1KCVH 2ZOUA 4MMYB 4HWZA 1NIDA 3LS5H 4I18A 2ICWI 3ZE0F 5C92A 2F68X 3BFQG 3AG3B 3IRZA 4I8DA 3ARGA 4P5MB 3QFJB 5C97A 4XCNA 4JRXE 1KB5B 1MFAL 3HG1D 3QXWA 4FXGC 1AZUA 2MCMA 3BN9C 1MCRA 4RMTA 1L9NA 4M4RB 1B2WH 1E42A 3WCYA 5LKNA 4PEEA 1IMHC 1OPGH 3C60B 1EZVX 1NEZA 4XO3A 4E5XG 3KWWB 3OR6A 3N55A 4M7LH 1ADWA 2CUAA 4I3SL 4B9GA 1UT1A 2VR9A 4YDVA 3FSOA 4UNIA 2ZUSA 3EJSA 3JWNH 4LO9A 3OPZH 3H9SD 2X1WL 5CCKL 2P5EA 1CQKA 3DUSA 2G2NA 1LEGA 2V33A 4ZMLA 1INQA 1N7MH 3KYNB 4R6UA 1I3RA 5AD0A 3OLIA 1OAYH 4X6BB 3GLEA 1CLZL 2FUTA 3IB4A 4OZFH 4X0NA 1UXLA 5EU5B 4FQIL 4Z23A 5HHNA 1P9MC 4P23D 5FOBB 2AQNA 3WJMA 4RZCA 3V4PB 3ZKMD 2IH9A 3N1MC 1U4EA 4PSPA 1CL7L 1KY6A 3QDGB 1I1YB 2TAAA 2UUDH 4MMXB 3Q7JA 2AJZB 1SXAA 3VNZA 4FKEA 4JREC 3PWJB 2NCEA 1W72B 1KXQA 3QJHA 4WW2F 3RWIA 1NC2D 5CIPA 4IBLT 1KT2A 1WTGT 1Z0NA 2XRAL 3LEYH 4LDLB 2DWSA 2R1WB 2WQSA 3B6SA 4O2FA 3D0AA 2Y7QB 3OAZH 3TO4D 2AKRA 4PFEA 5EBLA 1IT9H 4NX0A 5EO1A 5KSVA 2ZXGA 5E7FA 2LU5A 3Q43A 2GVYA 4JM2C 5ANMB 3IDGA 3BHBA 3CFDB 2APXA 2VDLH 4NUGH 4OFYD 4OLUH 5T5FL 4ELDA 3C8DA 1THAA 3CE1A 5F89B 2ALWA 4GXUN 3GPSA 3S4SG 1QSEA 1X5FA 1XH3A 5J6HA 5K1VA 3QUYD 1GIGH 3O3AB 1BPLB 4M7ZB 3WIHL 4B9CA 2APSA 4YO0B 2CKNA 2XICA 2UZYB 3EH3B 5DTFA 4N0YL 5CUSL 1WIPA 3VD0A 4I3RH 1K8IA 3HPLA 2NY5L 4LSQH 4IBYA 1NGQH 4ZSOA 5FM4A 3WFCL 3MJ9L 4C56E 4IBUA 3LN4A 2HG5A 4OCXL 5F1KC 2AJ3B 4FMVA 2WYHA 5CJQL 4P3CL 5FYJD 2O5ZH 1NKRA 2WXPA 5BUPA 1ZLDA 2O93L 4XMPL 3N9GH 2ZOTA 3OB0H 2FX7H 4N0UA 3QH3B 4JFSA 2NUTA 3RY5A 4QRRD 2WYIA 4UT6L 1V5JA 5H37H 3D2UD 1L9MA 5JPNB 4XO4A 4IOIB 3NJGA 4KGJA 4TNVF 4JMNA 2UWEA 5I17A 4Q6YA 1CXEA 3HG0A 2CLVA 3DUHA 3T2LA 4XHQA 5ID1B 4FYQA 3BVXA 2ZAIA 1NCBL 1O6SB 4MBRA 4ZO6A 5PAZA 1AMYA 3V8OA 1TQCC 3TBYA 1J9SA 3QIWC 4A39A 2YSSB 5ADOL 3L8QA 2CUHA 3VD3A 3C2AH 3KPLB 4TNEA 1G7MB 2IPKA 2DEXX 4KI5C 4YDZA 1RHHB 2X1PA 4JG1L 3VSTA 3WNNA 1YYML 4ELKB 4JJ5A 1DBKL 3S35H 2FJFB 4UQ3A 3HZ3A 3TEXA 2NQDA 4PGDA 4WEBH 2N01B 1J12A 2YWYA 5EWIH 3P0YL 3KYKL 3EGDA 5F93C 3KLAB 3HLAB 4MVBD 3VFVB 4WAFA 5FYJH 2XTJC 1S9YA 2KKQA 3UROR 5IMLB 4DCQB 1Z6JT 2GJ6A 3R0NA 3WEMA 1XCWA 1EAQA 2FWUA 4U2ZA 1AHMA 2BNRD 1EZSA 3TESA 2XZQL 3WTSA 1CVSC 5DZLA 5A16A 3MTRA 1EEYA 4P5TA 1UUSA 3FULA 5F7MC 5I15H 1ZXKA 2A9NH 5CLZA 5DT1H 4EUPB 4FAAB 1F11B 2E59A 3GSNH 4PJDE 1HQ4A 3GSWB 2Q86A 2OSLA 4EPSA 1X5YA 5DFTA 5E2UH 3T4AA 1SF5A 3HC4L 3Q3GB 4HK0A 4TS6A 3KXFA 2K6YA 2WQUA 5KG9B 1KNOA 2J71A 2O26U 1P7QD 4ZFGL 4IOSA 2FIRT 3P40A 5SWSD 1M3IA 1Y0LA 1QYGH 1OY3B 4TPRH 3IU4L 4JG0L 3RIAF 4BRJA 1OHZA 5A3ID 3P11H 1DLFH 2X89D 1BVLA 5IHUH 2DS4A 4PJIE 5C2BH 3CC1A 4X4ZA 4YEEA 1UVQA 2P4AB 1U2HA 6TAAA 1E43A 2W0KA 4WVRA 2F8XC 4ZMAT 3L1OL 2YS4A 2ICWB 2L04A 5J3HD 1ZLSH 3STBA 3UYRL 5JNYB 2DD8H 1AGDA 3MFFA 4JRXB 1JXGA 4KJQC 2VDML 5IEKB 3SQOH 3A4AA 1D9KC 4MZRA 3C8KA 3EOAB 3CVCA 3RPBA 1CGUA 1MWAA 3IDYC 4XRCA 3T6XA 4AZ8A 2OA9A 4POZC 3A6CH 4YSQA 3VWKB 2VL5B 1IBGH 2VDKL 1BZ7B 5D7SH 4NHCL 3BFWA 1V54B 2ENQA 5H94B 1C08B 2XBZA 3ARSA 3FU9A 5DC0A 3VWJD 3ZDWA 2OMVA 3N04A 3CFBB 1CFTB 1XR8A 4HJGA 3P73A 1S78D 4OLEA 5KSBE 1ZGLB 2WBWB 3TBSB 4Y5VA 3WSQH 4F5CE 1OP9A 3EYFA 3FCGA 4MD4A 3D50A 4EQ2A 1F02I 2FSEB 3P4NA 4YDJA 4J4PD 1ODUA 1JZ7A 4Q4EA 4TL4A 4F7CB 1PPIA 4P4RB 3E8UL 2XV0A 2G4GA 4NRYA 4NRZB 3UPRB 3BKJH 4Q9RH 3HE7A 1HIMH 2XVBA 2AVGA 3HZKB 1LEIB 1A9VA 1V3JA 3T8MA 5IHLB 4HXBH 3VACA 1G7PB 1FRGL 4YSAA 3C75A 4HIHB 4FN0A 5TQ2L 3PWLA 5D7JA 3M46A 3GF8A 2DKUA 4N8VB 3PWUA 2XZAL 1I31A 3ZT5A 3ZHFA 5F96H 2FJUB 1DQMH 4X5LA 5DMIH 3S7GA 4UM8A 3BD5A 1UOWA 1YNKL 1HHJA 1J9QA 2I7SA 2KHAA 4NJAL 2NCMA 1TU2A 4OIFA 5IT2H 1UM6L 4UOW1 1AGBB 3MXVL 3T65A 5I6NA 1XMEB 5IVXE 3B2PA 1KZYA 2FIKB 2VW7A 1N5YH 12E8H 1XZWA 5C8JA 1A3LH 2KZBA 3RNKA 3UO8B 3MAWA 4HS3A 2X2JA 4WO0A 4Z7VE 5DJCA 4Z3GA 3OGCB 1KCVL 2G3MA 2O72A 4RCAA 3LS5L 5DU7A 3IT8D 2WQAA 1DQLH 2HT3D 2R2EB 4F7PA 1AGFA 4FQLH 3OKKB 2J44A 2BVPA 1J5HA 2FJGA 1XIWB 4WK4B 4LRNH 3DMMB 4C56B 4CVXA 2XXMB 5GS0L 1PEWA 4PJFE 5C0RH 1B4TA 2G75B 1BZ8A 3OKYA 4QRBA 3QDMA 4RMSA 5CEXA 1B2WL 4NNXB 4C47A 4LVHC 3ULVC 4XBMA 3NK4A 4MA8L 1DCEA 3BPCA 1OPGL 3LXBA 4NO0B 4EO5A 4OZIE 3V55A 3OLEA 3ZKXB 1P5UC 4F80A 1ZJAA 2VLKD 1SQ2N 5JXEC 2ZE0A 4YLBA 1CYGA 3HA0A 4XMXA 4AC4A 1M2VB 3VGHA 1OP4A 2NZ9C 5A1AA 3MUGA 4TKWA 4CW1B 3MLVH 1R5VB 2LW3A 4YSTA 5BPPA 1G6RL 4IMKC 2WZ5A 1C5CH 1H9VA 2CR6A 2K70A 1N7ML 5D7HA 4LVOC 1H3UA 2GY5A 3FQNA 1UJ3A 1HILA 3V6FA 4ZXBB 3ULAB 1Z9OA 2D2OA 4W9FC 4AEFA 1NUNB 2HJLA 3CFKB 3VYOA 4AYGA 2CLRA 2VR5A 3QJVB 1HKFA 4O51A 3KCPB 5JW4R 4NZTH 2E7CA 3TCTA 2DYSB 5FYLD 5L88H 1NAMB 3T2NH 2EIJB 4URTB 3WNIA 1L9RA 1WT5C 5D6DA 4G1MA 3WLBA 3LEYL 3LZNA 3O9WC 2B2XL 2ALAA 2YWZA 1VFOA 1KB3A 2JCWA 1KXQE 2Z7UA 3KE0A 3V6BR 4UOZA 4FQQA 4K3HA 1IGFH 4WHYH 5JQHC 4ONFH 3I6GA 4ZTOH 1DVZA 1KPVB 2KZ1B 2VDLL 1TJGH 4NUGL 4OLUL 3ZKND 3B9DA 4J1UB 2ADGA 4JFYA 4OKVB 2HT4D 5CBEA 1JV2A 4YSEA 2VO8A 2WINB 5I1EL 1GIGL 1XF2B 4YDNA 1SMOA 1M7IB 3BLKA 2NW3A 4Q74A 4PJDB 3OR7A 4TSAH 1U8PB 4A7UA 4E2OA 1MF2H 2EEXA 4I3RL 5FKPB 5AVVB 3ZMNA 3C5ZB 1QSEE 5C70A 4LSQL 4BZYA 4GMSH 3G08B 4TN9A 4JKLA 1Z3RA 3DXAA 3MJGX 4OJYA 5IGXH 1E8YA 3U7AA 1WC7B 4AM0B 1D2PA 3RWEB 2WXRA 4HOWA 3BCDA 5TE4H 5LGHH 1L3NA 4LLQB 3PL6C 2VN5A 4ILDA 5FHBH 2AK4A 3ARDA 3GSRA 3N9GL 4GEJA 5DD0H 5DZOA 3OHXC 5FYLH 4C54A 5BCAA 5EA0H 1F97A 1U58B 1E30A 3UTQA 5JPMA 3P2BA 4PREB 1X44A 2P1YA 1U8OB 3ZE1F 4X99B 1YEDA 5D5MA 2A9CA 4XN8A 1Q1JL 4PJIB 5HTSA 4E41A 2VAAB 3H8NA 2MRYA 3TF4A 4N0UE 2KDYA 4JO1L 2BWQA 1BQLH 4LEOB 1XAKA 1RK0B 1YEJL 5C0AA 3VXNB 5I1LB 1YN7B 1GSKA 2E74C 1J18A 5CZVH 2B14A 3W9EA 5ETUB 2HZHA 1SM3L 2EIBA 4ZPTA 2AI0H 4GUPB 3MGTB 2DWDB 3KDMA 2X4NB 1K4DB 2HJFB 2AXFB 3FT4A 3MUY1 3IMSA 4FQHA 2Q8BL 4PJDF 2UZIL 3LNIA 3QDGD 4AMXA 4WEBL 5EWIL 4WNJA 3AMLA 5KSBB 4YXHL 4IDJH 4PPTA 4PVMA 2M1KA 1SHSA 2WVVB 3BKYH 3AACA 4NQQA 3BZEA 2J57A 3K5RA 1YEEH 1NDTA 3PJNA 1G9NH 1KB5H 2WXNA 4XCEB 3BP6B 4KH2A 2OSYA 2KLSA 2XA8H 1MFDL 4PY7B 1A0QL 2ZXBA 1S6NA 4ESKA 3BVTA 2A9NL 3P1VA 1SXNA 2BP5M 2GJ6E 5DT1L 5LQBL 1G87A 4PWJA 3GSNL 1NSNH 2APTA 1AMXA 4K7PY 5FUCE 4QRUB 2V37A 4NZUH 5E2UL 4N20A 3GQFA 5EB9A 4O2CA 1B6DA 2BOCA 4PRBA 3UPRA 4MZIA 2QGDA 1H5BC 1JV5A 4LOUC 1JHKH 1RFDH 2XWBA 4UUJA 1IM3A 4QCIA 3N6YA 4RQQB 2SEBA 1XF3B 5C0BD 3WNMA 4BJLA 5D1ZA 1ET7A 5C7XH 1KYOK 3B9KC 2A38A 5IVOA 1BA9A 4TPRL 1HH9B 2FJHB 2WLIA 3LV3B 4YHKH 3KNBA 5C0ND 1AG0A 5IVXB 2KT6A 1W9XA 2DH3A 1ZRUA 3KXFE 4P2QA 4R96B 4JQVC 2BY0A 1PAMA 5D2LF 2DJUA 3V4PH 3P11L 4L2LA 1DLFL 2CHNA 3DX3A 3EAKA 5I1IL 4Z7OE 1QEWB 4Z7VB 5A2AA 4JFEA 5K9QG 5C2BL 3QORC 4CMHC 1W72H 4OKDA 4X5WB 4BGDA 3GLAA 4H5SB 5D2NE 5JQ6H 3SDXE 4A1RA 4YSSA 4TUOB 1KTJA 2TRHA 2VXSL 3MCG1 3P2TA 5A2LH 3GSOB 1ZLSL 2DD8L 1LVEA 4MCZB 3HB3B 1G0YR 2PP8A 3QO1A 3SQOL 4PJFB 1R9FA 5BOJA 4Y16A 2Z8RA 4DUVA 1I85C 2M83A 4HWZB 4I18B 3GSUA 5BS0A 4MMZC 3A6CL 3ARGB 4U7KA 3SD5A 3QIBC 5TDNB 4OZIB 2QTVA 4MLSA 4XCNB 5D7SL 3VX0A 3BVDB 3O4LA 3U4AA 2CHZA 5DK3A 3SYQA 3IFPB 1OM9A 1ITBB 1UA7A 2CK2A 4UU9A 4U7SA 3N1FC 2ZT9C 4S1QH 5DJXB 4ELMF 2WSDA 1X5KA 2L7JA 4XXCA 1KCUH 3OR6B 3A67H 1JK8A 1U3JA 3KLKA 1NCCH 2CGZA 4QRAA 3SKUD 1ZPLA 2V9TA 4LP8A 4AV5A 2ZKXA 4YDVB 3KWXA 4GAAA 5IBUB 3WS6A 1JD7A 3D0VB 3QEUB 3PV6A 3ZDYF 3BKJL 1NBZA 2VRQA 4M6MH 3S88H 4Q9RL 4KKCD 5IVXF 4HXBL 3BP4B 1LEGB 4QKTA 2EDLA 1INQB 4G9FE 1DJYA 2XV6B 1I3RB 1KENH 4YFLI 5LNGA 3W57A 3P3TA 3QAQA 4Z7VF 3QJSB 4JZJC 5F96L 1DQML 5HHNB 1AD0A 4HBQA 4H8VA 4AC2A 5E9NA 5DMIL 2R83A 2ZKHL 4MJIA 5EF2A 2J25A 5AALA 3NGBB 5LGJA 1GC1H 5FA3A 4GP4B 2BW5A 5JHLA 5IT2L 4JUSA 3BMVA 3RWIB 2X70A 4PJFF 3SKMB 1KT2B 4N2CA 4BBWA 1E4JA 3K4AA 3CZLA 2NUPB 1J0HA 1T7YA 3L3KA 1ZVNA 3RNQA 1FLTX 1CO1A 1N5YL 12E8L 1A3LL 4HWUA 4J7RA 4O2FB 2DL9A 2XQYK 2H2SC 5EFIA 5EO1B 1NKGA 4FP8H 1GYWA 3BHBB 1HWWA 4NM4L 1AANA 3N85H 1U92B 2Y5EA 4XN2A 2IWEA 3H3PH 4FQLL 2F1EA 1QSEB 5SWQA 3V6ZA 3KBHE 1MDTA 2X4PA 3I6LE 3QPXH 5D1QC 1XH3B 4LRNL 1YEKL 4U1MA 2GQHA 1HC1A 2E6QA 3MA7B 2B39A 4TUJB 5C0RL 1WBYB 3WEOA 3LRKA 3CJJA 1U91A 3RZWA 4NZDA 1RJZA 1K8IB 4L3FA 3AW5A 2WXLA 3HPLB 3HE6C 4JRXD 3W82A 2VZ3A 5DJ0A 1UCBH 2HG5B 4AIEA 1EZVY 2EDBA 5FS5A 2C4FT 3QDME 1MRFL 4EUPH 1A6ZA 3VWKD 1BQHB 4DWHA 2Y69B 5A43C 3MLVL 2CO3A 1R33A 4N0UB 2V8MA 3BGFC 3OTTA 2C4XA 1C5CL 4U4BA 5J1AA 2NUTB 3PHSA 4DO6A 2XN1A 3DIDA 4JO8A 1WAAE 3JXAA 1R5WA 2XQ0A 4KKBD 3TBWB 5TK2A 5EEVA 2W91A 3RPIB 1BF2A 5J57B 4Q9CA 2PNDA 1S4IA 2DWXA 2JE8A 5I17B 4NZTL 4W4NA 2IXQA 3T2NL 4D0BA 1PIGA 3COOA 2I24N 3K6FA 3B83A 1A2YA 4LKXA 1TCRB 3C2SA 3BD3A 4TV3A 5LBSH 5F6HJ 1NPJA 1WPCA 3TBYB 1VPOH 2YD3A 4IRZH 1MQKL 3JWDL 3L16A 3QYMA 3W11C 5I6PA 1T3FA 5FFOA 5CS7A 3ZTEA 3ZW3A 1IGFL 1X5IA 2D4FA 3LDBB 3QEQA 4JJ5B 4ONFL 1ACXA 1HCVA 4PGDB 5E9DE 4S0HA 1TJGL 2F7QA 2PKDA 1JZDC 2H6PA 3SCMB 1XBRA 4BH8B 5E1AB 4X5QA 5E8DH 4AIZA 5M94B 2GJ6B 2YEVB 1LNUA 4I88A 4ODUB 4KJPD 4OUUB 3ZGIA 5DHDA 4TSAL 1YZZA 4P2RE 4NP4L 1DEEB 4B9KC 1MF2L 4FL4B 5A16B 4MDIA 2BIPA 4JHWL 1BMZA 4P5TB 1DANT 5HDBF 4HCRA 1Z2KA 4GMSL 2E8YA 2APBA 5IGXL 4BH7B 5C71A 2YAHA 1HQ4B 3BEVA 1JGUH 1KOAA 5TE4L 5LGHL 2OSLB 5FHBL 3GMOA 5FYLL 1XIWD 1QAWA 1H3VA 2UWEF 3DMMD 4YWGH 5EA0L 4HK0B 4C56D 3K4ZA 3DXAE 3HR5A 5B8CA 3KXFB 4HMEA 1EJ8A 1MXGA 1EVUA 1BXAA 1KNOB 4L0ZA 1H0DB 4NO0D 2VH5L 5AOKA 5E8EA 5EMYA 1Y0LB 2AK4E 4Z7OB 5HD8C 2DB8A 5B1JC 3C09C 5E2TH 1WGOA 1ZS2A 5DRNB 3WFHA 5CJ8A 3LIZL 5D2NB 1BQLL 4HISA 3SDXB 2NZ1A 3FZUC 5BZDA 1HINL 3L13A 1U3YA 1BVLB 2GABA 3ESNA 5D5ME 3NIGF 5CZVL 4IRSB 3C60C 5CNHA 4L8SC 1HEZA 4HKXA 1UVQB 3Q13A 1TOXA 2AI0L 1TO5A 3APMA 1MFBH 4BFFA 4I0PA 5L2KA 2JWYA 3X3GH 2B1AH 3GS4A 2DJ4A 2ITEA 1OARH 1AGDB 1E7UA 2XX0A 3MFFB 2RB8A 2PCFB 4O02A 4EI0A 3TEWA 1I8IA 3GHBH 3FO1A 1D5BB 2X88A 1MWAB 4AZ8B 1AS6A 4FTVA 5F3HA 4Q6IA 3HS8A 3FTYA 1H19A 1SOXA 1U6AH 4NN6C 2FB4H 4CDHA 2PWHA 3BKYL 5F7LB 4Z7QF 2XZCH 1JRHI 1N59A 3HI1B 4YL4A 1QMUA 1YEEL 1ZA6A 2NPLX 5C08A 3V0IA 2OMVB 1KTDA 2NDFA 1KB5L 1XR8B 4HJGB 3P73B 1F45A 4H7VA 4XVTH 3L6FA 3OAYK 3KVDD 4Y5VB 5G2NA 4IHBA 2XA8L 3EYFB 5KTEH 1NGZA 4F20A 4X7FC 4M3HA 4YDJB 3P4NB 2HTLC 4GSXA 4DPBX 3ROOA 4G9FB 4MA1C 5FDWA 4QGYA 5CLXA 2V17H 1O7VA 5BW7C 1NSNL 1YYCA 2FO8A 2ZCKH 2Y6SD 1Q0EA 4NRYB 5GSRB 4HJJH 4NQSB 5L0QC 2DPKA 4NZUL 3GPEA 4UQ2A 4XWOC 3H6AA 3WNJA 1KJVA 2UY6B 3SBWC 1ZLWH 2EO9A 3HFMH 5L9DH 3PWLB 4NO2A 4MQTB 4XMVA 3LRLA 5D7JB 1KGIA 5EBWA 4UV7H 5C7XL 5I16B 5HYFA 1ZHNB 3C5ZD 3TPKA 1KACB 3KVQA 1VESA 4YHKL 1P7KA 3FAXA 4J3OG 5KVDH 4IBQA 3LX9A 3V4PL 4HCIA 4M7ZC 1HHJB 4TOYH 1NFAA 5IB1A 4CMMA 1TU2B 3FUJA 2Q6WA 4O5LH 3PE9A 3DROA 3T65B 1SJHB 1W72L 4J28A 1P69B 3OJDA 5JQ6L 1NCDH 5DEJA 2E9IA 4HPYH 4RWHA 4EIZC 2I5YH 4HS3B 1H6UA 4OFQA 1BZ9B 1JHLH 4GIPD 5AQ0A 4KKRA 5GGQL 5LDSA 3LVTA 1L9PA 2GJRA 5DJCB 3IXTA 3NJKA 1EMTH 2EUVA 1QFWM 5CGYC 4N2IA 2Z8WC 4HD5A 3UG5A 4ABQA 1TFHA 2F53A 1AGFB 4F7PB 4D0DA 1BVZA 3QCVH 5EG6C 4AQ1C 5D7IA 3IJHA 2AFNA 4WCYH 4CVXB 1O0VA 1UA3A 3BKCL 5E5RB 1NOLA 3AQXA 1M6UA 2DF3A 1KGWA 4ZZFA 1WBXB 2ZWLT 3QDMB 4YFLF 5CEXB 5BS0E 2I7OA 3ASWA 3DWTA 1UZ8A 3QSKB 4Z7AA 1EERB 4ZMOA 3NDZE 4KXZI 3FUDA 1OP3K 1KCUL 4JANA 1XHHA 3A67L 4M6NH 4WV1C 1NCCL 1E4WH 4PLKD 1C9SA 2FLMA 1EPFA 4GAJH 1RIVH 5DJ6A 1JK9A 1KXTA 4M6ML 4LKCB 4RISH 3RL2A 4EEEA 8CGTA 4FNLH 1CD1A 1J05A 1KENL 4LMQI 2NXZB 1UJ3B 1HILB 2LGNA 4QNPE 4BSJA 2KLRA 2HJLB 4LMQE 3TBTA 2CLRB 2FX9L 4P2OA 1L3WA 2YAPA 4FCHA 5LVEA 2MJWA 3ML8A 4YX2H 3FCSB 5CHNA 1GC1L 1L9QA 3MUHL 4OD3H 4CSSA 1QWUA 2NY3C 4WJKB 4R0LB 3UMNA 3WLBB 5BRZA 2IDFA 2JCCA 4MJIE 3AQDA 5E9DB 4BE6A 1T83A 2W60A 5C6TH 1AS7A 2NXYB 2HN7A 1OM3H 3FO9B 3M45A 2HT2D 3CSBA 3CZJA 4PR5A 4ANXA 4FP8L 2VXQH 1EJ6A 4J3SA 3SBPA 4NZRH 4EF3A 3N85L 4P2RB 5B1BB 3WLWD 1NMBH 4AVIA 3AAZB 4JFYB 4AVKA 5E6YA 1DUZB 3QPXL 1A3ZA 3E2HB 2PCYA 1HEJC 3UJIH 1NCHA 4OCMC 2NW3B 3CFIC 4Y2DC 1IKNA 4M6AA 3OR7B 2UYLA 3MODH 5HJBA 1D7FA 1GPOL 3SGKC 3S6CA 3HB3D 2WBJD 4ENEC 4ZQTA 3D30A 1UCBL 3DXAB 5EOTB 4UILH 3TBBA 5GZNC 3SDDA 4F24A 3PAUA 3EJYD 3MRBA 5DHXB 3T6VA 4JFFA 2X41A 3ARGD 1YMHA 3QR2A 4OCLC 5AL8A 2D9CA 5JORA 2AK4B 3TLRA 1AKPA 2WYZA 2Z35A 4GSDH 4KTEH 3PAZA 5ENWA 5IREA 4F9PC 1TTAA 5B3JE 1A4JA 2MQCA 3UTQB 2HP4A 2B20A 5JPMB 3BO8A 1FL6A 2AQSA 5EU3A 1LK2A 2R0LH 1NBQA 5H4YA 1YEDB 2YAQA 5D5MB 4K71B 3S36X 1MEXL 2JJVA 2WWNA 3HNVL 1HE7A 2WKLA 1BHGA 4L3AA 1JPEA 2I07A 2JMRA 3PP4H 4LSSH 1G1OA 1BZQK 4TRPH 5I82A 1RUKH 2Z4TA 5CP3A 2FECI 5AVSB 3UGUA 3IBEA 1E8XA 1WF5A 2EDDA 2P5ED 4YUEH 5F7WC 4B96A 3IGFA 3IMBA 3W9EB 2DWEA 5IF0B 1WIUA 5TD4A 1RZGB 5LBSL 4P5KB 3LAFA 1CDUA 1VPOL 3HC2A 3DRQB 4IRZL 4ZPTB 4B97A 3DX4A 3BXNA 4DERA 2IAAC 2JSFA 4XHJD 4HSAC 2DJMA 2X3BA 3FT4B 1NMAH 3OHMB 1DVXA 3DBXA 2P48B 4AW4A 5EZJA 5IB5B 1YEHH 4X9FA 1TVBB 3L45A 3ZUCA 4HJEA 4CADA 1VRSA 2NY2B 1E2WA 4Z3HA 2QVKA 3VI3E 1J1XL 5ABAA 5D4QA 1MCPH 2LVEA 2YD0A 3UC0H 2ED8A 3LYRA 2WHVA 4MD0A 4QRPE 1X9UA 3TBCA 4RFOH 2UY7A 4K5OA 2GJPA 5DEZA 3BGAA 3TVMA 3GIZL 3JWNG 2YEZB 5FO9A 3BRFA 1MW0A 2YAOA 3C5JA 1H6TA 4WUUA 1UFUA 1OD9A 5DZAA 3UX9B 4IIZA 4QRQA 5D5MF 1JGUL 2KBGA 1Z66A 5GIRA 5I74B 1QSED 2WJ5A 3L4TA 3TOPA 4OZFG 5JLZA 1U8MA 4FABH 4O2CB 2XQYA 1FFNA 2ZYIA 3DVIA 4LSPH 3L3HB 4PRBB 1JDDA 1JV5B 4AX3A 5KBNC 3LD8C 2XWBB 3MREA 1C7SA 4QCIB 4WJG3 4PJ5A 3QULA 4OV6F 3VFPB 1QQDA 1BBJA 1PEZA 2ROXA 3BMWA 4AKPA 2WLIB 5G5DB 1B3JA 2CBOA 4U1GC 5E2TL 3KNBB 3VM7A 3ECQA 1RJLA 2BIQA 4WY7H 3UADA 4CJ0A 1QUPA 4ZMWA 1ZE3C 3WN5A 4K3GA 3L3GA 1BJ1J 2OCFD 3GJFB 4U2YA 3WXVH 2GW5A 3A47A 3DDFA 5CIPH 3GB7A 3CXDH 3FL7A 3J27A 1MFBL 3CVHB 1FVDA 2IJ0C 3OB8A 3X3GL 2R2BA 3L3IA 1G9EA 5CEYB 1OARL 3RI5F 2YQ3A 4WFGE 2FRGP 1F3DJ 5T1DL 5AVTB 4Y16B 4CU7A 4G80A 4ZAKB 4GUCA 3GSUB 5BS0B 5L2KE 2Z7ZA 4DNLA 5CSBA 4R90L 1U6AL 1LP9F 1IJ9A 2FB4L 4KK8C 1LGVA 3B9AA 2YQGA 2XZCL 2IPUK 4DGIH 3LNGA 4I0KA 4WWPA 2ZYHA 1JDAA 1YEIH 4UU9B 2N1KA 4F8OA 4XVTL 4IIQB 1I75A 3R18A 2XPGA 1MCDA 4JFQA 1JK8B 5C08E 1BXUA 4KXDA 4PJ7F 3WJJC 1ULVA 1QRNA 3TT1H 1I9RH 1IC0A 2JK5A 3L1EA 4HJJL 3ZDZF 1A1MA 3CHOA 2WAQA 4ONOA 4PS4H 1RK1A 3VU1A 3V4LA 2BSRA 3HFML 5L9DL 2GJ6D 3SE4C 3I3EA 4D9LH 4OQ1A 4UV7L 1JN6A 2GFBA 1SHWA 1Y6MR 2JJTC 3NCEB 2V2WA 3QIUB 1AD0B 4P5TD 3X12A 1NBCA 4L4VA 4MJIB 2WLMA 1UM5H 5HGDA 3TYGL 5LGJB 3GBNH 4TOYL 4P4KC 1GJIA 4AM0Q 2KC0A 3OZLA 1P1ZB 4HX1B 4BFGA 4O5LL 1NAML 3VM5A 5JIQA 1H9DA 1M1XA 5IFHH 1QFOA 2F15A 3KXFD 3BSHA 3L3KB 3RNQB 2JB5H 5AG8A 1NCDL 3N0PB 3PFUA 4HPYL 4IOSD 2I5YL 3PHQB 5C0JA 1Q0XL 1JHLL 1WDAA 5EFIB 2Q8AH 4PB9H 4JRYA 3QQDB 3TNMB 2E7HA 3V0EA 4NUQA 5DC9B 4ZS6C 3C6SA 1EMTL 3D87B 3RURA 3CFEB 4OFIA 1IGJA 1PDKA 3V6ZB 3TEZA 2E86A 4G8GA 3CH1A 1S7VA 2X4PB 4HPOL 3SGDI 5BMFH 4WCYL 4DN4H 1DVQA 4U1MB 1IX2A 2RIKA 1U2CA 2EVGA 1O5DT 4M7JH 2QJDA 4FEIA 4LXFA 2F53E 1OE1A 1OLLA 1RJZB 1X5HA 3NABL 2GYSA 3IGKA 1QBBA 1K8DA 5D7IE 3SY6A 4P9HH 3AFLA 4M6NL 4TMPA 3FFCA 1E4WL 3H55A 4ODTH 1MJ8H 1AP2A 4GAJL 4L1HA 4AYBA 3CPUA 1RIVL 2X0VA 5DUBA 2JKSA 4I77H 1A6ZB 4QHNA 4Y4FB 1KBBA 2WN3A 4IKIA 1TVDA 5AYQA 1HL8A 1NUDA 4HU2A 1LWRA 3BN3B 4P06A 3FTGA 4JKNA 5B3NA 1IU1A 5E94A 1R6VA 3SB3A 1PYWB 3RL1A 4MXWH 5L4JA 3QO0A 1RURL 4HIIA 1F6LL 3BUQA 1A6AA 1U8KA 2HVKA 4PBWD 1U93A 4KNTA 1JPTH 2CCWA 3PU7A 4FMFA 3DA0A 1NWPA 5DD5H 2IBZX 3E38A 4YX2L 4PJ8C 3C6LB 5DFVD 3NCYP 3JYCA 1ZHBA 4UQDA 3I02B 1J9TA 3NZ8A 4LEXH 4OD3L 3MR9A 1A2YB 4JN1H 4ZNEA 4Q7DA 5D7JD 2DRUA 5B39A 1CG9B 3OVUB 2Y5QA 3ESOA 4GP5B 3WMPA 1QPKA 4Z76B 5C6TL 3FONA 4PGEA 5DS8A 5F1IA 5J56B 1S7RB 4WLCA 5BXFB 1OM3L 4W9IC 1T3FB 3KLHC 3VI3B 5MEOA 2VM3A 2CBTA 5CGBA 3RZCC 1ML0A 1U30A 1VZHA 1GOFA 2EE6A 4QRPB 4WSKA 4GNKB 4NZRL 2NZIA 2H6PB 3EO9H 1MWAH 1NMBL 2OSWA 1QSVA 3K81A 1UACH 4W93A 4HUWB 4AIZB 4U3HA 4XMKH 4UNTA 5DXWA 1FNLA 5AW7B 3IU3A 3UJIL 4NKOA 4BQ6A 3AABA 1XGRA 3D85B 4TSBL 1CFBA 4MDIB 2B4CH 3I6LD 2P8PA 3ZYZA 3VCLA 3HLKA 5G4NA 4KV5F 1YNTB 1L6ZA 2H32B 4K7FB 4QXTA 4UILL 2X9XA 2CBMA 5AW9B 3ENEA 1P7HL 3U0TA 3BEVB 3QUMA 5DFWH 2APWA 4N87A 3GMOB 4JRFA 4KTEL 4DKFH 3L54A 5ESVA 2O4EA 3UAJC 1JVKA 1OSEA 1MJUH 5B8CB 1DSFH 3MLXH 2HTKC 2EDHA 3QDMD 1GW6A 3CLWA 4JFXA 1WFTA 3L9RB 1JXKA 5SX4I 2ZIDA 1QBMH 3GK8H 2R0LL 4JFFE 1E27A 3FPXA 3GS0A 5E8EB 4AH2A 1BVNP 2Y7MA 3IDJA 1KB9K 4U6VL 5DD3H 2HKAA 5TDOA 3N0AA 3ABZA 4E9LA 3WFHB 1KBPA 2YBRB 4LSSL 1R3HA 4ZODA 2J21A 5I0DA 1RUKL 4NO3A 1D7CA 1DUYB 1S9WB 1WS8A 2VXVL 4R26H 3HZYB 4HLZH 4YUEL 4K9EC 5AVRB 2ZSWA 1HEZB 3LRSA 1XF4A 2NXZD 2NDGA 4HWEH 1UGNA 4GH7B 2XG5A 5L2KB 3Q1EA 3NMEA 2CSPA 4HFUH 2DQIH 3DNKA 5DWPA 1I8IB 3FO1B 3OLGA 1T1YB 4Q52A 1UUNA 5F3HB 5L6YH 4OGXH 1X5LA 5ERWA 4XP5H 4CL7A 4IKNA 1K6QL 2OW6A 4GRLC 3VG9B 3CXFA 3QR1A 4W4OA 2Z31B 4YPJA 5C08B 3FT1A 3UC0L 2IH8A 3EOTL 1KTDB 2FCBA 4JKPH 3B34A 3F58H 4FFYL 2NXYD 2VSMB 4AGLA 1QBLL 2NNCA 2CPUA 5EC2B 5IUCA 1NGZB 3CSGA 4L1SA 4UBDD 4WTWA 2ICEC 5JYMA 3CIAA 3OAUH 3QNXA 3EH1A 3ROOB 2CCVA 1UC6A 4YDIH 4XVUD 1MXDA 3O6FC 4IEFB 1G7HA 2EDFA 4P2RD 2A7BA 1ZS8A 2L7QA 4MS6A 1Q9LA 1SLWA 3NFNA 2E3VA 1KJVB 5F88A 2ZX9A 5HDRA 4F1ZA 3NN8B 4LSPL 4WF7A 3B1UA 2PF6A 3MNZA 3HZMA 4WUUE 3QYNA 1DQTA 2WNGA 3EOYG 1Z9MA 3GM8A 2YGNA 5HGAA 1WE5A 3JV6A 1CD9B 2CHXA 2GBVA 5FV1L 2G60H 1F2XK 1WP6A 3DXAD 2DH2A 4ZUVB 1P7KB 2JFCA 3UGXA 3UYPA 1TZOA 4ZD3H 4LDCA 4RRPM 4WY7L 5EZOH 2WWOA 4ZDHA 4CMMB 4QHKJ 4GIOA 2AK4D 3LKNA 3DROB 4YK4C 1KGXA 1P0SE 1GXEA 4RLDA 3WXVL 4WHYG 3OJDB 1AIZA 1I1AC 4XO5A 4UTBA 2QLYA 3L5XL 3UXFA 1PZ2A 1NUFA 1QTYT 1I8MA 1HH6A 1Z9NA 4FI6A 4MB4A 2ZTBA 4ZX6A 4WI9A 2VO5A 3QUHA 1GCFA 3OF6A 3IXTB 1MCKA 4F7KA 5IQOA 2J8OA 1BQ5A 2B77A 5C0AD 4HYTB 1NBYB 3CVBA 2F53B 4D0DB 3WTXA 5LJYH 2BY3A 2OS7A 5D7IB 2ATAA 3IJHB 3FO2A 1T66D 3HBZA 1HOEA 5DD6A 1JZIA 2BCKA 1USQA 3ZHLA 4MTMA 3CN3A 4BZ1A 4DGIL 5BOZG 1Z32X 4X4YA 1HHIA 1YEIL 2BFVL 4E42A 5JR1L 3LN5B 4AXWA 2C1OA 3JUZA 2Y5TA 5I1JH 3ARTA 4U1KA 5CD3A 2BW4A 4JANB 4QHPA 2FATH 4BKSC 3TT1L 5HPMA 2DQJH 4AQZA 4U3XA 2NY2D 1JK9B 2IH3A 1KXTB 5EPMB 3NRFA 1UM4H 3DK0A 1HN1A 1EHXA 3P2DA 3MOAH 2UXFA 1A25A 2EAEA 2QGBA 4PS4L 7PAZA 5E0QA 5E8NA 1T1XA 2LLGA 4F92B 3ECUA 1J1OH 4BE5A 1BGXH 1MLBB 3NSXA 4N85A 3OWRA 5B7EA 5F0PB 4D9LL 5EIQA 1QRNE 2QT6A 2R9HC 2XN9A 1XB6A 2KL6A 1II4E 3LPGA 4DJMA 5KANI 4YVNA 3TBTB 3SCMC 3AM8A 4P2OB 3TBVA 5ABZA 2CLZA 1OP5K 4AKOA 1VKXB 3SGEI 2VN3A 2IIJA 3L3OB 4EVNA 1H3PH 3NIFF 3QPQC 4KGLA 1VFBA 5CHNB 1N6VA 4HKZA 5FUCC 1DJZA 2OXHB 5JIMA 2VN6A 3MO1A 3Q0HA 4URKA 4FL4C 2WB7A 5B22A 4L4VE 5IFHL 1IM3D 1X6NA 5D1ZD 4ZMQA 5JO5A 4MAZA 3GZPA 1RD6A 2HN7B 1MFCL 4PB9L 1MDAA 1Q94B 4PTTA 2GBAA 4ZRGA 2OL3B 2Y36H 3QRGH 4KZDH 5LDUA 4HWBA 5FWQA 3FHAA 2WB1A 1A65A 2Z34A 2L8AA 4JFED 3FSZA 3EADA 5BMFL 2AXGA 3F7LA 1NL0H 4L5FE 2R0KH 5FYKU 4DN4L 4GBXB 1TSHA 4GS7B 1RSYA 4BD4A 2J2ZA 4M7JL 3FSWA 3JVFC 2VDOB 2A0LC 3ARBC 3KPQA 1T4KB 3AXHA 4MAYA 4XVJH 5C0CA 5FB8A 2J1XA 3RY6A 4XMWA 3RILA 4G8GE 5IJDC 3SDAA 4P9HL 3TL5A 4Y16D 3QJXA 2OMWA 2OAAA 5D7LE 4ODTL 4HWNA 5BS0D 1JERA 3MRBB 3EHBB 1CXIA 1YPZF 1P84K 4JFFB 4E9VA 2LQRA 1KELL 1PF3A 2A6KA 4TTDD 3ZIMA 5ENWB 2YOCA 3O4LD 4G6AC 3WTWA 5TPWH 1VERA 2X2UA 1FL6B 3BO8B 2XSKA 2RCSH 4MXWL 1GZHA 1NDMA 1OB1A 5KN5A 2JCCF 3QK0A 2I07B 5LO7A 4PLJD 1JPTL 3DTUB 4KDTA 5DD5L 5JYLA 3CAFA 4AV4A 1MHHB 2CDEA 2WYTA 2ZF8A 2F8OA 4FG4A 3CU7A 5I0ZA 4LEXL 1N8ZA 3MGAA 4JN1L 1AO7A 1MCFA 2UXVA 1D5XA 3QXDA 2OJ1A 1UENA 1JHTA 4NXKA 2F8IA 2IC2A 1FFPA 2P5WA 4XGZA 4KX7A 2WC7A 4XMZA 2F0CA 4WNQB 2FT7A 1L9OA 3C6EA 4LCCA 4MJID 1DFBH 4ZNEE 2RA1A 5F97E 1KEGH 1OQOA 3KLSA 4GO6B 3GXDA 4Y8AA 4CADB 3V7MA 3TFKC 4DVBA 1MWAL 3DX7B 4R83A 2N4IA 3WAKA 1UACL 3X14B 5LN4A 4BFKA 3FOLB 4JG9A 4XMKL 5HVHC 2N59A 4W9LC 2E9GA 5SX5H 4AWJC 2Q76B 5IV2A 1FIGH 2B4CL 4LARH 3TIEA 3TVMB 5FYKE 4OI7A 4H25B 4JPIB 3BC9A 4OZGA 1TF4A 3C5JB 4JPWH 4WUUB 2XFXA 3DETC 2X3AA 3TA4D 3RFZA 5AW6B 3UDWA 1CQYA 5A2CA 4Z6AT 5T3ZE 1JPSH 4N9GA 4R4BA 3UCRA 4J2QA 5KYUA 3ATFA 2XY1A 4DKFL 1KYDA 5JLZB 1A1NA 1U8MB 1ZSDA 3BVVA 1FFNB 4FXKB 4YFEA 4ZMYA 1BAFH 2X12A 3DPBA 1U8IB 1DSFL 3MLXL 1AKJA 3RWFA 1G5AA 1FLRL 3H2PA 2WQXA 5J7CC 4FFTA 1BBJB 1QBML 3Q5TA 2ARJB 3VXUE 1M3JA 2YN3A 2EKJA 2CO4A 5DD3L 2GTQA 4Q8BA 3AT0A 3L3JA 4K5MA 1ZANH 3OJMB 3KL0A 3L08A 2V7HA 2VLLA 4JHBA 5C6PB 1N67A 1Q38A 2Z91A 4GSRA 5D72H 4BWTA 1KTBA 1L7TL 4ISVA 3QUYC 4R26L 3L3GB 1FAIH 5JHLH 3DC0A 4FERA 3V0GA 4AEIL 2VXTH 4HWEL 1JFQH 1VFMA 4HJUA 1FVDB 4XTRC 1TENA 2R2BB 3L3IB 5L8JB 1S7QB 4A63A 2H45A 4HFUL 2DQIL 4QXUL 3QUXB 2Q0ZX 5DVMA 3DRTA 3K6NA 4G80B 4ZO9A 4IGBA 3S48A 1SOQA 1DQKA 4FLSA 5L6YL 4OGXL 3L1FA 4XP5L 4I3GA 3LRGA 2DQDH 2DWTA 2D31B 1L6PA 4KX9A 2UUDK 3EIFA 4XXDA 4BKLB 1SJEA 3F58L 4JKPL 4AGPA 1AQ8A 1I9EA 2WXMA 4LL1A 4EUPG 2FDBP 3NZHH 3QEQD 4XWGL 1G1CA 5DZPA 4JFQB 4ZMZA 4R0LC 5FF6B 4YDIL 2OZ4A 4BQ9A 1QRNB 5CJXC 2XJLA 2OI9C 4P3DB 5LG1A 4QTIH 4AYFA 4HQQH 1SGKA 1IC7H 1NINA 2IH1A 2X38A 1A1MB 4G43B 1BIHA 3TZVC 1RZIB 4GW1A 1XQ4A 3W37A 2ZCZA 3HBQA 3G3LA 2AV7B 1JN6B 5J13B 2GFBB 3F84A 4U3CA 1OO2A 4F7EA 1LO5B 2Y9RT 4LSRH 4LASL 2C9QA 3VFUA 4MRBA 4L4VB 5FX3A 3B37A 4XVSH 1E67A 3AB0B 3CLEH 4ZD3L 5HGDB 2HFTA 5DJZA 5FAAA 2F1AA 5EZOL 1HZKA 5E51A 3K6IA 2WQRA 1RP9A 2Y7SA 5BRQA 3UP1A 2YRPA 5KVMC 3FB6A 1CFVL 3FU7B 2EE2A 3UTPE 1M1XB 3Q2NA 3MJWA 3PG2A 5IZ7A 4KOBA 5J6SA 5CM1A 1R3KB 1FCGA 2XWJA 5BO0D 4KKAD 5C0JB 3OB0K 1UWYA 2NW2A 4QD2E 1Q9OB 1RZ8A 1DVFA 1LE5A 3G04A 1A3QA 3OQRA 5KUKA 2FO1A 2O5YH 1V7MH 3TTYA 4OJEH 3I2CH 4G8GB 3CH1B 1S7VB 3HPJA 1WS7A 4WFGD 5AW4B 5D7LB 3MLSH 1KIPA 3OSKA 2D4DA 1WCQA 5L2KD 5INCB 1KTKE 2CG9X 2Q9OA 4I0PD 4WEEA 1T1ZA 3BYYA 4IK7A 3ZE2E 2WTOA 2VITB 4G7YH 3TH4T 3V4UH 5EEZA 5HGGS 4YFDB 1K8DB 2AJVL 2BP8B 1A8JH 1E28A 4GSQA 1GGBH 2F6AA 2FATL 2Z3FA 1AIFA 4HCRH 4KUCF 2DQJL 4PGCA 5DUBB 4DFHA 1GTNA 4ODSH 1P4BL 4N28A 1NH6A 5C0DA 4QHNB 1UM4L 4LEEA 3T2OA 4F9LC 3MOAL 3HG4A 1TJHH 2DTMH 2WD0A 2Z31D 2FBJH 4N8VG 5C08D 3FF8A 3CQQA 5T1MA 1A7OH 1BGXL 1KIQA 3FTGB 3HC0A 3T8XA 2WK2A 2V4LA 3RL1B 2YK1L 4R97B 5GRVL 3QO0B 3GBEA 4F33A 5DHVB 1U8KB 1F1GA 1KBGL 1TZ8A 3PNRB 4XPFH 2Z9TA 4D8OA 4J5VA 1KIUA 1H3PL 2FHFA 4FXGA 1V8HA 2JIXB 1JXDA 2XN9E 3CHSA 1ZHBB 4WI8A 5K5YA 3NZ8B 5C0FA 3RWJA 1JXJA 3RUGE 3LNHA 2V9QA 5B39B 4M5TA 3SE8H 43CAA 1GGIL 1MH5A 4HIXH 5DS8B 5F1IB 3GBMH 4FI7A 3EBHA 4Z8FH 3EOBB 1A7NL 4GI6A 4JHVA 3S37H 1AHWA 5I0XA 2LAAA 4O02H 3QRGL 2Y36L 4X8CA 3MNWA 5E08L 4KZDL 5T5FA 1MPAL 4KKNA 1SFHA 4V2CB 4W6YB 1JRHL 4N6RA 4IHOB 1P9MA 1NL0L 1QSFA 2EDNA 4I4WA 4NKOB 1I7TB 4YGVB 2FYYA 1MZYA 4GJTB 4PVLA 1XGRB 1IV8A 1OGSA 3QUZC 3QNYA 5LB1A 3PXJA 2P8PB 1AR2A 2WWKO 3VCLB 3IJEA 5TK4A 5IHZA 4NZJA 5I23A 4EZLA 1MCOH 3ARQA 1P4IH 3CMOH 3HMWL 3QUMB 2F53D 5HDOA 2WLJA 4Q9QH 4GKLA 9CGTA 3O0LA 4H1LA 3VXUB 1EANA 1UXWA 4RAVB 5ESVB 3T5WA 2QKIB 1DSWA 2A73B 2IOIA 3P4OA 1L0YA 3B2MA 1L7IH 1AJ7H 4ZAKC 1IE4A 3KWVA 4UAHA 1A1OA 3K7UA 5TDOB 3P4MA 5J0BA 5EU4A 4KROB 4L1LA 1R3HB 4NO3B 1JF6A 1WFJA 3EZJB 4K3JH 5BOPA 2IBZY 1AR1B 5LCVA 3MLPA 1OTSC 3NIDF 1WZMA 4ES8A 2PMZA 1PY9A 4IOFD 4AVHA 2ZCLH 1CFQB 2XG5B 5DJAB 2ZCHH 5I1KH 3MJ6A 2Y1YA 3OKNB 4P2OD 1W0WA 5BVJA 1G7JB 3T0WA 4XP9H 3W39A 1FZKA 4KK5C 3CVHL 1RPKA 4RFEB 2XIDA 1F5WA 4CNIA 1DFBL 1Y7VA 4NQCA 4RFNB 3UTZA 5LXGH 1KF9B 2ZOKB 4N4YB 1LHZA 1OWWA 3QNZA 1KEGL 4MQSB 1WAEA 1E5AA 3FO0H 2CRIA 3WUWB 2P5WE 4AOFA 4BV1A 4D2NA 3AS3A 3MLWH 4NQEE 3SE9L 4KNUA 5LNEA 1XFPA 1FIGL 4JHAH 2QADB 1DN0A 2M8XA 4GG6A 2D7QA 1MCJA 4MJ4A 3QNXB 4L0YA 4JPWL 5L7XH 4PGZA 2BIHA 4PRPA 3DGDA 4GW4B 3QIWA 1FZMA 3IRPX 1TT6A 1UD5A 5EUOF 1A6WH 3VFWA 7PCYA 1ORQB 1X9QA 4UM9A 3N43F 2IFFH 1OF0A 1ZVSB 3MKKA 4GBXD 1B2YA 1BAFL 3HZMB 1QWHA 3MNZB 4LU5H 1Q4NX 2VAJA 2C5DC 3W1ZA 2KLTA 4MXQD 3OKEA 1BOGA 1WA1X 1D5MB 4YHML 2VDPH 2C4FU 5AKVA 2O6FA 3CZSA 4KAQH 3LXAA 1XH2A 3U83A 3QEHB 5IW3A 1ZANL 1B0WA 3SDDD 3UYPB 4BHUA 2X87A 3EHBD 4KQ0A 4WI7A 1OPOA 4ZDHB 4JFFD 5D72L 1ITCA 1S7UA 5EN2A 2AEIT 3LKNB 3VTTA 4X7SH 3KMDA 1CC3A 1FAIL 1IEBA 3F01A 2C3XA 2KZWA 3INUL 2B8OT 4X9GA 5FM5M 2FAUA 3FKUS 2VXTL 5IM7A 3B7RL 2A74C 4XOBA 4Y19A 2HFGH 4WW2C 1UD2A 2CDGB 3BEWA 2PPCA 4MWFA 5E1IA 3AS0A 5HI4C 4UTAH 1SXZA 2R4RH 3IJ7A 4Y4FC 2Y72A 4ZOEA 2WVSA 2WPGA 3IKKA 1OGPA 3C87A 5BQDA 3MXWH 4AYEC 4L8BA 4GQ9H 1XCQA 4NN5B 4JDZA 1FYTA 1G9NC 3ZE2B 4DSYA 1QHQA 4KJWD 1EDYA 5E1QA 1N70A 5A6LA 3FO2B 1BREA 2BCKB 3KH4A 4K23H 5JUEL 4X4YB 2DQEH 4E42B 5I8OH 1BZDA 4AXWB 2AGJH 4RGNE 2C1OB 3C6LC 4Z7WA 5CP7A 3PWPA 4U1KB 2VDOH 2YZ1A 3BAJA 5FV2A 3NZHL 5CD3B 2RFXB 3KS0H 1J8KA 1SY6A 3M17B 4N1HB 3VG0H 5HPMB 4NC1E 3LZQA 2BS9A 1IM9A 2YUZA 2IH3B 4HQQL 4QTIL 1IC7L 2L0DA 4R5XA 3FB7A 4H2CA 2P47B 5DQDL 5CU5A 1T1XB 2JI2A 1T22A 1MJ7H 4G5AA 4L23A 3S8GB 1HZLA 1TQUA 1D9KA 3FTXA 2XN9B 1EAOA 3LZRA 3RWCA 5K1JA 3WNPA 3TVMD 4JM0A 3KPOA 3TBVB 3DI3B 3MNDA 3PPSA 2CLZB 4RGOH 2MWCA 4K8RL 3FW6A 4WUUD 1TJXA 4S1SH 3RUGB 1Z5LB 2FECL 3CLEL 4GKSA 3V6OC 3KCWA 3OKOA 4EVNB 4YDLB 3AROA 1VFBB 1KPUA 2ESVE 5CP3H 4L1DA 3MO1B 1F00I 1HE8A 4GQQA 5F70A 5C09A 3UBXA 1EIBA 4MZ3A 2ZJSH 1SMDA 3R4DA 4JY5H 5JO5B 3EYQD 2EDQA 1XF1A 1CDHA 2P5PA 1HSAA 4PMFA 4Z3EA 1AYRA 1UHVA 1HXYA 3FH5A 4PTTB 3KPNA 1JZ8A 1ODAA 3ARPA 4M9OA 2O5YL 1BQRA 1V7ML 2KUTA 1WD9A 3I2CL 4NT6A 1P6FA 5IWLC 2HFEA 3QQXA 4KY2A 5KUMA 3ZSTA 4MB5A 3MLSL 2WUBH 1ANUA