1BAKA

Signal transduction pleckstrin homology domain of g-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1), c-terminal extended, nmr, 20 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
GSHMGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure and dynamics of the pleckstrin homology domain of G protein-coupled receptor kinase 2 (beta-adrenergic receptor kinase 1). A binding partner of Gbetagamma subunits.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords G-PROTEIN COUPLED RECEPTOR KINASE 2
total genus 15
structure length 119
sequence length 119
ec nomenclature ec 2.7.11.15: [Beta-adrenergic-receptor] kinase.
pdb deposition date 1997-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1bakA00
2CAYA 2GS0A 4CHMA 4XWXA 4IFSA 2AEHA 5JP4A 3NSUA 3PG7A 5C16A 1SHCA 1FHXA 1PLSA 4BBKA 3N7CA 1UEFA 1BTNA 2Q13A 2J59M 2Z0QA 3ML4A 4PQ0A 5D3XA 3T06A 4PNKA 1EF1A 3ZVRA 2CY4A 3WYFB 2DHKA 3TVVA 4D0NB 4F7HA 4B6HA 1U29A 4MT7A 2DHJA 4K2OA 1U5GA 2L2IA 3TCAA 3BJIA 2COCA 1Z87A 1XD4A 1U5FA 2P0DA 2DYQA 1XX0A 1DDMA 1XODA 2YS3A 1MIZB 1X1GA 5FI1A 1DDWA 3KZ1A 1AWEA 3KY9A 1UPRA 2KGXB 2RSGA 2Y7BA 2YS5A 4Y94A 4HHVA 4HDOA 3KRWA 4HB3B 1Y5OA 4HB2B 1X11A 4L6EA 3G9WA 2OTXA 2UVMA 1DDVA 3FM8C 2LULA 4HB0B 4EKUA 2K2UA 2K00A 2RUKB 3LJUX 3OANA 2DHIA 3PEGA 2MDXA 5KQ4A 4ZRIA 4GMVA 2COAA 2QKMA 2I1JA 2DX5A 1H10A 5KCVA 2D2QA 1P3RA 4HDQA 1P5TA 1J19A 2I5FA 2RLOA 1MAIA 4GN1A 1FAOA 2VRWB 2I5CA 1GC6A 1ZM0A 2YS1A 1B55A 4WSFA 1U27A 4EJNA 2J0MA 3HQCA 2L1CA 3HK0A 3A8QA 1ZC3B 2GCJA 2D11A 5D27A 4Z2NA 2JP2A 1FOEA 3SYXA 2ELBA 2LKOA 1UNPA 2KCJA 2EMSA 2UZSA 4A5KA 3QWMA 2P0FA 4F7UP 2YSZA 3PSCA 1KZ7A 4TYZA 2W2XD 2DX1A 2Y8GA 1W1DA 5LOPB 2YF0A 3MPXA 2IYBA 2FJLA 1XCGA 1FHWA 2PZ1A 3RCPA 1EAZA 3VOQA 4C0AA 3UZTA 1U2BA 2GJYA 2MWNB 2MKRA 3ULCA 4EMOA 1MIXA 2MFQA 2R0DA 5L81A 2I1KA 2Z0PA 2CODA 2EC1A 4HATB 5C5BB 1QQGA 3X23A 1RJ2A 1DBHA 3PP2A 3VIAA 1P6SA 2QKLA 1PMSA 5C79A 1I7AA 2R09A 1MPHA 4GXBA 1ZVRA 1TXDA 3WA0A 3PVWA 2P8VA 2VSZA 3V5WA 1NI2A 1UPQA 2RGNB 3TW1A 5HE0A 1FGZA 4HAZB 3CXBB 3QIJA 2DA0A 4YL8A 3AU4A 2K2JA 2H7DA 3PZDA 4DXAB 5EFXA 4GZUA 1FB8A 4DX8A 2ADZA 5JHHA 2EJ8A 3BINA 2D9XA 4A6KA 3A8PA 2ROVA 2N23A 1WGUA 1V89A 4ZRJA 1DYNA 4K81A 4KHBB 4CYEA 1GC7A 2E2XA 3ULBA 1NTYA 4P7IA 1OMWA 4HAUB 5DHAB 2NZ8B 3GYPA 4NY0A 3U8ZA 1UNRA 2D9YA 3F0WA 2BCJA 1H4RA 3SNHA 2AL6A 1V88A 5D3YA 4WJ7A 4GPTB 1EVHA 2X18A 3PVUA 2H7EA 2N0YA 2D9ZA 4K2PA 1TJ6A 2Y8FA 2DN6A 3FSSA 5HE2A 1QC6A 3CIKA 1K5GB 5JHGA 1AQCA 1WGQA 4HAVB 3D8DA 2CRFA 1LW3A 1WJ1A 5DHFB 2M38A 5CLLB 5KQ1A 4HAYB 1BTKA 1XKEA 1DROA 3SV1A 3P6AA 1E5WA 1V5MA 1Y19B 1V5UA 2G35A 2D4QA 3D8EA 4DBBA 2HE7A 4ZRKA 2ELAA 1V5PA 2V76A 3SUZA 5J3YA 3MDBC 3TFMA 2DFKA 2D10A 1NU2A 1PFJA 2COFA 2M14A 4H8SA 5D3VA 1M7EA 5CLQB 3QBVB 2YT0A 1W1HA 2NMBA 5DIFB 4HB4B 3IVFA 2ROZB 3ZDTA 3ODWA 1TQZA 1KI1B 2DLWA 4A6HA 3KSYA 3DXEA 1NTVA 1I2HA 3DXDA 1K5DB 1SGHA 1FGYA 1GG3A 1V61A 3O96A 2P0HA 4F7GA 1RRPB 4GMXB 2OQBA 5FI0A 1X1FA 5J3TA 3A98B 1LB1A 2DKQA 5DI9B 2DTCA 3ODOA 1M7RA 3M1IB 2KUPA 4MY6A 2W2XC 2YVCA 2W2WA 3ODXA 2LOXA 2VKIA 1W1GA 2YRYA 2DKPA 3FEHA 3GYOA 4YONA 4DX90 4CHJA 1IRSA 4IOYX 1MK7B 3AJ4A 3KRXA 2LOZA 5JLJB 4NSWA 2Z0OA 3TO1A 3DXCA 5HE3A 5GOWB 1WVHA 2D9VA 1WJMA 2LYDA 4IAPA 4TKNA 4Z2MB 3U7DA 1X86A 1ISNA 1N3HA 1U5EA 5D3WA 2XQNM 4HAXB 5DH9B 1MKEA 4A6FA 4KHAA 2YT1A 2EMTA 3PVLA 4A6FB 3D8FA 1KZGA 1U5DA 1OY2A 1FHOA 1J0WA 1EGXA 1WI1A 2D9WA 1OQNA 2UZRA 5LONB 1Q67A 4KAXB 4WVFB 2J0KA 1MK9B 4MK0A 1XR0B 5HE1A 3P7ZA 2IFSA 1ZC4B 3HW2B 1BAKA 3SO6A 1BWNA 2RVBB 4K17A 4HAWB 3AU5A 2CY5A 1UNQA 2DYNA 3F5RA 4KVGB 1WG7A 1ZSQA 5C6RA 5C5BA 2GCLA 5J3QA 1X05A 2HTHB 2J0JA 2ZPYA 2RNRB 4KHOA 2LG1A
chains in the Genus database with same CATH superfamily
2CAYA 2GS0A 4CHMA 4XWXA 4IFSA 4QJ4B 2AEHA 5JP4A 3NSUA 2Z13A 3PG7A 5C16A 1SHCA 1FHXA 1PLSA 4BBKA 3N7CA 3OHMB 1UEFA 2KR0A 1BTNA 2Q13A 2J59M 2Z0QA 3ML4A 4PQ0A 5D3XA 3T06A 3U12A 4PNKA 1EF1A 3ZVRA 2CY4A 3WYFB 2DHKA 3DCXA 3TVVA 5IRSA 4D0NB 4F7HA 4B6HA 1U29A 4MT7A 2DHJA 4K2OA 1U5GA 2L2IA 3TCAA 3BJIA 2COCA 1Z87A 1XD4A 1U5FA 5I2SA 2P0DA 4DIXA 2DYQA 1XX0A 1DDMA 1XODA 2YS3A 1MIZB 1X1GA 5FI1A 1DDWA 3KZ1A 1AWEA 3KY9A 1UPRA 2KGXB 1MI1A 2RSGA 2Y7BA 4KHBA 2YS5A 4Y94A 4HHVA 4HB3B 3KRWA 4HDOA 1Y5OA 4HB2B 1X11A 4L6EA 3G9WA 2OTXA 2UVMA 1DDVA 3FM8C 4HSIA 2LULA 4HB0B 4EKUA 2K2UA 2K00A 2RUKB 3LJUX 3OANA 2DHIA 3PEGA 2MDXA 5KQ4A 4ZRIA 4GMVA 2KUQA 2COAA 2QKMA 2I1JA 2DX5A 1H10A 5KCVA 2D2QA 1P3RA 4HDQA 1P5TA 1J19A 2I5FA 5LG4B 2RLOA 1MAIA 4GN1A 1FAOA 2VRWB 2YT2A 2K49A 2I5CA 1GC6A 1ZM0A 5I2MA 2YS1A 1B55A 4WSFA 1U27A 4EJNA 2J0MA 3HQCA 2L1CA 3HK0A 4D6WA 3A8QA 1ZC3B 2GCJA 1ZYIA 2D11A 5D27A 4Z2NA 2JP2A 1FOEA 3SYXA 2ELBA 3A58A 2LKOA 1UNPA 2KCJA 2EMSA 3HIEA 2UZSA 4A5KA 3QWMA 4QXAB 2P0FA 4F7UP 2YSZA 3PSCA 1KZ7A 4TYZA 2W2XD 2DX1A 2Y8GA 1W1DA 4QJ5B 2NBVA 3NWFA 5LOPB 2YF0A 3MPXA 2IYBA 4GNKB 2FJLA 4QJ3B 1XCGA 1FHWA 2PZ1A 3RCPA 1EAZA 3VOQA 4C0AA 3UZTA 1U2BA 2R2YA 2GJYA 2MWNB 2MKRA 3ULCA 4EMOA 1MIXA 2FJUB 2MFQA 2ZKMX 2R0DA 4OT1A 5L81A 2I1KA 2Z0PA 2CODA 2EC1A 4HATB 5C5BB 1QQGA 3X23A 1RJ2A 1DBHA 3PP2A 3VIAA 1P6SA 2QKLA 1PMSA 5C79A 2RRFA 1I7AA 2R09A 1MPHA 4GXBA 1ZVRA 1TXDA 3WA0A 3PVWA 4OSNA 2P8VA 3NWDA 2VSZA 3V5WA 1NI2A 1UPQA 2RGNB 3TW1A 5HE0A 1FGZA 4HAZB 3CXBB 3QIJA 2DA0A 4YL8A 3AU4A 2K2JA 2H7DA 3PZDA 4DXAB 5EFXA 4GZUA 3FVCA 1FB8A 4L1RA 4DX8A 2ADZA 5JHHA 2EJ8A 3BINA 2D9XA 4A6KA 3A8PA 2ROVA 2N23A 1WGUA 1V89A 4ZRJA 1DYNA 4GOUA 4K81A 4KHBB 4CYEA 1GC7A 3B77A 2E2XA 3ULBA 1NTYA 4P7IA 1OMWA 4HAUB 5DHAB 2NZ8B 3GYPA 4NY0A 3U8ZA 1UNRA 2D9YA 3F0WA 2BCJA 1H4RA 3SNHA 2AL6A 1V88A 5D3YA 4WJ7A 4GPTB 1EVHA 2X18A 3PVUA 2H7EA 2N0YA 2D9ZA 4K2PA 1TJ6A 2Y8FA 2DN6A 3FSSA 5HE2A 1QC6A 3CIKA 1K5GB 5JHGA 1AQCA 1WGQA 4HAVB 3D8DA 2CRFA 1LW3A 1WJ1A 5DHFB 2M38A 5CLLB 5KQ1A 4HAYB 1BTKA 1XKEA 1DROA 3SV1A 3P6AA 1E5WA 1V5MA 3HSAA 1Y19B 1V5UA 2G35A 2D4QA 3D8EA 4DBBA 2HE7A 4ZRKA 2ELAA 1V5PA 2V76A 3SUZA 5J3YA 3MDBC 3TFMA 2DFKA 2D10A 1NU2A 1PFJA 2COFA 2M14A 2Z59A 4H8SA 5D3VA 1M7EA 1T77A 5CLQB 3QBVB 2Z4DA 2YT0A 1W1HA 2NMBA 5DIFB 5M4YB 4HB4B 3IVFA 2ROZB 3ZDTA 3ODWA 1TQZA 1KI1B 2DLWA 4A6HA 3KSYA 3DXEA 1NTVA 1I2HA 3DXDA 1K5DB 1SGHA 1FGYA 1GG3A 3NW8A 1V61A 3O96A 2P0HA 4F7GA 1RRPB 4GMXB 2OQBA 5FI0A 1X1FA 5J3TA 3A98B 1LB1A 2DKQA 2KIGA 5DI9B 2DTCA 2Z14A 3ODOA 1M7RA 3M1IB 2KUPA 4MY6A 2W2XC 2YVCA 2W2WA 3ODXA 2LOXA 2VKIA 1W1GA 2YRYA 2DKPA 3FEHA 3GYOA 4YONA 4DX90 4CHJA 1IRSA 4IOYX 1MK7B 3AJ4A 3KRXA 2LOZA 4CSQA 5JLJB 4NSWA 2Z0OA 3TO1A 3DXCA 3NWAA 5HE3A 5GOWB 1WVHA 2D9VA 2KIEA 1WJMA 2LYDA 4IAPA 4TKNA 4Z2MB 3U7DA 1X86A 2GUMA 1ISNA 1N3HA 1U5EA 5D3WA 2XQNM 4HAXB 5DH9B 1MKEA 4A6FA 4KHAA 2YT1A 2EMTA 3PVLA 4A6FB 3D8FA 1KZGA 1U5DA 1OY2A 1FHOA 1J0WA 1EGXA 1WI1A 2D9WA 1OQNA 2UZRA 5LONB 1Q67A 4KAXB 4WVFB 2J0KA 1MK9B 4MK0A 1XR0B 5HE1A 3P7ZA 2IFSA 1ZC4B 3HW2B 1BAKA 3SO6A 1BWNA 2RVBB 4K17A 4HAWB 3AU5A 2CY5A 1UNQA 2DYNA 2K8EA 3F5RA 4KVGB 1WG7A 1ZSQA 5C6RA 5C5BA 2GCLA 5J3QA 1X05A 2HTHB 2J0JA 2ZPYA 2RNRB 4KHOA 2LG1A
chains in the Genus database with same CATH topology
2CAYA 2GS0A 4CHMA 4XWXA 4IFSA 2AEHA 5JP4A 3NSUA 3PG7A 5C16A 1SHCA 1FHXA 1PLSA 4BBKA 3N7CA 1UEFA 1BTNA 2Q13A 2J59M 2Z0QA 3ML4A 4PQ0A 5D3XA 3T06A 4PNKA 1EF1A 3ZVRA 2CY4A 3WYFB 2DHKA 3TVVA 4D0NB 4F7HA 4B6HA 1U29A 4MT7A 2DHJA 4K2OA 1U5GA 2L2IA 3TCAA 3BJIA 2COCA 1Z87A 1XD4A 1U5FA 2P0DA 2DYQA 1XX0A 1DDMA 1XODA 2YS3A 1MIZB 1X1GA 5FI1A 1DDWA 3KZ1A 1AWEA 3KY9A 1UPRA 2KGXB 2RSGA 2Y7BA 2YS5A 4Y94A 4HHVA 4HDOA 3KRWA 4HB3B 1Y5OA 4HB2B 1X11A 4L6EA 3G9WA 2OTXA 2UVMA 1DDVA 3FM8C 2LULA 4HB0B 4EKUA 2K2UA 2K00A 2RUKB 3LJUX 3OANA 2DHIA 3PEGA 2MDXA 5KQ4A 4ZRIA 4GMVA 2COAA 2QKMA 2I1JA 2DX5A 1H10A 5KCVA 2D2QA 1P3RA 4HDQA 1P5TA 1J19A 2I5FA 2RLOA 1MAIA 4GN1A 1FAOA 2VRWB 2I5CA 1GC6A 1ZM0A 2YS1A 1B55A 4WSFA 1U27A 4EJNA 2J0MA 3HQCA 2L1CA 3HK0A 3A8QA 1ZC3B 2GCJA 2D11A 5D27A 4Z2NA 2JP2A 1FOEA 3SYXA 2ELBA 2LKOA 1UNPA 2KCJA 2EMSA 2UZSA 4A5KA 3QWMA 2P0FA 4F7UP 2YSZA 3PSCA 1KZ7A 4TYZA 2W2XD 2DX1A 2Y8GA 1W1DA 5LOPB 2YF0A 3MPXA 2IYBA 2FJLA 1XCGA 1FHWA 2PZ1A 3RCPA 1EAZA 3VOQA 4C0AA 3UZTA 1U2BA 2GJYA 2MWNB 2MKRA 3ULCA 4EMOA 1MIXA 2MFQA 2R0DA 5L81A 2I1KA 2Z0PA 2CODA 2EC1A 4HATB 5C5BB 1QQGA 3X23A 1RJ2A 1DBHA 3PP2A 3VIAA 1P6SA 2QKLA 1PMSA 5C79A 1I7AA 2R09A 1MPHA 4GXBA 1ZVRA 1TXDA 3WA0A 3PVWA 2P8VA 2VSZA 3V5WA 1NI2A 1UPQA 2RGNB 3TW1A 5HE0A 1FGZA 4HAZB 3CXBB 3QIJA 2DA0A 4YL8A 3AU4A 2K2JA 2H7DA 3PZDA 4DXAB 5EFXA 4GZUA 1FB8A 4DX8A 2ADZA 5JHHA 2EJ8A 3BINA 2D9XA 4A6KA 3A8PA 2ROVA 2N23A 1WGUA 1V89A 4ZRJA 1DYNA 4K81A 4KHBB 4CYEA 1GC7A 2E2XA 3ULBA 1NTYA 4P7IA 1OMWA 4HAUB 5DHAB 2NZ8B 3GYPA 4NY0A 3U8ZA 1UNRA 2D9YA 3F0WA 2BCJA 1H4RA 3SNHA 2AL6A 1V88A 5D3YA 4WJ7A 4GPTB 1EVHA 2X18A 3PVUA 2H7EA 2N0YA 2D9ZA 4K2PA 1TJ6A 2Y8FA 2DN6A 3FSSA 5HE2A 1QC6A 3CIKA 1K5GB 5JHGA 1AQCA 1WGQA 4HAVB 3D8DA 2CRFA 1LW3A 1WJ1A 5DHFB 2M38A 5CLLB 5KQ1A 4HAYB 1BTKA 1XKEA 1DROA 3SV1A 3P6AA 1E5WA 1V5MA 1Y19B 1V5UA 2G35A 2D4QA 3D8EA 4DBBA 2HE7A 4ZRKA 2ELAA 1V5PA 2V76A 3SUZA 5J3YA 3MDBC 3TFMA 2DFKA 2D10A 1NU2A 1PFJA 2COFA 2M14A 4H8SA 5D3VA 1M7EA 5CLQB 3QBVB 2YT0A 1W1HA 2NMBA 5DIFB 4HB4B 3IVFA 2ROZB 3ZDTA 3ODWA 1TQZA 1KI1B 2DLWA 4A6HA 3KSYA 3DXEA 1NTVA 1I2HA 3DXDA 1K5DB 1SGHA 1FGYA 1GG3A 1V61A 3O96A 2P0HA 4F7GA 1RRPB 4GMXB 2OQBA 5FI0A 1X1FA 5J3TA 3A98B 1LB1A 2DKQA 5DI9B 2DTCA 3ODOA 1M7RA 3M1IB 2KUPA 4MY6A 2W2XC 2YVCA 2W2WA 3ODXA 2LOXA 2VKIA 1W1GA 2YRYA 2DKPA 3FEHA 3GYOA 4YONA 4DX90 4CHJA 1IRSA 4IOYX 1MK7B 3AJ4A 3KRXA 2LOZA 5JLJB 4NSWA 2Z0OA 3TO1A 3DXCA 5HE3A 5GOWB 1WVHA 2D9VA 1WJMA 2LYDA 4IAPA 4TKNA 4Z2MB 3U7DA 1X86A 1ISNA 1N3HA 1U5EA 5D3WA 2XQNM 4HAXB 5DH9B 1MKEA 4A6FA 4KHAA 2YT1A 2EMTA 3PVLA 4A6FB 3D8FA 1KZGA 1U5DA 1OY2A 1FHOA 1J0WA 1EGXA 1WI1A 2D9WA 1OQNA 2UZRA 5LONB 1Q67A 4KAXB 4WVFB 2J0KA 1MK9B 4MK0A 1XR0B 5HE1A 3P7ZA 2IFSA 1ZC4B 3HW2B 1BAKA 3SO6A 1BWNA 2RVBB 4K17A 4HAWB 3AU5A 2CY5A 1UNQA 2DYNA 3F5RA 4KVGB 1WG7A 1ZSQA 5C6RA 5C5BA 2GCLA 5J3QA 1X05A 2HTHB 2J0JA 2ZPYA 2RNRB 4KHOA 2LG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CAY A;  2GS0 A;  4CHM A;  4XWX A;  4IFS A;  2AEH A;  5JP4 A;  3NSU A;  3PG7 A;  5C16 A;  1SHC A;  1FHX A;  1PLS A;  4BBK A;  3N7C A;  1UEF A;  1BTN A;  2Q13 A;  2J59 M;  2Z0Q A;  3ML4 A;  4PQ0 A;  5D3X A;  3T06 A;  4PNK A;  1EF1 A;  3ZVR A;  2CY4 A;  3WYF B;  2DHK A;  3TVV A;  4D0N B;  4F7H A;  4B6H A;  1U29 A;  4MT7 A;  2DHJ A;  4K2O A;  1U5G A;  2L2I A;  3TCA A;  3BJI A;  2COC A;  1Z87 A;  1XD4 A;  1U5F A;  2P0D A;  2DYQ A;  1XX0 A;  1DDM A;  1XOD A;  2YS3 A;  1MIZ B;  1X1G A;  5FI1 A;  1DDW A;  3KZ1 A;  1AWE A;  3KY9 A;  1UPR A;  2KGX B;  2RSG A;  2Y7B A;  2YS5 A;  4Y94 A;  4HHV A;  4HDO A;  3KRW A;  4HB3 B;  1Y5O A;  4HB2 B;  1X11 A;  4L6E A;  3G9W A;  2OTX A;  2UVM A;  1DDV A;  3FM8 C;  2LUL A;  4HB0 B;  4EKU A;  2K2U A;  2K00 A;  2RUK B;  3LJU X;  3OAN A;  2DHI A;  3PEG A;  2MDX A;  5KQ4 A;  4ZRI A;  4GMV A;  2COA A;  2QKM A;  2I1J A;  2DX5 A;  1H10 A;  5KCV A;  2D2Q A;  1P3R A;  4HDQ A;  1P5T A;  1J19 A;  2I5F A;  2RLO A;  1MAI A;  4GN1 A;  1FAO A;  2VRW B;  2I5C A;  1GC6 A;  1ZM0 A;  2YS1 A;  1B55 A;  4WSF A;  1U27 A;  4EJN A;  2J0M A;  3HQC A;  2L1C A;  3HK0 A;  3A8Q A;  1ZC3 B;  2GCJ A;  2D11 A;  5D27 A;  4Z2N A;  2JP2 A;  1FOE A;  3SYX A;  2ELB A;  2LKO A;  1UNP A;  2KCJ A;  2EMS A;  2UZS A;  4A5K A;  3QWM A;  2P0F A;  4F7U P;  2YSZ A;  3PSC A;  1KZ7 A;  4TYZ A;  2W2X D;  2DX1 A;  2Y8G A;  1W1D A;  5LOP B;  2YF0 A;  3MPX A;  2IYB A;  2FJL A;  1XCG A;  1FHW A;  2PZ1 A;  3RCP A;  1EAZ A;  3VOQ A;  4C0A A;  3UZT A;  1U2B A;  2GJY A;  2MWN B;  2MKR A;  3ULC A;  4EMO A;  1MIX A;  2MFQ A;  2R0D A;  5L81 A;  2I1K A;  2Z0P A;  2COD A;  2EC1 A;  4HAT B;  5C5B B;  1QQG A;  3X23 A;  1RJ2 A;  1DBH A;  3PP2 A;  3VIA A;  1P6S A;  2QKL A;  1PMS A;  5C79 A;  1I7A A;  2R09 A;  1MPH A;  4GXB A;  1ZVR A;  1TXD A;  3WA0 A;  3PVW A;  2P8V A;  2VSZ A;  3V5W A;  1NI2 A;  1UPQ A;  2RGN B;  3TW1 A;  5HE0 A;  1FGZ A;  4HAZ B;  3CXB B;  3QIJ A;  2DA0 A;  4YL8 A;  3AU4 A;  2K2J A;  2H7D A;  3PZD A;  4DXA B;  5EFX A;  4GZU A;  1FB8 A;  4DX8 A;  2ADZ A;  5JHH A;  2EJ8 A;  3BIN A;  2D9X A;  4A6K A;  3A8P A;  2ROV A;  2N23 A;  1WGU A;  1V89 A;  4ZRJ A;  1DYN A;  4K81 A;  4KHB B;  4CYE A;  1GC7 A;  2E2X A;  3ULB A;  1NTY A;  4P7I A;  1OMW A;  4HAU B;  5DHA B;  2NZ8 B;  3GYP A;  4NY0 A;  3U8Z A;  1UNR A;  2D9Y A;  3F0W A;  2BCJ A;  1H4R A;  3SNH A;  2AL6 A;  1V88 A;  5D3Y A;  4WJ7 A;  4GPT B;  1EVH A;  2X18 A;  3PVU A;  2H7E A;  2N0Y A;  2D9Z A;  4K2P A;  1TJ6 A;  2Y8F A;  2DN6 A;  3FSS A;  5HE2 A;  1QC6 A;  3CIK A;  1K5G B;  5JHG A;  1AQC A;  1WGQ A;  4HAV B;  3D8D A;  2CRF A;  1LW3 A;  1WJ1 A;  5DHF B;  2M38 A;  5CLL B;  5KQ1 A;  4HAY B;  1BTK A;  1XKE A;  1DRO A;  3SV1 A;  3P6A A;  1E5W A;  1V5M A;  1Y19 B;  1V5U A;  2G35 A;  2D4Q A;  3D8E A;  4DBB A;  2HE7 A;  4ZRK A;  2ELA A;  1V5P A;  2V76 A;  3SUZ A;  5J3Y A;  3MDB C;  3TFM A;  2DFK A;  2D10 A;  1NU2 A;  1PFJ A;  2COF A;  2M14 A;  4H8S A;  5D3V A;  1M7E A;  5CLQ B;  3QBV B;  2YT0 A;  1W1H A;  2NMB A;  5DIF B;  4HB4 B;  3IVF A;  2ROZ B;  3ZDT A;  3ODW A;  1TQZ A;  1KI1 B;  2DLW A;  4A6H A;  3KSY A;  3DXE A;  1NTV A;  1I2H A;  3DXD A;  1K5D B;  1SGH A;  1FGY A;  1GG3 A;  1V61 A;  3O96 A;  2P0H A;  4F7G A;  1RRP B;  4GMX B;  2OQB A;  5FI0 A;  1X1F A;  5J3T A;  3A98 B;  1LB1 A;  2DKQ A;  5DI9 B;  2DTC A;  3ODO A;  1M7R A;  3M1I B;  2KUP A;  4MY6 A;  2W2X C;  2YVC A;  2W2W A;  3ODX A;  2LOX A;  2VKI A;  1W1G A;  2YRY A;  2DKP A;  3FEH A;  3GYO A;  4YON A;  4DX9 0;  4CHJ A;  1IRS A;  4IOY X;  1MK7 B;  3AJ4 A;  3KRX A;  2LOZ A;  5JLJ B;  4NSW A;  2Z0O A;  3TO1 A;  3DXC A;  5HE3 A;  5GOW B;  1WVH A;  2D9V A;  1WJM A;  2LYD A;  4IAP A;  4TKN A;  4Z2M B;  3U7D A;  1X86 A;  1ISN A;  1N3H A;  1U5E A;  5D3W A;  2XQN M;  4HAX B;  5DH9 B;  1MKE A;  4A6F A;  4KHA A;  2YT1 A;  2EMT A;  3PVL A;  4A6F B;  3D8F A;  1KZG A;  1U5D A;  1OY2 A;  1FHO A;  1J0W A;  1EGX A;  1WI1 A;  2D9W A;  1OQN A;  2UZR A;  5LON B;  1Q67 A;  4KAX B;  4WVF B;  2J0K A;  1MK9 B;  4MK0 A;  1XR0 B;  5HE1 A;  3P7Z A;  2IFS A;  1ZC4 B;  3HW2 B;  1BAK A;  3SO6 A;  1BWN A;  2RVB B;  4K17 A;  4HAW B;  3AU5 A;  2CY5 A;  1UNQ A;  2DYN A;  3F5R A;  4KVG B;  1WG7 A;  1ZSQ A;  5C6R A;  5C5B A;  2GCL A;  5J3Q A;  1X05 A;  2HTH B;  2J0J A;  2ZPY A;  2RNR B;  4KHO A;  2LG1 A; 
#chains in the Genus database with same CATH topology
 2CAY A;  2GS0 A;  4CHM A;  4XWX A;  4IFS A;  4QJ4 B;  2AEH A;  5JP4 A;  3NSU A;  2Z13 A;  3PG7 A;  5C16 A;  1SHC A;  1FHX A;  1PLS A;  4BBK A;  3N7C A;  3OHM B;  1UEF A;  2KR0 A;  1BTN A;  2Q13 A;  2J59 M;  2Z0Q A;  3ML4 A;  4PQ0 A;  5D3X A;  3T06 A;  3U12 A;  4PNK A;  1EF1 A;  3ZVR A;  2CY4 A;  3WYF B;  2DHK A;  3DCX A;  3TVV A;  5IRS A;  4D0N B;  4F7H A;  4B6H A;  1U29 A;  4MT7 A;  2DHJ A;  4K2O A;  1U5G A;  2L2I A;  3TCA A;  3BJI A;  2COC A;  1Z87 A;  1XD4 A;  1U5F A;  5I2S A;  2P0D A;  4DIX A;  2DYQ A;  1XX0 A;  1DDM A;  1XOD A;  2YS3 A;  1MIZ B;  1X1G A;  5FI1 A;  1DDW A;  3KZ1 A;  1AWE A;  3KY9 A;  1UPR A;  2KGX B;  1MI1 A;  2RSG A;  2Y7B A;  4KHB A;  2YS5 A;  4Y94 A;  4HHV A;  4HB3 B;  3KRW A;  4HDO A;  1Y5O A;  4HB2 B;  1X11 A;  4L6E A;  3G9W A;  2OTX A;  2UVM A;  1DDV A;  3FM8 C;  4HSI A;  2LUL A;  4HB0 B;  4EKU A;  2K2U A;  2K00 A;  2RUK B;  3LJU X;  3OAN A;  2DHI A;  3PEG A;  2MDX A;  5KQ4 A;  4ZRI A;  4GMV A;  2KUQ A;  2COA A;  2QKM A;  2I1J A;  2DX5 A;  1H10 A;  5KCV A;  2D2Q A;  1P3R A;  4HDQ A;  1P5T A;  1J19 A;  2I5F A;  5LG4 B;  2RLO A;  1MAI A;  4GN1 A;  1FAO A;  2VRW B;  2YT2 A;  2K49 A;  2I5C A;  1GC6 A;  1ZM0 A;  5I2M A;  2YS1 A;  1B55 A;  4WSF A;  1U27 A;  4EJN A;  2J0M A;  3HQC A;  2L1C A;  3HK0 A;  4D6W A;  3A8Q A;  1ZC3 B;  2GCJ A;  1ZYI A;  2D11 A;  5D27 A;  4Z2N A;  2JP2 A;  1FOE A;  3SYX A;  2ELB A;  3A58 A;  2LKO A;  1UNP A;  2KCJ A;  2EMS A;  3HIE A;  2UZS A;  4A5K A;  3QWM A;  4QXA B;  2P0F A;  4F7U P;  2YSZ A;  3PSC A;  1KZ7 A;  4TYZ A;  2W2X D;  2DX1 A;  2Y8G A;  1W1D A;  4QJ5 B;  2NBV A;  3NWF A;  5LOP B;  2YF0 A;  3MPX A;  2IYB A;  4GNK B;  2FJL A;  4QJ3 B;  1XCG A;  1FHW A;  2PZ1 A;  3RCP A;  1EAZ A;  3VOQ A;  4C0A A;  3UZT A;  1U2B A;  2R2Y A;  2GJY A;  2MWN B;  2MKR A;  3ULC A;  4EMO A;  1MIX A;  2FJU B;  2MFQ A;  2ZKM X;  2R0D A;  4OT1 A;  5L81 A;  2I1K A;  2Z0P A;  2COD A;  2EC1 A;  4HAT B;  5C5B B;  1QQG A;  3X23 A;  1RJ2 A;  1DBH A;  3PP2 A;  3VIA A;  1P6S A;  2QKL A;  1PMS A;  5C79 A;  2RRF A;  1I7A A;  2R09 A;  1MPH A;  4GXB A;  1ZVR A;  1TXD A;  3WA0 A;  3PVW A;  4OSN A;  2P8V A;  3NWD A;  2VSZ A;  3V5W A;  1NI2 A;  1UPQ A;  2RGN B;  3TW1 A;  5HE0 A;  1FGZ A;  4HAZ B;  3CXB B;  3QIJ A;  2DA0 A;  4YL8 A;  3AU4 A;  2K2J A;  2H7D A;  3PZD A;  4DXA B;  5EFX A;  4GZU A;  3FVC A;  1FB8 A;  4L1R A;  4DX8 A;  2ADZ A;  5JHH A;  2EJ8 A;  3BIN A;  2D9X A;  4A6K A;  3A8P A;  2ROV A;  2N23 A;  1WGU A;  1V89 A;  4ZRJ A;  1DYN A;  4GOU A;  4K81 A;  4KHB B;  4CYE A;  1GC7 A;  3B77 A;  2E2X A;  3ULB A;  1NTY A;  4P7I A;  1OMW A;  4HAU B;  5DHA B;  2NZ8 B;  3GYP A;  4NY0 A;  3U8Z A;  1UNR A;  2D9Y A;  3F0W A;  2BCJ A;  1H4R A;  3SNH A;  2AL6 A;  1V88 A;  5D3Y A;  4WJ7 A;  4GPT B;  1EVH A;  2X18 A;  3PVU A;  2H7E A;  2N0Y A;  2D9Z A;  4K2P A;  1TJ6 A;  2Y8F A;  2DN6 A;  3FSS A;  5HE2 A;  1QC6 A;  3CIK A;  1K5G B;  5JHG A;  1AQC A;  1WGQ A;  4HAV B;  3D8D A;  2CRF A;  1LW3 A;  1WJ1 A;  5DHF B;  2M38 A;  5CLL B;  5KQ1 A;  4HAY B;  1BTK A;  1XKE A;  1DRO A;  3SV1 A;  3P6A A;  1E5W A;  1V5M A;  3HSA A;  1Y19 B;  1V5U A;  2G35 A;  2D4Q A;  3D8E A;  4DBB A;  2HE7 A;  4ZRK A;  2ELA A;  1V5P A;  2V76 A;  3SUZ A;  5J3Y A;  3MDB C;  3TFM A;  2DFK A;  2D10 A;  1NU2 A;  1PFJ A;  2COF A;  2M14 A;  2Z59 A;  4H8S A;  5D3V A;  1M7E A;  1T77 A;  5CLQ B;  3QBV B;  2Z4D A;  2YT0 A;  1W1H A;  2NMB A;  5DIF B;  5M4Y B;  4HB4 B;  3IVF A;  2ROZ B;  3ZDT A;  3ODW A;  1TQZ A;  1KI1 B;  2DLW A;  4A6H A;  3KSY A;  3DXE A;  1NTV A;  1I2H A;  3DXD A;  1K5D B;  1SGH A;  1FGY A;  1GG3 A;  3NW8 A;  1V61 A;  3O96 A;  2P0H A;  4F7G A;  1RRP B;  4GMX B;  2OQB A;  5FI0 A;  1X1F A;  5J3T A;  3A98 B;  1LB1 A;  2DKQ A;  2KIG A;  5DI9 B;  2DTC A;  2Z14 A;  3ODO A;  1M7R A;  3M1I B;  2KUP A;  4MY6 A;  2W2X C;  2YVC A;  2W2W A;  3ODX A;  2LOX A;  2VKI A;  1W1G A;  2YRY A;  2DKP A;  3FEH A;  3GYO A;  4YON A;  4DX9 0;  4CHJ A;  1IRS A;  4IOY X;  1MK7 B;  3AJ4 A;  3KRX A;  2LOZ A;  4CSQ A;  5JLJ B;  4NSW A;  2Z0O A;  3TO1 A;  3DXC A;  3NWA A;  5HE3 A;  5GOW B;  1WVH A;  2D9V A;  2KIE A;  1WJM A;  2LYD A;  4IAP A;  4TKN A;  4Z2M B;  3U7D A;  1X86 A;  2GUM A;  1ISN A;  1N3H A;  1U5E A;  5D3W A;  2XQN M;  4HAX B;  5DH9 B;  1MKE A;  4A6F A;  4KHA A;  2YT1 A;  2EMT A;  3PVL A;  4A6F B;  3D8F A;  1KZG A;  1U5D A;  1OY2 A;  1FHO A;  1J0W A;  1EGX A;  1WI1 A;  2D9W A;  1OQN A;  2UZR A;  5LON B;  1Q67 A;  4KAX B;  4WVF B;  2J0K A;  1MK9 B;  4MK0 A;  1XR0 B;  5HE1 A;  3P7Z A;  2IFS A;  1ZC4 B;  3HW2 B;  1BAK A;  3SO6 A;  1BWN A;  2RVB B;  4K17 A;  4HAW B;  3AU5 A;  2CY5 A;  1UNQ A;  2DYN A;  2K8E A;  3F5R A;  4KVG B;  1WG7 A;  1ZSQ A;  5C6R A;  5C5B A;  2GCL A;  5J3Q A;  1X05 A;  2HTH B;  2J0J A;  2ZPY A;  2RNR B;  4KHO A;  2LG1 A; 
#chains in the Genus database with same CATH homology
 2CAY A;  2GS0 A;  4CHM A;  4XWX A;  4IFS A;  2AEH A;  5JP4 A;  3NSU A;  3PG7 A;  5C16 A;  1SHC A;  1FHX A;  1PLS A;  4BBK A;  3N7C A;  1UEF A;  1BTN A;  2Q13 A;  2J59 M;  2Z0Q A;  3ML4 A;  4PQ0 A;  5D3X A;  3T06 A;  4PNK A;  1EF1 A;  3ZVR A;  2CY4 A;  3WYF B;  2DHK A;  3TVV A;  4D0N B;  4F7H A;  4B6H A;  1U29 A;  4MT7 A;  2DHJ A;  4K2O A;  1U5G A;  2L2I A;  3TCA A;  3BJI A;  2COC A;  1Z87 A;  1XD4 A;  1U5F A;  2P0D A;  2DYQ A;  1XX0 A;  1DDM A;  1XOD A;  2YS3 A;  1MIZ B;  1X1G A;  5FI1 A;  1DDW A;  3KZ1 A;  1AWE A;  3KY9 A;  1UPR A;  2KGX B;  2RSG A;  2Y7B A;  2YS5 A;  4Y94 A;  4HHV A;  4HDO A;  3KRW A;  4HB3 B;  1Y5O A;  4HB2 B;  1X11 A;  4L6E A;  3G9W A;  2OTX A;  2UVM A;  1DDV A;  3FM8 C;  2LUL A;  4HB0 B;  4EKU A;  2K2U A;  2K00 A;  2RUK B;  3LJU X;  3OAN A;  2DHI A;  3PEG A;  2MDX A;  5KQ4 A;  4ZRI A;  4GMV A;  2COA A;  2QKM A;  2I1J A;  2DX5 A;  1H10 A;  5KCV A;  2D2Q A;  1P3R A;  4HDQ A;  1P5T A;  1J19 A;  2I5F A;  2RLO A;  1MAI A;  4GN1 A;  1FAO A;  2VRW B;  2I5C A;  1GC6 A;  1ZM0 A;  2YS1 A;  1B55 A;  4WSF A;  1U27 A;  4EJN A;  2J0M A;  3HQC A;  2L1C A;  3HK0 A;  3A8Q A;  1ZC3 B;  2GCJ A;  2D11 A;  5D27 A;  4Z2N A;  2JP2 A;  1FOE A;  3SYX A;  2ELB A;  2LKO A;  1UNP A;  2KCJ A;  2EMS A;  2UZS A;  4A5K A;  3QWM A;  2P0F A;  4F7U P;  2YSZ A;  3PSC A;  1KZ7 A;  4TYZ A;  2W2X D;  2DX1 A;  2Y8G A;  1W1D A;  5LOP B;  2YF0 A;  3MPX A;  2IYB A;  2FJL A;  1XCG A;  1FHW A;  2PZ1 A;  3RCP A;  1EAZ A;  3VOQ A;  4C0A A;  3UZT A;  1U2B A;  2GJY A;  2MWN B;  2MKR A;  3ULC A;  4EMO A;  1MIX A;  2MFQ A;  2R0D A;  5L81 A;  2I1K A;  2Z0P A;  2COD A;  2EC1 A;  4HAT B;  5C5B B;  1QQG A;  3X23 A;  1RJ2 A;  1DBH A;  3PP2 A;  3VIA A;  1P6S A;  2QKL A;  1PMS A;  5C79 A;  1I7A A;  2R09 A;  1MPH A;  4GXB A;  1ZVR A;  1TXD A;  3WA0 A;  3PVW A;  2P8V A;  2VSZ A;  3V5W A;  1NI2 A;  1UPQ A;  2RGN B;  3TW1 A;  5HE0 A;  1FGZ A;  4HAZ B;  3CXB B;  3QIJ A;  2DA0 A;  4YL8 A;  3AU4 A;  2K2J A;  2H7D A;  3PZD A;  4DXA B;  5EFX A;  4GZU A;  1FB8 A;  4DX8 A;  2ADZ A;  5JHH A;  2EJ8 A;  3BIN A;  2D9X A;  4A6K A;  3A8P A;  2ROV A;  2N23 A;  1WGU A;  1V89 A;  4ZRJ A;  1DYN A;  4K81 A;  4KHB B;  4CYE A;  1GC7 A;  2E2X A;  3ULB A;  1NTY A;  4P7I A;  1OMW A;  4HAU B;  5DHA B;  2NZ8 B;  3GYP A;  4NY0 A;  3U8Z A;  1UNR A;  2D9Y A;  3F0W A;  2BCJ A;  1H4R A;  3SNH A;  2AL6 A;  1V88 A;  5D3Y A;  4WJ7 A;  4GPT B;  1EVH A;  2X18 A;  3PVU A;  2H7E A;  2N0Y A;  2D9Z A;  4K2P A;  1TJ6 A;  2Y8F A;  2DN6 A;  3FSS A;  5HE2 A;  1QC6 A;  3CIK A;  1K5G B;  5JHG A;  1AQC A;  1WGQ A;  4HAV B;  3D8D A;  2CRF A;  1LW3 A;  1WJ1 A;  5DHF B;  2M38 A;  5CLL B;  5KQ1 A;  4HAY B;  1BTK A;  1XKE A;  1DRO A;  3SV1 A;  3P6A A;  1E5W A;  1V5M A;  1Y19 B;  1V5U A;  2G35 A;  2D4Q A;  3D8E A;  4DBB A;  2HE7 A;  4ZRK A;  2ELA A;  1V5P A;  2V76 A;  3SUZ A;  5J3Y A;  3MDB C;  3TFM A;  2DFK A;  2D10 A;  1NU2 A;  1PFJ A;  2COF A;  2M14 A;  4H8S A;  5D3V A;  1M7E A;  5CLQ B;  3QBV B;  2YT0 A;  1W1H A;  2NMB A;  5DIF B;  4HB4 B;  3IVF A;  2ROZ B;  3ZDT A;  3ODW A;  1TQZ A;  1KI1 B;  2DLW A;  4A6H A;  3KSY A;  3DXE A;  1NTV A;  1I2H A;  3DXD A;  1K5D B;  1SGH A;  1FGY A;  1GG3 A;  1V61 A;  3O96 A;  2P0H A;  4F7G A;  1RRP B;  4GMX B;  2OQB A;  5FI0 A;  1X1F A;  5J3T A;  3A98 B;  1LB1 A;  2DKQ A;  5DI9 B;  2DTC A;  3ODO A;  1M7R A;  3M1I B;  2KUP A;  4MY6 A;  2W2X C;  2YVC A;  2W2W A;  3ODX A;  2LOX A;  2VKI A;  1W1G A;  2YRY A;  2DKP A;  3FEH A;  3GYO A;  4YON A;  4DX9 0;  4CHJ A;  1IRS A;  4IOY X;  1MK7 B;  3AJ4 A;  3KRX A;  2LOZ A;  5JLJ B;  4NSW A;  2Z0O A;  3TO1 A;  3DXC A;  5HE3 A;  5GOW B;  1WVH A;  2D9V A;  1WJM A;  2LYD A;  4IAP A;  4TKN A;  4Z2M B;  3U7D A;  1X86 A;  1ISN A;  1N3H A;  1U5E A;  5D3W A;  2XQN M;  4HAX B;  5DH9 B;  1MKE A;  4A6F A;  4KHA A;  2YT1 A;  2EMT A;  3PVL A;  4A6F B;  3D8F A;  1KZG A;  1U5D A;  1OY2 A;  1FHO A;  1J0W A;  1EGX A;  1WI1 A;  2D9W A;  1OQN A;  2UZR A;  5LON B;  1Q67 A;  4KAX B;  4WVF B;  2J0K A;  1MK9 B;  4MK0 A;  1XR0 B;  5HE1 A;  3P7Z A;  2IFS A;  1ZC4 B;  3HW2 B;  1BAK A;  3SO6 A;  1BWN A;  2RVB B;  4K17 A;  4HAW B;  3AU5 A;  2CY5 A;  1UNQ A;  2DYN A;  3F5R A;  4KVG B;  1WG7 A;  1ZSQ A;  5C6R A;  5C5B A;  2GCL A;  5J3Q A;  1X05 A;  2HTH B;  2J0J A;  2ZPY A;  2RNR B;  4KHO A;  2LG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...