1BAKA

Signal transduction pleckstrin homology domain of g-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1), c-terminal extended, nmr, 20 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'GSHMGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords G-PROTEIN COUPLED RECEPTOR KINASE 2
publication title The solution structure and dynamics of the pleckstrin homology domain of G protein-coupled receptor kinase 2 (beta-adrenergic receptor kinase 1). A binding partner of Gbetagamma subunits.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 119
sequence length 119
ec nomenclature ec 2.7.11.15: [Beta-adrenergic-receptor] kinase.
pdb deposition date 1997-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1bakA00
4GMXB 3U8ZA 3LJUX 1XCGA 2OTXA 4CHMA 3MPXA 4CHJA 5JP4A 1XKEA 2DFKA 2QKLA 3KZ1A 5D27A 2YS5A 3TVVA 2IYBA 1Y19B 4F7UP 2YF0A 5FI0A 4WJ7A 2M14A 2P0FA 2R0DA 3FM8C 1H10A 3IVFA 4K81A 2YS3A 1EVHA 2P0DA 2DX5A 2D11A 2GCLA 2X18A 1PLSA 2LOXA 4YL8A 4Z2NA 2DYQA 4PNKA 1UPRA 3HK0A 1WGUA 2DHJA 3KSYA 3G9WA 3PVWA 2CODA 1V89A 3ULCA 5D3WA 2CY4A 3TO1A 1FHWA 2DKQA 2LKOA 2KCJA 3GYOA 4IFSA 3QIJA 4H8SA 3KRXA 2KGXB 2JP2A 2K2UA 4MY6A 1UNQA 2RVBB 2ZPYA 2V76A 1X1FA 3BINA 1W1DA 2K2JA 2I1KA 4BBKA 2D9VA 1V5PA 1W1GA 2HE7A 3CIKA 5JHGA 1TQZA 4ZRKA 2D2QA 2M38A 2Z0QA 3SUZA 1X1GA 1ISNA 4HDQA 1DDWA 5L81A 1RJ2A 5C16A 2P0HA 5EFXA 1E5WA 1XODA 5J3YA 1KZGA 3RCPA 1V5UA 2L1CA 2RSGA 5C5BA 4TKNA 1I2HA 4K2OA 4GMVA 4A6KA 3PSCA 1U5GA 1DROA 3FSSA 4F7HA 1FOEA 3FEHA 4D0NB 1U5DA 2D10A 2DN6A 2LOZA 2FJLA 1KI1B 1MPHA 2DYNA 5KQ4A 2VKIA 3M1IB 1U5EA 2YVCA 4ZRJA 2CRFA 1M7RA 2VSZA 2ROZB 3QBVB 3V5WA 4TYZA 3TFMA 1XD4A 2PZ1A 4CYEA 3PVUA 5KQ1A 5DHAB 5LOPB 2EC1A 1H4RA 2COCA 5J3TA 3D8EA 1BTKA 1PFJA 2DLWA 4HB2B 2J0JA 2P8VA 1MK7B 1P6SA 1V88A 1NTVA 4KHOA 1WGQA 2DHKA 5DIFB 3U7DA 4EMOA 3ML4A 3VIAA 3AU5A 3PP2A 2ADZA 2E2XA 4KVGB 1FHOA 3WA0A 2K00A 1U5FA 2VRWB 1K5DB 1FGYA 3A98B 1IRSA 2AEHA 1EAZA 2J0KA 4HATB 1MK9B 2BCJA 2HTHB 2MDXA 1NU2A 1GC7A 3NSUA 2NMBA 4GN1A 3SNHA 1MIXA 1DDMA 2D9YA 1WJ1A 2L2IA 2OQBA 1EF1A 2D9ZA 3WYFB 2DTCA 5C79A 4KHBB 1TXDA 4NY0A 2I5FA 5JHHA 1FB8A 2DX1A 3TW1A 4ZRIA 2QKMA 1NI2A 2COAA 4L6EA 4A5KA 1U2BA 5D3YA 4C0AA 2DKPA 3VOQA 3MDBC 3F5RA 2W2WA 2G35A 1Z87A 3HW2B 5GOWB 2Z0OA 3QWMA 2AL6A 1X11A 2EJ8A 5FI1A 4HAXB 4IAPA 2MKRA 3SO6A 2UZSA 3KY9A 1U27A 2YRYA 4F7GA 4HDOA 5DH9B 1DBHA 1GG3A 1KZ7A 3F0WA 3P6AA 3PEGA 4DX90 4PQ0A 1SHCA 2H7EA 3ODWA 2UZRA 3HQCA 5DHFB 1P3RA 4DXAB 1AWEA 2YS1A 4MK0A 4WVFB 4A6FA 3DXDA 4K2PA 3ODXA 2CY5A 4HB0B 4XWXA 4GPTB 2MFQA 5KCVA 1WG7A 5CLLB 4HB3B 1M7EA 4DBBA 2IFSA 1ZM0A 5HE0A 2RUKB 1U29A 2Z0PA 4GXBA 2RGNB 1B55A 2LG1A 3P7ZA 2NZ8B 2RNRB 2GCJA 2D4QA 3ULBA 1EGXA 5JLJB 1UEFA 2RLOA 5CLQB 1WJMA 2EMSA 2J0MA 3SYXA 3ZDTA 2W2XC 3O96A 3GYPA 1N3HA 1LW3A 1V61A 1Q67A 3X23A 1MAIA 3A8PA 1P5TA 2CAYA 4IOYX 1GC6A 1BTNA 1J19A 1MIZB 3KRWA 2MWNB 1ZSQA 2LULA 1W1HA 3D8DA 2D9XA 3PG7A 2N0YA 3ZVRA 1WVHA 2ROVA 1FHXA 2YT0A 5HE3A 4DX8A 2J59M 1LB1A 4A6HA 1OQNA 2I5CA 4HAVB 5HE2A 1K5GB 3CXBB 2H7DA 1UNPA 1XX0A 4HAZB 4YONA 3T06A 4HAUB 4EJNA 5HE1A 1RRPB 5LONB 1QQGA 1XR0B 1ZC4B 2YSZA 2D9WA 2I1JA 2Y8GA 1OMWA 4NSWA 2W2XD 3D8FA 2Y8FA 4HAYB 3BJIA 2GJYA 1I7AA 2GS0A 5C5BB 3TCAA 2Y7BA 3AU4A 1X86A 1UPQA 1NTYA 1FAOA 1SGHA 5D3VA 1J0WA 1V5MA 2N23A 2COFA 1X05A 2DHIA 4A6FB 3ODOA 2ELAA 2LYDA 5J3QA 4K17A 4GZUA 4Y94A 3DXCA 2R09A 1MKEA 2UVMA 4HB4B 3PVLA 1WI1A 3SV1A 5C6RA 3AJ4A 3UZTA 1PMSA 4EKUA 1FGZA 1ZC3B 4P7IA 1DYNA 1Y5OA 2YT1A 1AQCA 1ZVRA 1UNRA 3DXEA 2EMTA 4MT7A 1DDVA 1BWNA 4KAXB 2XQNM 5D3XA 1QC6A 2KUPA 4B6HA 4KHAA 4HHVA 4Z2MB 1TJ6A 4HAWB 2Q13A 5DI9B 2DA0A 3PZDA 2ELBA 1OY2A 3A8QA 3OANA 4WSFA 3N7CA 1BAKA
chains in the Genus database with same CATH superfamily
4GMXB 3HSAA 3U8ZA 3LJUX 1XCGA 2OTXA 4CHMA 3MPXA 4CHJA 5JP4A 1XKEA 2K49A 2DFKA 2QKLA 3KZ1A 5D27A 2YS5A 2Z13A 3TVVA 2IYBA 1Y19B 4F7UP 4GOUA 2YF0A 5FI0A 4WJ7A 2M14A 2P0FA 2R0DA 3FM8C 1H10A 3IVFA 4K81A 2YS3A 1EVHA 2P0DA 2DX5A 2D11A 2GCLA 2X18A 1PLSA 2KUQA 2LOXA 4YL8A 4Z2NA 3A58A 2DYQA 2GUMA 4PNKA 4HSIA 1UPRA 3HK0A 1WGUA 2DHJA 3KSYA 3G9WA 3PVWA 2CODA 1V89A 3ULCA 5D3WA 2CY4A 3TO1A 1FHWA 2DKQA 2LKOA 2KCJA 3GYOA 4IFSA 3QIJA 4H8SA 3KRXA 2KGXB 2JP2A 2K2UA 2KR0A 4MY6A 1UNQA 2RVBB 2ZPYA 2V76A 2YT2A 1X1FA 3BINA 1W1DA 2K2JA 2I1KA 4BBKA 2D9VA 1V5PA 1W1GA 2HE7A 3CIKA 5JHGA 2KIEA 1TQZA 4ZRKA 2D2QA 2M38A 2Z0QA 3SUZA 1X1GA 1ISNA 4HDQA 1DDWA 5L81A 1RJ2A 5C16A 2P0HA 5EFXA 1E5WA 1XODA 5J3YA 1KZGA 3RCPA 1V5UA 2L1CA 2RSGA 5C5BA 4TKNA 1I2HA 4K2OA 4GMVA 4A6KA 3PSCA 1U5GA 1DROA 3FSSA 4F7HA 1FOEA 3FEHA 4D0NB 1U5DA 2D10A 2DN6A 2LOZA 2FJLA 1KI1B 1MPHA 3NWDA 2DYNA 5KQ4A 2VKIA 3M1IB 1U5EA 2YVCA 4ZRJA 2CRFA 1M7RA 2VSZA 2ROZB 3QBVB 3V5WA 4TYZA 3TFMA 1XD4A 4D6WA 2PZ1A 4CYEA 3PVUA 5KQ1A 5DHAB 5LOPB 2EC1A 1H4RA 2COCA 5J3TA 3D8EA 1BTKA 1PFJA 2DLWA 4HB2B 5M4YB 2J0JA 2P8VA 1MK7B 1P6SA 1V88A 5I2SA 1NTVA 4KHOA 1ZYIA 1WGQA 2DHKA 5DIFB 3U7DA 4EMOA 3NWAA 3ML4A 3VIAA 3AU5A 3PP2A 2ADZA 2E2XA 4KVGB 1FHOA 3FVCA 2ZKMX 3WA0A 3NW8A 2K00A 1U5FA 2VRWB 1K5DB 1FGYA 3A98B 1IRSA 2Z4DA 2AEHA 1EAZA 2J0KA 4HATB 1MK9B 2BCJA 2HTHB 2MDXA 1NU2A 1GC7A 3NSUA 2NMBA 4GN1A 3SNHA 1MIXA 1DDMA 2D9YA 1WJ1A 2L2IA 2OQBA 1EF1A 2D9ZA 3WYFB 2DTCA 5IRSA 5C79A 4KHBB 1TXDA 4NY0A 2I5FA 5JHHA 4L1RA 1FB8A 2DX1A 3TW1A 4ZRIA 2QKMA 1NI2A 2COAA 4L6EA 4A5KA 1U2BA 5D3YA 4C0AA 2DKPA 3VOQA 3U12A 3MDBC 3F5RA 2W2WA 2G35A 1Z87A 3HW2B 5GOWB 2Z0OA 3QWMA 2AL6A 1X11A 1T77A 2EJ8A 5FI1A 4HAXB 2RRFA 4IAPA 2MKRA 3SO6A 2UZSA 3KY9A 5I2MA 1U27A 2YRYA 4F7GA 4HDOA 5DH9B 1DBHA 1GG3A 1KZ7A 3F0WA 3P6AA 3PEGA 4DX90 4PQ0A 3DCXA 1SHCA 2H7EA 3ODWA 2UZRA 3HIEA 4DIXA 3HQCA 2KIGA 5DHFB 1P3RA 4DXAB 1AWEA 2YS1A 4MK0A 4WVFB 4A6FA 3DXDA 4K2PA 3ODXA 2CY5A 4HB0B 4XWXA 4GPTB 2MFQA 5KCVA 1WG7A 5CLLB 4QJ5B 4HB3B 1M7EA 4DBBA 2IFSA 1ZM0A 5HE0A 2RUKB 2R2YA 1U29A 2Z0PA 4GXBA 2RGNB 1B55A 2LG1A 3P7ZA 2NZ8B 2RNRB 2GCJA 2D4QA 3ULBA 1EGXA 5JLJB 1UEFA 2RLOA 5CLQB 1WJMA 2EMSA 2J0MA 3SYXA 3ZDTA 2W2XC 3O96A 3NWFA 3GYPA 1N3HA 1LW3A 1V61A 1Q67A 3X23A 1MAIA 3A8PA 1P5TA 2CAYA 4IOYX 4OSNA 1GC6A 1BTNA 1J19A 1MIZB 1MI1A 4CSQA 3KRWA 2MWNB 1ZSQA 2LULA 1W1HA 3D8DA 2D9XA 3PG7A 2N0YA 3ZVRA 1WVHA 2ROVA 4QJ3B 1FHXA 2YT0A 5HE3A 4DX8A 2J59M 1LB1A 4A6HA 1OQNA 2I5CA 3B77A 4HAVB 5HE2A 1K5GB 3CXBB 2H7DA 1UNPA 1XX0A 4QXAB 2FJUB 4HAZB 4YONA 3T06A 4HAUB 4EJNA 5HE1A 1RRPB 5LONB 1QQGA 1XR0B 1ZC4B 2YSZA 2D9WA 2I1JA 4GNKB 2Y8GA 1OMWA 3OHMB 4NSWA 2W2XD 3D8FA 2Y8FA 4KHBA 4HAYB 3BJIA 2GJYA 1I7AA 2GS0A 5C5BB 3TCAA 2Y7BA 3AU4A 1X86A 2NBVA 1UPQA 1NTYA 1FAOA 1SGHA 5D3VA 1J0WA 1V5MA 2N23A 2COFA 1X05A 2DHIA 2Z14A 4A6FB 3ODOA 4QJ4B 2ELAA 2LYDA 5J3QA 4K17A 4GZUA 4Y94A 3DXCA 2R09A 2K8EA 1MKEA 2UVMA 4HB4B 3PVLA 1WI1A 3SV1A 5C6RA 3AJ4A 3UZTA 1PMSA 4OT1A 4EKUA 1FGZA 2Z59A 1ZC3B 4P7IA 1DYNA 1Y5OA 2YT1A 1AQCA 1ZVRA 1UNRA 3DXEA 2EMTA 4MT7A 1DDVA 1BWNA 4KAXB 2XQNM 5D3XA 5LG4B 1QC6A 2KUPA 4B6HA 4KHAA 4HHVA 4Z2MB 1TJ6A 4HAWB 2Q13A 5DI9B 2DA0A 3PZDA 2ELBA 1OY2A 3A8QA 3OANA 4WSFA 3N7CA 1BAKA
chains in the Genus database with same CATH topology
4GMXB 3U8ZA 3LJUX 1XCGA 2OTXA 4CHMA 3MPXA 4CHJA 5JP4A 1XKEA 2DFKA 2QKLA 3KZ1A 5D27A 2YS5A 3TVVA 2IYBA 1Y19B 4F7UP 2YF0A 5FI0A 4WJ7A 2M14A 2P0FA 2R0DA 3FM8C 1H10A 3IVFA 4K81A 2YS3A 1EVHA 2P0DA 2DX5A 2D11A 2GCLA 2X18A 1PLSA 2LOXA 4YL8A 4Z2NA 2DYQA 4PNKA 1UPRA 3HK0A 1WGUA 2DHJA 3KSYA 3G9WA 3PVWA 2CODA 1V89A 3ULCA 5D3WA 2CY4A 3TO1A 1FHWA 2DKQA 2LKOA 2KCJA 3GYOA 4IFSA 3QIJA 4H8SA 3KRXA 2KGXB 2JP2A 2K2UA 4MY6A 1UNQA 2RVBB 2ZPYA 2V76A 1X1FA 3BINA 1W1DA 2K2JA 2I1KA 4BBKA 2D9VA 1V5PA 1W1GA 2HE7A 3CIKA 5JHGA 1TQZA 4ZRKA 2D2QA 2M38A 2Z0QA 3SUZA 1X1GA 1ISNA 4HDQA 1DDWA 5L81A 1RJ2A 5C16A 2P0HA 5EFXA 1E5WA 1XODA 5J3YA 1KZGA 3RCPA 1V5UA 2L1CA 2RSGA 5C5BA 4TKNA 1I2HA 4K2OA 4GMVA 4A6KA 3PSCA 1U5GA 1DROA 3FSSA 4F7HA 1FOEA 3FEHA 4D0NB 1U5DA 2D10A 2DN6A 2LOZA 2FJLA 1KI1B 1MPHA 2DYNA 5KQ4A 2VKIA 3M1IB 1U5EA 2YVCA 4ZRJA 2CRFA 1M7RA 2VSZA 2ROZB 3QBVB 3V5WA 4TYZA 3TFMA 1XD4A 2PZ1A 4CYEA 3PVUA 5KQ1A 5DHAB 5LOPB 2EC1A 1H4RA 2COCA 5J3TA 3D8EA 1BTKA 1PFJA 2DLWA 4HB2B 2J0JA 2P8VA 1MK7B 1P6SA 1V88A 1NTVA 4KHOA 1WGQA 2DHKA 5DIFB 3U7DA 4EMOA 3ML4A 3VIAA 3AU5A 3PP2A 2ADZA 2E2XA 4KVGB 1FHOA 3WA0A 2K00A 1U5FA 2VRWB 1K5DB 1FGYA 3A98B 1IRSA 2AEHA 1EAZA 2J0KA 4HATB 1MK9B 2BCJA 2HTHB 2MDXA 1NU2A 1GC7A 3NSUA 2NMBA 4GN1A 3SNHA 1MIXA 1DDMA 2D9YA 1WJ1A 2L2IA 2OQBA 1EF1A 2D9ZA 3WYFB 2DTCA 5C79A 4KHBB 1TXDA 4NY0A 2I5FA 5JHHA 1FB8A 2DX1A 3TW1A 4ZRIA 2QKMA 1NI2A 2COAA 4L6EA 4A5KA 1U2BA 5D3YA 4C0AA 2DKPA 3VOQA 3MDBC 3F5RA 2W2WA 2G35A 1Z87A 3HW2B 5GOWB 2Z0OA 3QWMA 2AL6A 1X11A 2EJ8A 5FI1A 4HAXB 4IAPA 2MKRA 3SO6A 2UZSA 3KY9A 1U27A 2YRYA 4F7GA 4HDOA 5DH9B 1DBHA 1GG3A 1KZ7A 3F0WA 3P6AA 3PEGA 4DX90 4PQ0A 1SHCA 2H7EA 3ODWA 2UZRA 3HQCA 5DHFB 1P3RA 4DXAB 1AWEA 2YS1A 4MK0A 4WVFB 4A6FA 3DXDA 4K2PA 3ODXA 2CY5A 4HB0B 4XWXA 4GPTB 2MFQA 5KCVA 1WG7A 5CLLB 4HB3B 1M7EA 4DBBA 2IFSA 1ZM0A 5HE0A 2RUKB 1U29A 2Z0PA 4GXBA 2RGNB 1B55A 2LG1A 3P7ZA 2NZ8B 2RNRB 2GCJA 2D4QA 3ULBA 1EGXA 5JLJB 1UEFA 2RLOA 5CLQB 1WJMA 2EMSA 2J0MA 3SYXA 3ZDTA 2W2XC 3O96A 3GYPA 1N3HA 1LW3A 1V61A 1Q67A 3X23A 1MAIA 3A8PA 1P5TA 2CAYA 4IOYX 1GC6A 1BTNA 1J19A 1MIZB 3KRWA 2MWNB 1ZSQA 2LULA 1W1HA 3D8DA 2D9XA 3PG7A 2N0YA 3ZVRA 1WVHA 2ROVA 1FHXA 2YT0A 5HE3A 4DX8A 2J59M 1LB1A 4A6HA 1OQNA 2I5CA 4HAVB 5HE2A 1K5GB 3CXBB 2H7DA 1UNPA 1XX0A 4HAZB 4YONA 3T06A 4HAUB 4EJNA 5HE1A 1RRPB 5LONB 1QQGA 1XR0B 1ZC4B 2YSZA 2D9WA 2I1JA 2Y8GA 1OMWA 4NSWA 2W2XD 3D8FA 2Y8FA 4HAYB 3BJIA 2GJYA 1I7AA 2GS0A 5C5BB 3TCAA 2Y7BA 3AU4A 1X86A 1UPQA 1NTYA 1FAOA 1SGHA 5D3VA 1J0WA 1V5MA 2N23A 2COFA 1X05A 2DHIA 4A6FB 3ODOA 2ELAA 2LYDA 5J3QA 4K17A 4GZUA 4Y94A 3DXCA 2R09A 1MKEA 2UVMA 4HB4B 3PVLA 1WI1A 3SV1A 5C6RA 3AJ4A 3UZTA 1PMSA 4EKUA 1FGZA 1ZC3B 4P7IA 1DYNA 1Y5OA 2YT1A 1AQCA 1ZVRA 1UNRA 3DXEA 2EMTA 4MT7A 1DDVA 1BWNA 4KAXB 2XQNM 5D3XA 1QC6A 2KUPA 4B6HA 4KHAA 4HHVA 4Z2MB 1TJ6A 4HAWB 2Q13A 5DI9B 2DA0A 3PZDA 2ELBA 1OY2A 3A8QA 3OANA 4WSFA 3N7CA 1BAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMX B;  3U8Z A;  3LJU X;  1XCG A;  2OTX A;  4CHM A;  3MPX A;  4CHJ A;  5JP4 A;  1XKE A;  2DFK A;  2QKL A;  3KZ1 A;  5D27 A;  2YS5 A;  3TVV A;  2IYB A;  1Y19 B;  4F7U P;  2YF0 A;  5FI0 A;  4WJ7 A;  2M14 A;  2P0F A;  2R0D A;  3FM8 C;  1H10 A;  3IVF A;  4K81 A;  2YS3 A;  1EVH A;  2P0D A;  2DX5 A;  2D11 A;  2GCL A;  2X18 A;  1PLS A;  2LOX A;  4YL8 A;  4Z2N A;  2DYQ A;  4PNK A;  1UPR A;  3HK0 A;  1WGU A;  2DHJ A;  3KSY A;  3G9W A;  3PVW A;  2COD A;  1V89 A;  3ULC A;  5D3W A;  2CY4 A;  3TO1 A;  1FHW A;  2DKQ A;  2LKO A;  2KCJ A;  3GYO A;  4IFS A;  3QIJ A;  4H8S A;  3KRX A;  2KGX B;  2JP2 A;  2K2U A;  4MY6 A;  1UNQ A;  2RVB B;  2ZPY A;  2V76 A;  1X1F A;  3BIN A;  1W1D A;  2K2J A;  2I1K A;  4BBK A;  2D9V A;  1V5P A;  1W1G A;  2HE7 A;  3CIK A;  5JHG A;  1TQZ A;  4ZRK A;  2D2Q A;  2M38 A;  2Z0Q A;  3SUZ A;  1X1G A;  1ISN A;  4HDQ A;  1DDW A;  5L81 A;  1RJ2 A;  5C16 A;  2P0H A;  5EFX A;  1E5W A;  1XOD A;  5J3Y A;  1KZG A;  3RCP A;  1V5U A;  2L1C A;  2RSG A;  5C5B A;  4TKN A;  1I2H A;  4K2O A;  4GMV A;  4A6K A;  3PSC A;  1U5G A;  1DRO A;  3FSS A;  4F7H A;  1FOE A;  3FEH A;  4D0N B;  1U5D A;  2D10 A;  2DN6 A;  2LOZ A;  2FJL A;  1KI1 B;  1MPH A;  2DYN A;  5KQ4 A;  2VKI A;  3M1I B;  1U5E A;  2YVC A;  4ZRJ A;  2CRF A;  1M7R A;  2VSZ A;  2ROZ B;  3QBV B;  3V5W A;  4TYZ A;  3TFM A;  1XD4 A;  2PZ1 A;  4CYE A;  3PVU A;  5KQ1 A;  5DHA B;  5LOP B;  2EC1 A;  1H4R A;  2COC A;  5J3T A;  3D8E A;  1BTK A;  1PFJ A;  2DLW A;  4HB2 B;  2J0J A;  2P8V A;  1MK7 B;  1P6S A;  1V88 A;  1NTV A;  4KHO A;  1WGQ A;  2DHK A;  5DIF B;  3U7D A;  4EMO A;  3ML4 A;  3VIA A;  3AU5 A;  3PP2 A;  2ADZ A;  2E2X A;  4KVG B;  1FHO A;  3WA0 A;  2K00 A;  1U5F A;  2VRW B;  1K5D B;  1FGY A;  3A98 B;  1IRS A;  2AEH A;  1EAZ A;  2J0K A;  4HAT B;  1MK9 B;  2BCJ A;  2HTH B;  2MDX A;  1NU2 A;  1GC7 A;  3NSU A;  2NMB A;  4GN1 A;  3SNH A;  1MIX A;  1DDM A;  2D9Y A;  1WJ1 A;  2L2I A;  2OQB A;  1EF1 A;  2D9Z A;  3WYF B;  2DTC A;  5C79 A;  4KHB B;  1TXD A;  4NY0 A;  2I5F A;  5JHH A;  1FB8 A;  2DX1 A;  3TW1 A;  4ZRI A;  2QKM A;  1NI2 A;  2COA A;  4L6E A;  4A5K A;  1U2B A;  5D3Y A;  4C0A A;  2DKP A;  3VOQ A;  3MDB C;  3F5R A;  2W2W A;  2G35 A;  1Z87 A;  3HW2 B;  5GOW B;  2Z0O A;  3QWM A;  2AL6 A;  1X11 A;  2EJ8 A;  5FI1 A;  4HAX B;  4IAP A;  2MKR A;  3SO6 A;  2UZS A;  3KY9 A;  1U27 A;  2YRY A;  4F7G A;  4HDO A;  5DH9 B;  1DBH A;  1GG3 A;  1KZ7 A;  3F0W A;  3P6A A;  3PEG A;  4DX9 0;  4PQ0 A;  1SHC A;  2H7E A;  3ODW A;  2UZR A;  3HQC A;  5DHF B;  1P3R A;  4DXA B;  1AWE A;  2YS1 A;  4MK0 A;  4WVF B;  4A6F A;  3DXD A;  4K2P A;  3ODX A;  2CY5 A;  4HB0 B;  4XWX A;  4GPT B;  2MFQ A;  5KCV A;  1WG7 A;  5CLL B;  4HB3 B;  1M7E A;  4DBB A;  2IFS A;  1ZM0 A;  5HE0 A;  2RUK B;  1U29 A;  2Z0P A;  4GXB A;  2RGN B;  1B55 A;  2LG1 A;  3P7Z A;  2NZ8 B;  2RNR B;  2GCJ A;  2D4Q A;  3ULB A;  1EGX A;  5JLJ B;  1UEF A;  2RLO A;  5CLQ B;  1WJM A;  2EMS A;  2J0M A;  3SYX A;  3ZDT A;  2W2X C;  3O96 A;  3GYP A;  1N3H A;  1LW3 A;  1V61 A;  1Q67 A;  3X23 A;  1MAI A;  3A8P A;  1P5T A;  2CAY A;  4IOY X;  1GC6 A;  1BTN A;  1J19 A;  1MIZ B;  3KRW A;  2MWN B;  1ZSQ A;  2LUL A;  1W1H A;  3D8D A;  2D9X A;  3PG7 A;  2N0Y A;  3ZVR A;  1WVH A;  2ROV A;  1FHX A;  2YT0 A;  5HE3 A;  4DX8 A;  2J59 M;  1LB1 A;  4A6H A;  1OQN A;  2I5C A;  4HAV B;  5HE2 A;  1K5G B;  3CXB B;  2H7D A;  1UNP A;  1XX0 A;  4HAZ B;  4YON A;  3T06 A;  4HAU B;  4EJN A;  5HE1 A;  1RRP B;  5LON B;  1QQG A;  1XR0 B;  1ZC4 B;  2YSZ A;  2D9W A;  2I1J A;  2Y8G A;  1OMW A;  4NSW A;  2W2X D;  3D8F A;  2Y8F A;  4HAY B;  3BJI A;  2GJY A;  1I7A A;  2GS0 A;  5C5B B;  3TCA A;  2Y7B A;  3AU4 A;  1X86 A;  1UPQ A;  1NTY A;  1FAO A;  1SGH A;  5D3V A;  1J0W A;  1V5M A;  2N23 A;  2COF A;  1X05 A;  2DHI A;  4A6F B;  3ODO A;  2ELA A;  2LYD A;  5J3Q A;  4K17 A;  4GZU A;  4Y94 A;  3DXC A;  2R09 A;  1MKE A;  2UVM A;  4HB4 B;  3PVL A;  1WI1 A;  3SV1 A;  5C6R A;  3AJ4 A;  3UZT A;  1PMS A;  4EKU A;  1FGZ A;  1ZC3 B;  4P7I A;  1DYN A;  1Y5O A;  2YT1 A;  1AQC A;  1ZVR A;  1UNR A;  3DXE A;  2EMT A;  4MT7 A;  1DDV A;  1BWN A;  4KAX B;  2XQN M;  5D3X A;  1QC6 A;  2KUP A;  4B6H A;  4KHA A;  4HHV A;  4Z2M B;  1TJ6 A;  4HAW B;  2Q13 A;  5DI9 B;  2DA0 A;  3PZD A;  2ELB A;  1OY2 A;  3A8Q A;  3OAN A;  4WSF A;  3N7C A;  1BAK A; 
#chains in the Genus database with same CATH topology
 4GMX B;  3HSA A;  3U8Z A;  3LJU X;  1XCG A;  2OTX A;  4CHM A;  3MPX A;  4CHJ A;  5JP4 A;  1XKE A;  2K49 A;  2DFK A;  2QKL A;  3KZ1 A;  5D27 A;  2YS5 A;  2Z13 A;  3TVV A;  2IYB A;  1Y19 B;  4F7U P;  4GOU A;  2YF0 A;  5FI0 A;  4WJ7 A;  2M14 A;  2P0F A;  2R0D A;  3FM8 C;  1H10 A;  3IVF A;  4K81 A;  2YS3 A;  1EVH A;  2P0D A;  2DX5 A;  2D11 A;  2GCL A;  2X18 A;  1PLS A;  2KUQ A;  2LOX A;  4YL8 A;  4Z2N A;  3A58 A;  2DYQ A;  2GUM A;  4PNK A;  4HSI A;  1UPR A;  3HK0 A;  1WGU A;  2DHJ A;  3KSY A;  3G9W A;  3PVW A;  2COD A;  1V89 A;  3ULC A;  5D3W A;  2CY4 A;  3TO1 A;  1FHW A;  2DKQ A;  2LKO A;  2KCJ A;  3GYO A;  4IFS A;  3QIJ A;  4H8S A;  3KRX A;  2KGX B;  2JP2 A;  2K2U A;  2KR0 A;  4MY6 A;  1UNQ A;  2RVB B;  2ZPY A;  2V76 A;  2YT2 A;  1X1F A;  3BIN A;  1W1D A;  2K2J A;  2I1K A;  4BBK A;  2D9V A;  1V5P A;  1W1G A;  2HE7 A;  3CIK A;  5JHG A;  2KIE A;  1TQZ A;  4ZRK A;  2D2Q A;  2M38 A;  2Z0Q A;  3SUZ A;  1X1G A;  1ISN A;  4HDQ A;  1DDW A;  5L81 A;  1RJ2 A;  5C16 A;  2P0H A;  5EFX A;  1E5W A;  1XOD A;  5J3Y A;  1KZG A;  3RCP A;  1V5U A;  2L1C A;  2RSG A;  5C5B A;  4TKN A;  1I2H A;  4K2O A;  4GMV A;  4A6K A;  3PSC A;  1U5G A;  1DRO A;  3FSS A;  4F7H A;  1FOE A;  3FEH A;  4D0N B;  1U5D A;  2D10 A;  2DN6 A;  2LOZ A;  2FJL A;  1KI1 B;  1MPH A;  3NWD A;  2DYN A;  5KQ4 A;  2VKI A;  3M1I B;  1U5E A;  2YVC A;  4ZRJ A;  2CRF A;  1M7R A;  2VSZ A;  2ROZ B;  3QBV B;  3V5W A;  4TYZ A;  3TFM A;  1XD4 A;  4D6W A;  2PZ1 A;  4CYE A;  3PVU A;  5KQ1 A;  5DHA B;  5LOP B;  2EC1 A;  1H4R A;  2COC A;  5J3T A;  3D8E A;  1BTK A;  1PFJ A;  2DLW A;  4HB2 B;  5M4Y B;  2J0J A;  2P8V A;  1MK7 B;  1P6S A;  1V88 A;  5I2S A;  1NTV A;  4KHO A;  1ZYI A;  1WGQ A;  2DHK A;  5DIF B;  3U7D A;  4EMO A;  3NWA A;  3ML4 A;  3VIA A;  3AU5 A;  3PP2 A;  2ADZ A;  2E2X A;  4KVG B;  1FHO A;  3FVC A;  2ZKM X;  3WA0 A;  3NW8 A;  2K00 A;  1U5F A;  2VRW B;  1K5D B;  1FGY A;  3A98 B;  1IRS A;  2Z4D A;  2AEH A;  1EAZ A;  2J0K A;  4HAT B;  1MK9 B;  2BCJ A;  2HTH B;  2MDX A;  1NU2 A;  1GC7 A;  3NSU A;  2NMB A;  4GN1 A;  3SNH A;  1MIX A;  1DDM A;  2D9Y A;  1WJ1 A;  2L2I A;  2OQB A;  1EF1 A;  2D9Z A;  3WYF B;  2DTC A;  5IRS A;  5C79 A;  4KHB B;  1TXD A;  4NY0 A;  2I5F A;  5JHH A;  4L1R A;  1FB8 A;  2DX1 A;  3TW1 A;  4ZRI A;  2QKM A;  1NI2 A;  2COA A;  4L6E A;  4A5K A;  1U2B A;  5D3Y A;  4C0A A;  2DKP A;  3VOQ A;  3U12 A;  3MDB C;  3F5R A;  2W2W A;  2G35 A;  1Z87 A;  3HW2 B;  5GOW B;  2Z0O A;  3QWM A;  2AL6 A;  1X11 A;  1T77 A;  2EJ8 A;  5FI1 A;  4HAX B;  2RRF A;  4IAP A;  2MKR A;  3SO6 A;  2UZS A;  3KY9 A;  5I2M A;  1U27 A;  2YRY A;  4F7G A;  4HDO A;  5DH9 B;  1DBH A;  1GG3 A;  1KZ7 A;  3F0W A;  3P6A A;  3PEG A;  4DX9 0;  4PQ0 A;  3DCX A;  1SHC A;  2H7E A;  3ODW A;  2UZR A;  3HIE A;  4DIX A;  3HQC A;  2KIG A;  5DHF B;  1P3R A;  4DXA B;  1AWE A;  2YS1 A;  4MK0 A;  4WVF B;  4A6F A;  3DXD A;  4K2P A;  3ODX A;  2CY5 A;  4HB0 B;  4XWX A;  4GPT B;  2MFQ A;  5KCV A;  1WG7 A;  5CLL B;  4QJ5 B;  4HB3 B;  1M7E A;  4DBB A;  2IFS A;  1ZM0 A;  5HE0 A;  2RUK B;  2R2Y A;  1U29 A;  2Z0P A;  4GXB A;  2RGN B;  1B55 A;  2LG1 A;  3P7Z A;  2NZ8 B;  2RNR B;  2GCJ A;  2D4Q A;  3ULB A;  1EGX A;  5JLJ B;  1UEF A;  2RLO A;  5CLQ B;  1WJM A;  2EMS A;  2J0M A;  3SYX A;  3ZDT A;  2W2X C;  3O96 A;  3NWF A;  3GYP A;  1N3H A;  1LW3 A;  1V61 A;  1Q67 A;  3X23 A;  1MAI A;  3A8P A;  1P5T A;  2CAY A;  4IOY X;  4OSN A;  1GC6 A;  1BTN A;  1J19 A;  1MIZ B;  1MI1 A;  4CSQ A;  3KRW A;  2MWN B;  1ZSQ A;  2LUL A;  1W1H A;  3D8D A;  2D9X A;  3PG7 A;  2N0Y A;  3ZVR A;  1WVH A;  2ROV A;  4QJ3 B;  1FHX A;  2YT0 A;  5HE3 A;  4DX8 A;  2J59 M;  1LB1 A;  4A6H A;  1OQN A;  2I5C A;  3B77 A;  4HAV B;  5HE2 A;  1K5G B;  3CXB B;  2H7D A;  1UNP A;  1XX0 A;  4QXA B;  2FJU B;  4HAZ B;  4YON A;  3T06 A;  4HAU B;  4EJN A;  5HE1 A;  1RRP B;  5LON B;  1QQG A;  1XR0 B;  1ZC4 B;  2YSZ A;  2D9W A;  2I1J A;  4GNK B;  2Y8G A;  1OMW A;  3OHM B;  4NSW A;  2W2X D;  3D8F A;  2Y8F A;  4KHB A;  4HAY B;  3BJI A;  2GJY A;  1I7A A;  2GS0 A;  5C5B B;  3TCA A;  2Y7B A;  3AU4 A;  1X86 A;  2NBV A;  1UPQ A;  1NTY A;  1FAO A;  1SGH A;  5D3V A;  1J0W A;  1V5M A;  2N23 A;  2COF A;  1X05 A;  2DHI A;  2Z14 A;  4A6F B;  3ODO A;  4QJ4 B;  2ELA A;  2LYD A;  5J3Q A;  4K17 A;  4GZU A;  4Y94 A;  3DXC A;  2R09 A;  2K8E A;  1MKE A;  2UVM A;  4HB4 B;  3PVL A;  1WI1 A;  3SV1 A;  5C6R A;  3AJ4 A;  3UZT A;  1PMS A;  4OT1 A;  4EKU A;  1FGZ A;  2Z59 A;  1ZC3 B;  4P7I A;  1DYN A;  1Y5O A;  2YT1 A;  1AQC A;  1ZVR A;  1UNR A;  3DXE A;  2EMT A;  4MT7 A;  1DDV A;  1BWN A;  4KAX B;  2XQN M;  5D3X A;  5LG4 B;  1QC6 A;  2KUP A;  4B6H A;  4KHA A;  4HHV A;  4Z2M B;  1TJ6 A;  4HAW B;  2Q13 A;  5DI9 B;  2DA0 A;  3PZD A;  2ELB A;  1OY2 A;  3A8Q A;  3OAN A;  4WSF A;  3N7C A;  1BAK A; 
#chains in the Genus database with same CATH homology
 4GMX B;  3U8Z A;  3LJU X;  1XCG A;  2OTX A;  4CHM A;  3MPX A;  4CHJ A;  5JP4 A;  1XKE A;  2DFK A;  2QKL A;  3KZ1 A;  5D27 A;  2YS5 A;  3TVV A;  2IYB A;  1Y19 B;  4F7U P;  2YF0 A;  5FI0 A;  4WJ7 A;  2M14 A;  2P0F A;  2R0D A;  3FM8 C;  1H10 A;  3IVF A;  4K81 A;  2YS3 A;  1EVH A;  2P0D A;  2DX5 A;  2D11 A;  2GCL A;  2X18 A;  1PLS A;  2LOX A;  4YL8 A;  4Z2N A;  2DYQ A;  4PNK A;  1UPR A;  3HK0 A;  1WGU A;  2DHJ A;  3KSY A;  3G9W A;  3PVW A;  2COD A;  1V89 A;  3ULC A;  5D3W A;  2CY4 A;  3TO1 A;  1FHW A;  2DKQ A;  2LKO A;  2KCJ A;  3GYO A;  4IFS A;  3QIJ A;  4H8S A;  3KRX A;  2KGX B;  2JP2 A;  2K2U A;  4MY6 A;  1UNQ A;  2RVB B;  2ZPY A;  2V76 A;  1X1F A;  3BIN A;  1W1D A;  2K2J A;  2I1K A;  4BBK A;  2D9V A;  1V5P A;  1W1G A;  2HE7 A;  3CIK A;  5JHG A;  1TQZ A;  4ZRK A;  2D2Q A;  2M38 A;  2Z0Q A;  3SUZ A;  1X1G A;  1ISN A;  4HDQ A;  1DDW A;  5L81 A;  1RJ2 A;  5C16 A;  2P0H A;  5EFX A;  1E5W A;  1XOD A;  5J3Y A;  1KZG A;  3RCP A;  1V5U A;  2L1C A;  2RSG A;  5C5B A;  4TKN A;  1I2H A;  4K2O A;  4GMV A;  4A6K A;  3PSC A;  1U5G A;  1DRO A;  3FSS A;  4F7H A;  1FOE A;  3FEH A;  4D0N B;  1U5D A;  2D10 A;  2DN6 A;  2LOZ A;  2FJL A;  1KI1 B;  1MPH A;  2DYN A;  5KQ4 A;  2VKI A;  3M1I B;  1U5E A;  2YVC A;  4ZRJ A;  2CRF A;  1M7R A;  2VSZ A;  2ROZ B;  3QBV B;  3V5W A;  4TYZ A;  3TFM A;  1XD4 A;  2PZ1 A;  4CYE A;  3PVU A;  5KQ1 A;  5DHA B;  5LOP B;  2EC1 A;  1H4R A;  2COC A;  5J3T A;  3D8E A;  1BTK A;  1PFJ A;  2DLW A;  4HB2 B;  2J0J A;  2P8V A;  1MK7 B;  1P6S A;  1V88 A;  1NTV A;  4KHO A;  1WGQ A;  2DHK A;  5DIF B;  3U7D A;  4EMO A;  3ML4 A;  3VIA A;  3AU5 A;  3PP2 A;  2ADZ A;  2E2X A;  4KVG B;  1FHO A;  3WA0 A;  2K00 A;  1U5F A;  2VRW B;  1K5D B;  1FGY A;  3A98 B;  1IRS A;  2AEH A;  1EAZ A;  2J0K A;  4HAT B;  1MK9 B;  2BCJ A;  2HTH B;  2MDX A;  1NU2 A;  1GC7 A;  3NSU A;  2NMB A;  4GN1 A;  3SNH A;  1MIX A;  1DDM A;  2D9Y A;  1WJ1 A;  2L2I A;  2OQB A;  1EF1 A;  2D9Z A;  3WYF B;  2DTC A;  5C79 A;  4KHB B;  1TXD A;  4NY0 A;  2I5F A;  5JHH A;  1FB8 A;  2DX1 A;  3TW1 A;  4ZRI A;  2QKM A;  1NI2 A;  2COA A;  4L6E A;  4A5K A;  1U2B A;  5D3Y A;  4C0A A;  2DKP A;  3VOQ A;  3MDB C;  3F5R A;  2W2W A;  2G35 A;  1Z87 A;  3HW2 B;  5GOW B;  2Z0O A;  3QWM A;  2AL6 A;  1X11 A;  2EJ8 A;  5FI1 A;  4HAX B;  4IAP A;  2MKR A;  3SO6 A;  2UZS A;  3KY9 A;  1U27 A;  2YRY A;  4F7G A;  4HDO A;  5DH9 B;  1DBH A;  1GG3 A;  1KZ7 A;  3F0W A;  3P6A A;  3PEG A;  4DX9 0;  4PQ0 A;  1SHC A;  2H7E A;  3ODW A;  2UZR A;  3HQC A;  5DHF B;  1P3R A;  4DXA B;  1AWE A;  2YS1 A;  4MK0 A;  4WVF B;  4A6F A;  3DXD A;  4K2P A;  3ODX A;  2CY5 A;  4HB0 B;  4XWX A;  4GPT B;  2MFQ A;  5KCV A;  1WG7 A;  5CLL B;  4HB3 B;  1M7E A;  4DBB A;  2IFS A;  1ZM0 A;  5HE0 A;  2RUK B;  1U29 A;  2Z0P A;  4GXB A;  2RGN B;  1B55 A;  2LG1 A;  3P7Z A;  2NZ8 B;  2RNR B;  2GCJ A;  2D4Q A;  3ULB A;  1EGX A;  5JLJ B;  1UEF A;  2RLO A;  5CLQ B;  1WJM A;  2EMS A;  2J0M A;  3SYX A;  3ZDT A;  2W2X C;  3O96 A;  3GYP A;  1N3H A;  1LW3 A;  1V61 A;  1Q67 A;  3X23 A;  1MAI A;  3A8P A;  1P5T A;  2CAY A;  4IOY X;  1GC6 A;  1BTN A;  1J19 A;  1MIZ B;  3KRW A;  2MWN B;  1ZSQ A;  2LUL A;  1W1H A;  3D8D A;  2D9X A;  3PG7 A;  2N0Y A;  3ZVR A;  1WVH A;  2ROV A;  1FHX A;  2YT0 A;  5HE3 A;  4DX8 A;  2J59 M;  1LB1 A;  4A6H A;  1OQN A;  2I5C A;  4HAV B;  5HE2 A;  1K5G B;  3CXB B;  2H7D A;  1UNP A;  1XX0 A;  4HAZ B;  4YON A;  3T06 A;  4HAU B;  4EJN A;  5HE1 A;  1RRP B;  5LON B;  1QQG A;  1XR0 B;  1ZC4 B;  2YSZ A;  2D9W A;  2I1J A;  2Y8G A;  1OMW A;  4NSW A;  2W2X D;  3D8F A;  2Y8F A;  4HAY B;  3BJI A;  2GJY A;  1I7A A;  2GS0 A;  5C5B B;  3TCA A;  2Y7B A;  3AU4 A;  1X86 A;  1UPQ A;  1NTY A;  1FAO A;  1SGH A;  5D3V A;  1J0W A;  1V5M A;  2N23 A;  2COF A;  1X05 A;  2DHI A;  4A6F B;  3ODO A;  2ELA A;  2LYD A;  5J3Q A;  4K17 A;  4GZU A;  4Y94 A;  3DXC A;  2R09 A;  1MKE A;  2UVM A;  4HB4 B;  3PVL A;  1WI1 A;  3SV1 A;  5C6R A;  3AJ4 A;  3UZT A;  1PMS A;  4EKU A;  1FGZ A;  1ZC3 B;  4P7I A;  1DYN A;  1Y5O A;  2YT1 A;  1AQC A;  1ZVR A;  1UNR A;  3DXE A;  2EMT A;  4MT7 A;  1DDV A;  1BWN A;  4KAX B;  2XQN M;  5D3X A;  1QC6 A;  2KUP A;  4B6H A;  4KHA A;  4HHV A;  4Z2M B;  1TJ6 A;  4HAW B;  2Q13 A;  5DI9 B;  2DA0 A;  3PZD A;  2ELB A;  1OY2 A;  3A8Q A;  3OAN A;  4WSF A;  3N7C A;  1BAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...