1BANA

The contribution of buried hydrogen bonds to protein stability: the crystal structures of two barnase mutants
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYASDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 27
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1banA00
1Q9EA 3AGOA 1HYFA 1MGRA 1RCLA 1RLSA 1BU4A 4HOHA 1BRNL 1JBRA 3RNTA 2RBIA 1UCLA 1RMSA 1B20A 8RNTA 1BRJA 1RGGA 1DETA 1FZUA 3WHOA 1B2SA 2AAEA 1BSDA 4HAAA 1BSEA 1BIRA 1UCJA 1BANA 1RGKA 1RNBA 4GHOA 3A5EA 1FYSA 4J5KA 1UCIA 1T2IA 1RGLA 1B21A 1MGWA 1BOXA 1DE3A 1RGFA 1BSCA 1BSBA 1RGHA 3URPA 1TRPA 3DH2A 1BAOA 1YVSA 5GSPA 2BIRA 1RGEA 1GMPA 1JBTA 1BNRA 1GMRA 1GOVA 3GSPA 1RGAA 1RGCA 1I8VA 1HZ1A 3BIRA 1RCKA 3D5GA 7GSPA 1BNIA 2C4BA 1B2XA 1BNJA 1I3FA 1X1XA 1LNIA 1PY3A 1I0XA 6RNTA 3D4AA 1YNVX 1FUSA 1R4YA 4BU4A 1RN1A 2F5WA 1B2MA 1A2PA 1GOUA 5BIRA 2KF4A 3Q3FA 1B27A 1AY7A 3HOHA 1UCKA 3KCHA 1LOYA 1BRGA 3AHSA 2RNTA 7RNTA 3AGNA 1GOYA 4GSPA 2KF3A 1RHLA 1I2GA 1BNSA 3SYUA 1I3IA 9RNTA 1IYYA 1CH0A 4RNTA 1I70A 1B3SA 1I2FA 1C54A 1LOWA 1JBSA 1RDSA 1BNGA 2F56A 1RSNA 1LRAA 4J5GA 1PYLA 1BRSA 1ZGXA 1G02A 1LOVA 1SARA 2HOHA 1YGWA 2KAAA 1I0VA 1X1UA 2ZA4A 3BU4A 1B2UA 1BVIA 5BU4A 1BRIA 1GSPA 2KF5A 2F5MA 2GSPA 1B2ZA 3D5IA 3DGYA 6GSPA 1GMQA 3WR2A 1BNFA 1RN4A 5HOHA 1RNTA 5RNTA 4BIRA 2F4YA 1BSAA 1RTUA 2AADA 1I2EA 1FW7A 1T2HA 1BRKA 3AHWA 1FUTA 1BGSA 2KF6A 2SARA 1BUJA 1BNEA 1TTOA 1X1YA 1TRQA 2BU4A 1BRHA 1X1WA 1AQZA
chains in the Genus database with same CATH superfamily
2D42A 2P0MA 4RNYA 1N5PA 1NB5I 1LVNA 1W5ZA 1RCLA 3EBYA 1BU4A 3FLJA 1N8QA 1V58A 1FUWA 4K1UA 1JBRA 1MWSA 3SX1A 3WMDA 2CG0A 1E3RA 5IF6A 1VQ73 3DMCA 5G1KA 1UUGB 2RBIA 1YIT3 2JDIH 1J2BA 2P38A 3Q2PA 4OK0A 1G0TA 3DZLA 1FGTA 4WYKA 1R4CA 1QAFA 5JPUA 5ELUA 1EG9B 1GD3A 2LYXA 1U8CB 1BRJA 1UDII 3VSYA 2E2TA 4FMAA 4KVHA 1EQKA 3IPTA 2W56B 2BNGA 1BSDA 5IEPA 1UW1A 3EHCA 1BIRA 2QEX3 4XDWA 4STDA 4GHOA 1YJ93 1FGQA 4LEHA 1FYSA 2KCDA 1IU7A 2XGNA 1TFOA 1TIJA 3NX0A 1IVWA 1AVKA 3HIIA 3G0KA 4O3VA 2F98A 1RGFA 4L7KA 3CC23 3IJEB 1RGHA 2ML6A 5GSPA 1N9EA 1BAOA 3DH2A 1GD4A 2XF3A 3GRDA 3F8XA 4FCJA 2BIRA 3B8LA 4GB5A 1JV2B 3SOYA 4HM8B 1VQ93 1RJOA 1OF5B 1UUVB 4AEQA 6STDA 3OW22 1HZ1A 5CXOA 4O02B 2YFJB 4N6TA 2W04A 5KP4A 3MHEA 1W4NA 1BNJA 2FGTA 1YIJ3 3F8HA 3JUQA 3FKAA 4OUQA 4RNZA 3D4AA 1K28A 3CCU3 4H3UA 1FUSA 1B2MA 2SBLA 4N3VA 1A2PA 3U1WA 2OOVC 2KF4A 3S29A 2CFLA 1UGHI 3CCS3 1DMQA 3PGBA 4XBTA 1OPYA 2RNTA 1CEWI 5AIIA 4J8TA 1IVUA 4DKIA 2WO0A 1JRQA 3LXUX 3EJVA 1I3IA 4FMDA 2IUJA 1AR0A 3SYUA 1I70A 1KSIA 3JUOA 1CQSA 4U13A 1VQK3 1ISKA 1M904 3WODG 1E97A 1VQL3 2H0HA 2CC3A 3PXMA 1DVDA 1SQWA 1GS3A 4EYCA 4ZM8A 3CME3 1YGEA 4K90B 3ZG5A 3G6E3 3OX9A 1ZGXA 1SARA 3ZG0A 1IQYA 3G713 2CX1A 4O8SA 2YFLB 1BVIA 4HM4B 1BRIA 1GSPA 1MWTA 2KF5A 3GZRA 4HYZA 1WTHA 1B2ZA 1OACA 3V98A 5JPPA 2IA7A 3WOEB 4RZMA 3O8YA 3N8BA 1M9GA 2MF7A 3FSDA 3NV0B 4BIRA 5IW9A 4G1MB 4MMZB 3AMOB 2GBXB 3EC9A 2WOFA 3MSOA 1ZX2A 3S5CA 3JVCA 3NHXA 3AHWA 3CXC2 1A90A 3RDEA 5IG3A 1ULJB 1U5OA 3K5TA 3NUVA 1BNEA 1UI7A 1X1YA 3CCJ3 1TRQA 3GZXB 2BMQB 4HZBB 4FMCA 1BRHA 3MWZA 3UL5A 4I5QA 4KT3B 3G8ZA 3X3YA 3KZTA 1D6UA 2CFKA 3K0ZA 1LNHA 4CCVA 1O7MB 3MPHA 2CK3H 4HM2B 3RNTA 4EC6A 4CPKA 1VQN3 1FGOA 1SIHA 1Q40B 3KFQC 3T0UA 1IQ8A 4XBXA 3LZAA 2OTL3 5DREA 1JKGA 1DETA 3DGNA 2CWTA 1N5HA 5AYSC 2GBWB 3EE1A 2CWUA 4HAAA 1ROVA 4FMBA 1BSEA 1VQQA 4HM5B 5CF2A 3HI7A 4KZ1A 1UCJA 1E3VA 1W6CA 2W56A 3B7CA 5M1AA 1N9JA 1UI8A 4QWTA 1BUQA 4NREA 1CYVA 4XDVA 1BOXA 3GAXA 1TRPA 1Z1SA 1YVSA 3X41A 3DUKA 2PZVA 5FGOA 3EB8A 1HU9A 3K63A 3FGYA 1GMPA 1JBTA 3DGOA 3KIIA 1GMRA 3I553 1S723 1I8VA 1YJN3 2D1WA 4WWUC 1FA3A 3D5GA 2WGQA 1YJW3 2C4BA 2QGUA 2RSXA 4N6LA 2HMLB 3CD63 1KQS2 1PY3A 1MWRA 6RNTA 1Q7HA 3L0RA 4MJDA 1RN1A 3FZWA 1GOUA 2OCTA 3H3HA 4HKVB 4HM0B 1B27A 1C7HA 3NXJA 1LOYA 2K3DA 2O3OA 2QIYA 2Y73A 1CYUA 2WGOA 3MKIA 5IENA 3FG3A 2B1XB 1NB3I 1EA2A 2KRTA 2KF3A 1W01A 5G2GA 1TUHA 2E2VA 2XEPA 2CKFB 3LTBA 1CH0A 3MG2A 3SVAA 3IMAB 4HM1B 2RCDA 3LH4A 4KFFA 5AEWB 5G1LA 3HZPA 3OV4A 1BNGA 1RSNA 1LRAA 1PFPA 1IK3A 5AIFA 1T5YA 1LOVA 3FH1A 2XRXB 2HMJB 3CCQ3 3FG4A 1YGWA 2KAAA 1HKXA 3OXAA 3X40A 1I0VA 1X1UA 3EX9A 2ZA4A 4EW5A 2WOHA 4H61A 4N6NB 2GEXA 5BU4A 1QJGA 4WYKB 2ZDJA 1JNQA 1O7WB 2F5MA 2ML5A 3FG1A 3NM2A 3DM8A 2F86B 4HVNA 4LGQA 6GSPA 5M18A 3CC43 1N8R4 2OTJ3 4BL3A 3BNBA 4R80A 4TX4A 2XFTA 5RNTA 4AKZA 2F4YA 3BNCA 3CPOA 2W9PA 5IG4A 1YI23 2AADA 3QK9A 4KFDA 4XB5A 4EXRA 2JQ5A 2STDA 2A15A 4EV5A 1YHQ3 2QA43 1O7GB 2SARA 2W9QA 4XBYA 1OHPA 2HMOB 1Q7Y4 3V99A 3LTAA 5EEOA 2ZL8A 2OQEA 2FXTA 4CDLA 4BTXA 1O7NB 5CLKA 1L5GB 1X1WA 2XR8B 3K9MC 5EQLA 1Q9EA 1TJDA 3AGOA 3CU3A 3EBTA 1FGMA 1HYFA 1MGRA 1US1A 2XFSA 1LQMB 1QALA 3KE7A 1W02A 1NDOB 3LT9A 3M8CA 4XM4A 3RGAA 3T8UA 1BRNL 1SIIA 1EUIC 1JN5A 1KWIA 1NWWA 3JUPA 2K0MA 1IVVA 2J8XB 1RRLA 1B20A 5IEOA 3H51A 4KFEA 1Q42A 3F7SA 3S27A 3K7CA 1RGGA 4PEJA 2CG1A 5AIGA 2C10A 2Z7AA 2K54A 1OUNA 4N6V0 2CFDA 3PCRA 3V92A 3WOFB 1B2SA 1MOLA 2AAEA 2CFWA 2W03A 2HMNB 4AKYA 1A2VA 3NBRA 3LT8A 1GY6A 1V74A 2IUKA 3KSPA 1RGKA 3Q1CA 1RNBA 4N6UA 2CW9A 3FF2A 1OGZA 4K1VA 1QAKA 4WFOA 2YFIB 4J5KA 2W6JH 1RGLA 3UB1A 1EKMA 1MGWA 2P09A 5M19A 1WMPA 2CX0A 5AIHA 2CFGA 1BSBA 2HMKB 3WA2X 1K9M4 1LOXA 2IY2A 4LMIA 5IERA 1RGEA 3S28A 4EV2A 3E99A 1JJ22 1Y4KA 4NPBA 4R9LA 1GOVA 4NHFA 1K41A 1RGAA 1RGCA 5IG0A 1W2B2 1VQ43 2V1LA 2R41A 4N6MA 1GY7A 2I9WA 3LTCA 3QRDA 3CCE3 1BNIA 1UUWB 1T3BA 1B2XA 1X1XA 3LTDA 1Q864 4JF8A 1I0XA 3EN8A 1JZDA 2OWPA 4Q53A 1IT7A 2CH9A 1WMNA 2F5WA 3BNEA 5D81A 2OOVA 2ZHXB 1D6YA 1UCKA 3HOHA 3CC73 3UL6A 3AHSA 4ORLA 7RNTA 3CCR3 1JB5A 1AVLA 5ELJA 1GOYA 2LQVA 3OWUA 5DRVA 2P0XA 2L1SA 4K61A 2B24B 5EVHA 1ULIB 1GY5A 1JZOA 1A2KA 1VQO3 3EN1B 2UGIA 3HX8A 1I2FA 3DY5A 5AI1A 1KD14 3MG1A 1JBSA 3I563 3F40A 3ROBA 2F99A 2CWVA 2F56A 5D83A 1O7PB 4HZ9B 1IDPA 2L4VA 1PYLA 4CJNA 1OF5A 1LXEA 3ER7A 3F7XA 1VQP3 3VF1A 2W2CA 5KP3A 3BU4A 5AEUB 2KXGA 3X3XA 1B2UA 3DGLA 3CNXA 3OWYA 2XSOB 3FCSB 3EQQB 3NBJA 2GSPA 4L8PA 3RGRA 3CCV3 2MC8A 3J7Yd 4MMXB 3U97A 2CIUA 1BNFA 1DVCA 2M7OA 1JKGB 3Q90A 3PCSA 8CHOA 3NQYA 2BHMA 3PS8A 4WP5A 1TP6A 1RTUA 5HGRA 3EF8A 4R9KA 3F9SA 1T2HA 2GXFA 4IPBA 1Q814 1JB2A 3CPW2 3HIGA 2KF6A 4IIAA 4X2OA 7STDA 1VQM3 4X2HA 4BTYA 1MNLA 1O7HB 1TTOA 3LMLA 2RFRA 1OCVA 1NNVA 3SOAA 3I0YA 5FW5A 3T8NA 3PYJA 1IT8A 1STFI 1QVG2 1WQLB 1AQZA 2E2UA 3PZWA 4MMYB 5LC7A 3X3ZA 1VQ53 3G4S3 1WMOA 3JUMA 2INXA 3A76A 2RGQA 4HOHA 1VQ83 2BO9B 4LYLB 1K8A4 1F8NA 2Z77A 4HBRA 1NO3A 3GZBA 5CK6A 3STDA 2Y74A 3OWSA 1UCLA 1RMSA 3CMA3 8RNTA 2R4IA 1ZS7A 3N54B 3HK4A 1ASKA 1A67A 3SLUA 4L8OA 3G16A 4WHAA 3X42A 1FZUA 3NV0A 3BB9A 3WHOA 2IMJA 1G96A 1SJWA 3B4OA 1STDA 3AMOA 1W6YA 1EEJA 1BANA 3GWRA 1IQXA 3D79A 3DXOA 3A5EA 3SXXA 4EBGA 1AV4A 3KN4A 1PU4A 2IYJA 1UCIA 4OVMA 1T2IA 1NJI4 4I4KA 1IV9A 1M1XB 2BMOB 1B21A 2BT3A 5LC6A 1DE3A 3KKGA 3CCL3 1TU5A 1W6GA 2Q07A 1BSCA 3WDGB 2GU3A 3VGNA 3URPA 1QMAA 1DMNA 3MG3A 3DGMA 3MYTA 2PNCA 1W7CA 1M1K4 1OHSA 3B4PA 1BNRA 3GSPA 3BLZA 3BIRA 1V57A 1OH0A 1RCKA 1DMMA 1KC84 3FF0A 5JBSA 1QVF2 1YVBI 7GSPA 2H0IA 5AYRB 1Q40A 1I3FA 5I97A 1LNIA 3TDGA 1YNVX 1VZZA 1R4YA 1S5AA 2XGLA 2YX9A 1OGXA 3F14A 4BU4A 5BIRA 3Q3FA 2H0GA 1AY7A 3SEDA 3S67A 1GYBA 5BXQA 3KCHA 1BRGA 4RBNA 3NM7A 3D3LA 4LZIA 3GZYB 5IG5A 5CF1A 3AGNA 1RN7A 3ALAA 3BNDA 4GL6A 1Q824 4GSPA 1RHLA 1I2GA 1BNSA 2O9UX 9RNTA 5D82A 1IYYA 1NU3A 4ILFA 4RNTA 2Z76A 1B3SA 1C54A 1LOWA 3NBBA 3KSED 1RDSA 4IT7A 1ZO2A 4MEIA 1OHOA 1D6ZA 1UGIA 2HMMB 5STDA 4BTWA 2C11A 1SPUA 4J5GA 1BRSA 4HM3B 1G02A 2XH9A 1JN5B 1IVXA 3JUNA 2HOHA 4FCZA 4O2HA 1RKYA 1K734 4FR9A 3CCM3 3NQZA 4BL2A 1VQ63 1FGRA 3LOYA 4HM6B 1TFKA 2CHCA 1W2ZA 2UX0A 3D5IA 3DGYA 5BVBA 1GMQA 2W0QA 4HM7B 3WR2A 1RN4A 3UNLA 2BMRB 1RNTA 5HOHA 5KP1A 1MWUA 1LQGC 3LYGA 2FNQA 3CNMA 1RRHA 3N9HA 1BSAA 4HJLB 1DYUA 1IV7A 1I2EA 2GU1A 2P05A 4R4KA 3UJMA 1FW7A 1BRKA 4N6OB 3D9RA 3ECFA 1FUTA 1BGSA 2GEYA 2UUGC 2Z6BA 5TGNA 4FCMA 1BUJA 4R1KA 5A0OB 4LSOA 3ZFZA 2XSHB 4J9AA 1W00A 2BU4A 3WA3A 1WNHA 2OQEC 4JRFA 1RLSA 1JB4A 1ROAA
chains in the Genus database with same CATH topology
1Q9EA 3AGOA 1HYFA 1MGRA 1RCLA 1RLSA 1BU4A 4HOHA 1BRNL 1JBRA 3RNTA 2RBIA 1UCLA 1RMSA 1B20A 8RNTA 1BRJA 1RGGA 1DETA 1FZUA 3WHOA 1B2SA 2AAEA 1BSDA 4HAAA 1BSEA 1BIRA 1UCJA 1BANA 1RGKA 1RNBA 4GHOA 3A5EA 1FYSA 4J5KA 1UCIA 1T2IA 1RGLA 1B21A 1MGWA 1BOXA 1DE3A 1RGFA 1BSCA 1BSBA 1RGHA 3URPA 1TRPA 3DH2A 1BAOA 1YVSA 5GSPA 2BIRA 1RGEA 1GMPA 1JBTA 1BNRA 1GMRA 1GOVA 3GSPA 1RGAA 1RGCA 1I8VA 1HZ1A 3BIRA 1RCKA 3D5GA 7GSPA 1BNIA 2C4BA 1B2XA 1BNJA 1I3FA 1X1XA 1LNIA 1PY3A 1I0XA 6RNTA 3D4AA 1YNVX 1FUSA 1R4YA 4BU4A 1RN1A 2F5WA 1B2MA 1A2PA 1GOUA 5BIRA 2KF4A 3Q3FA 1B27A 1AY7A 3HOHA 1UCKA 3KCHA 1LOYA 1BRGA 3AHSA 2RNTA 7RNTA 3AGNA 1GOYA 4GSPA 2KF3A 1RHLA 1I2GA 1BNSA 3SYUA 1I3IA 9RNTA 1IYYA 1CH0A 4RNTA 1I70A 1B3SA 1I2FA 1C54A 1LOWA 1JBSA 1RDSA 1BNGA 2F56A 1RSNA 1LRAA 4J5GA 1PYLA 1BRSA 1ZGXA 1G02A 1LOVA 1SARA 2HOHA 1YGWA 2KAAA 1I0VA 1X1UA 2ZA4A 3BU4A 1B2UA 1BVIA 5BU4A 1BRIA 1GSPA 2KF5A 2F5MA 2GSPA 1B2ZA 3D5IA 3DGYA 6GSPA 1GMQA 3WR2A 1BNFA 1RN4A 5HOHA 1RNTA 5RNTA 4BIRA 2F4YA 1BSAA 1RTUA 2AADA 1I2EA 1FW7A 1T2HA 1BRKA 3AHWA 1FUTA 1BGSA 2KF6A 2SARA 1BUJA 1BNEA 1TTOA 1X1YA 1TRQA 2BU4A 1BRHA 1X1WA 1AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9E A;  3AGO A;  1HYF A;  1MGR A;  1RCL A;  1RLS A;  1BU4 A;  4HOH A;  1BRN L;  1JBR A;  3RNT A;  2RBI A;  1UCL A;  1RMS A;  1B20 A;  8RNT A;  1BRJ A;  1RGG A;  1DET A;  1FZU A;  3WHO A;  1B2S A;  2AAE A;  1BSD A;  4HAA A;  1BSE A;  1BIR A;  1UCJ A;  1BAN A;  1RGK A;  1RNB A;  4GHO A;  3A5E A;  1FYS A;  4J5K A;  1UCI A;  1T2I A;  1RGL A;  1B21 A;  1MGW A;  1BOX A;  1DE3 A;  1RGF A;  1BSC A;  1BSB A;  1RGH A;  3URP A;  1TRP A;  3DH2 A;  1BAO A;  1YVS A;  5GSP A;  2BIR A;  1RGE A;  1GMP A;  1JBT A;  1BNR A;  1GMR A;  1GOV A;  3GSP A;  1RGA A;  1RGC A;  1I8V A;  1HZ1 A;  3BIR A;  1RCK A;  3D5G A;  7GSP A;  1BNI A;  2C4B A;  1B2X A;  1BNJ A;  1I3F A;  1X1X A;  1LNI A;  1PY3 A;  1I0X A;  6RNT A;  3D4A A;  1YNV X;  1FUS A;  1R4Y A;  4BU4 A;  1RN1 A;  2F5W A;  1B2M A;  1A2P A;  1GOU A;  5BIR A;  2KF4 A;  3Q3F A;  1B27 A;  1AY7 A;  3HOH A;  1UCK A;  3KCH A;  1LOY A;  1BRG A;  3AHS A;  2RNT A;  7RNT A;  3AGN A;  1GOY A;  4GSP A;  2KF3 A;  1RHL A;  1I2G A;  1BNS A;  3SYU A;  1I3I A;  9RNT A;  1IYY A;  1CH0 A;  4RNT A;  1I70 A;  1B3S A;  1I2F A;  1C54 A;  1LOW A;  1JBS A;  1RDS A;  1BNG A;  2F56 A;  1RSN A;  1LRA A;  4J5G A;  1PYL A;  1BRS A;  1ZGX A;  1G02 A;  1LOV A;  1SAR A;  2HOH A;  1YGW A;  2KAA A;  1I0V A;  1X1U A;  2ZA4 A;  3BU4 A;  1B2U A;  1BVI A;  5BU4 A;  1BRI A;  1GSP A;  2KF5 A;  2F5M A;  2GSP A;  1B2Z A;  3D5I A;  3DGY A;  6GSP A;  1GMQ A;  3WR2 A;  1BNF A;  1RN4 A;  5HOH A;  1RNT A;  5RNT A;  4BIR A;  2F4Y A;  1BSA A;  1RTU A;  2AAD A;  1I2E A;  1FW7 A;  1T2H A;  1BRK A;  3AHW A;  1FUT A;  1BGS A;  2KF6 A;  2SAR A;  1BUJ A;  1BNE A;  1TTO A;  1X1Y A;  1TRQ A;  2BU4 A;  1BRH A;  1X1W A;  1AQZ A; 
#chains in the Genus database with same CATH topology
 2D42 A;  2P0M A;  4RNY A;  1N5P A;  1NB5 I;  1LVN A;  1W5Z A;  1RCL A;  3EBY A;  1BU4 A;  3FLJ A;  1N8Q A;  1V58 A;  1FUW A;  4K1U A;  1JBR A;  1MWS A;  3SX1 A;  3WMD A;  2CG0 A;  1E3R A;  5IF6 A;  1VQ7 3;  3DMC A;  5G1K A;  1UUG B;  2RBI A;  1YIT 3;  2JDI H;  1J2B A;  2P38 A;  3Q2P A;  4OK0 A;  1G0T A;  3DZL A;  1FGT A;  4WYK A;  1R4C A;  1QAF A;  5JPU A;  5ELU A;  1EG9 B;  1GD3 A;  2LYX A;  1U8C B;  1BRJ A;  1UDI I;  3VSY A;  2E2T A;  4FMA A;  4KVH A;  1EQK A;  3IPT A;  2W56 B;  2BNG A;  1BSD A;  5IEP A;  1UW1 A;  3EHC A;  1BIR A;  2QEX 3;  4XDW A;  4STD A;  4GHO A;  1YJ9 3;  1FGQ A;  4LEH A;  1FYS A;  2KCD A;  1IU7 A;  2XGN A;  1TFO A;  1TIJ A;  3NX0 A;  1IVW A;  1AVK A;  3HII A;  3G0K A;  4O3V A;  2F98 A;  1RGF A;  4L7K A;  3CC2 3;  3IJE B;  1RGH A;  2ML6 A;  5GSP A;  1N9E A;  1BAO A;  3DH2 A;  1GD4 A;  2XF3 A;  3GRD A;  3F8X A;  4FCJ A;  2BIR A;  3B8L A;  4GB5 A;  1JV2 B;  3SOY A;  4HM8 B;  1VQ9 3;  1RJO A;  1OF5 B;  1UUV B;  4AEQ A;  6STD A;  3OW2 2;  1HZ1 A;  5CXO A;  4O02 B;  2YFJ B;  4N6T A;  2W04 A;  5KP4 A;  3MHE A;  1W4N A;  1BNJ A;  2FGT A;  1YIJ 3;  3F8H A;  3JUQ A;  3FKA A;  4OUQ A;  4RNZ A;  3D4A A;  1K28 A;  3CCU 3;  4H3U A;  1FUS A;  1B2M A;  2SBL A;  4N3V A;  1A2P A;  3U1W A;  2OOV C;  2KF4 A;  3S29 A;  2CFL A;  1UGH I;  3CCS 3;  1DMQ A;  3PGB A;  4XBT A;  1OPY A;  2RNT A;  1CEW I;  5AII A;  4J8T A;  1IVU A;  4DKI A;  2WO0 A;  1JRQ A;  3LXU X;  3EJV A;  1I3I A;  4FMD A;  2IUJ A;  1AR0 A;  3SYU A;  1I70 A;  1KSI A;  3JUO A;  1CQS A;  4U13 A;  1VQK 3;  1ISK A;  1M90 4;  3WOD G;  1E97 A;  1VQL 3;  2H0H A;  2CC3 A;  3PXM A;  1DVD A;  1SQW A;  1GS3 A;  4EYC A;  4ZM8 A;  3CME 3;  1YGE A;  4K90 B;  3ZG5 A;  3G6E 3;  3OX9 A;  1ZGX A;  1SAR A;  3ZG0 A;  1IQY A;  3G71 3;  2CX1 A;  4O8S A;  2YFL B;  1BVI A;  4HM4 B;  1BRI A;  1GSP A;  1MWT A;  2KF5 A;  3GZR A;  4HYZ A;  1WTH A;  1B2Z A;  1OAC A;  3V98 A;  5JPP A;  2IA7 A;  3WOE B;  4RZM A;  3O8Y A;  3N8B A;  1M9G A;  2MF7 A;  3FSD A;  3NV0 B;  4BIR A;  5IW9 A;  4G1M B;  4MMZ B;  3AMO B;  2GBX B;  3EC9 A;  2WOF A;  3MSO A;  1ZX2 A;  3S5C A;  3JVC A;  3NHX A;  3AHW A;  3CXC 2;  1A90 A;  3RDE A;  5IG3 A;  1ULJ B;  1U5O A;  3K5T A;  3NUV A;  1BNE A;  1UI7 A;  1X1Y A;  3CCJ 3;  1TRQ A;  3GZX B;  2BMQ B;  4HZB B;  4FMC A;  1BRH A;  3MWZ A;  3UL5 A;  4I5Q A;  4KT3 B;  3G8Z A;  3X3Y A;  3KZT A;  1D6U A;  2CFK A;  3K0Z A;  1LNH A;  4CCV A;  1O7M B;  3MPH A;  2CK3 H;  4HM2 B;  3RNT A;  4EC6 A;  4CPK A;  1VQN 3;  1FGO A;  1SIH A;  1Q40 B;  3KFQ C;  3T0U A;  1IQ8 A;  4XBX A;  3LZA A;  2OTL 3;  5DRE A;  1JKG A;  1DET A;  3DGN A;  2CWT A;  1N5H A;  5AYS C;  2GBW B;  3EE1 A;  2CWU A;  4HAA A;  1ROV A;  4FMB A;  1BSE A;  1VQQ A;  4HM5 B;  5CF2 A;  3HI7 A;  4KZ1 A;  1UCJ A;  1E3V A;  1W6C A;  2W56 A;  3B7C A;  5M1A A;  1N9J A;  1UI8 A;  4QWT A;  1BUQ A;  4NRE A;  1CYV A;  4XDV A;  1BOX A;  3GAX A;  1TRP A;  1Z1S A;  1YVS A;  3X41 A;  3DUK A;  2PZV A;  5FGO A;  3EB8 A;  1HU9 A;  3K63 A;  3FGY A;  1GMP A;  1JBT A;  3DGO A;  3KII A;  1GMR A;  3I55 3;  1S72 3;  1I8V A;  1YJN 3;  2D1W A;  4WWU C;  1FA3 A;  3D5G A;  2WGQ A;  1YJW 3;  2C4B A;  2QGU A;  2RSX A;  4N6L A;  2HML B;  3CD6 3;  1KQS 2;  1PY3 A;  1MWR A;  6RNT A;  1Q7H A;  3L0R A;  4MJD A;  1RN1 A;  3FZW A;  1GOU A;  2OCT A;  3H3H A;  4HKV B;  4HM0 B;  1B27 A;  1C7H A;  3NXJ A;  1LOY A;  2K3D A;  2O3O A;  2QIY A;  2Y73 A;  1CYU A;  2WGO A;  3MKI A;  5IEN A;  3FG3 A;  2B1X B;  1NB3 I;  1EA2 A;  2KRT A;  2KF3 A;  1W01 A;  5G2G A;  1TUH A;  2E2V A;  2XEP A;  2CKF B;  3LTB A;  1CH0 A;  3MG2 A;  3SVA A;  3IMA B;  4HM1 B;  2RCD A;  3LH4 A;  4KFF A;  5AEW B;  5G1L A;  3HZP A;  3OV4 A;  1BNG A;  1RSN A;  1LRA A;  1PFP A;  1IK3 A;  5AIF A;  1T5Y A;  1LOV A;  3FH1 A;  2XRX B;  2HMJ B;  3CCQ 3;  3FG4 A;  1YGW A;  2KAA A;  1HKX A;  3OXA A;  3X40 A;  1I0V A;  1X1U A;  3EX9 A;  2ZA4 A;  4EW5 A;  2WOH A;  4H61 A;  4N6N B;  2GEX A;  5BU4 A;  1QJG A;  4WYK B;  2ZDJ A;  1JNQ A;  1O7W B;  2F5M A;  2ML5 A;  3FG1 A;  3NM2 A;  3DM8 A;  2F86 B;  4HVN A;  4LGQ A;  6GSP A;  5M18 A;  3CC4 3;  1N8R 4;  2OTJ 3;  4BL3 A;  3BNB A;  4R80 A;  4TX4 A;  2XFT A;  5RNT A;  4AKZ A;  2F4Y A;  3BNC A;  3CPO A;  2W9P A;  5IG4 A;  1YI2 3;  2AAD A;  3QK9 A;  4KFD A;  4XB5 A;  4EXR A;  2JQ5 A;  2STD A;  2A15 A;  4EV5 A;  1YHQ 3;  2QA4 3;  1O7G B;  2SAR A;  2W9Q A;  4XBY A;  1OHP A;  2HMO B;  1Q7Y 4;  3V99 A;  3LTA A;  5EEO A;  2ZL8 A;  2OQE A;  2FXT A;  4CDL A;  4BTX A;  1O7N B;  5CLK A;  1L5G B;  1X1W A;  2XR8 B;  3K9M C;  5EQL A;  1Q9E A;  1TJD A;  3AGO A;  3CU3 A;  3EBT A;  1FGM A;  1HYF A;  1MGR A;  1US1 A;  2XFS A;  1LQM B;  1QAL A;  3KE7 A;  1W02 A;  1NDO B;  3LT9 A;  3M8C A;  4XM4 A;  3RGA A;  3T8U A;  1BRN L;  1SII A;  1EUI C;  1JN5 A;  1KWI A;  1NWW A;  3JUP A;  2K0M A;  1IVV A;  2J8X B;  1RRL A;  1B20 A;  5IEO A;  3H51 A;  4KFE A;  1Q42 A;  3F7S A;  3S27 A;  3K7C A;  1RGG A;  4PEJ A;  2CG1 A;  5AIG A;  2C10 A;  2Z7A A;  2K54 A;  1OUN A;  4N6V 0;  2CFD A;  3PCR A;  3V92 A;  3WOF B;  1B2S A;  1MOL A;  2AAE A;  2CFW A;  2W03 A;  2HMN B;  4AKY A;  1A2V A;  3NBR A;  3LT8 A;  1GY6 A;  1V74 A;  2IUK A;  3KSP A;  1RGK A;  3Q1C A;  1RNB A;  4N6U A;  2CW9 A;  3FF2 A;  1OGZ A;  4K1V A;  1QAK A;  4WFO A;  2YFI B;  4J5K A;  2W6J H;  1RGL A;  3UB1 A;  1EKM A;  1MGW A;  2P09 A;  5M19 A;  1WMP A;  2CX0 A;  5AIH A;  2CFG A;  1BSB A;  2HMK B;  3WA2 X;  1K9M 4;  1LOX A;  2IY2 A;  4LMI A;  5IER A;  1RGE A;  3S28 A;  4EV2 A;  3E99 A;  1JJ2 2;  1Y4K A;  4NPB A;  4R9L A;  1GOV A;  4NHF A;  1K41 A;  1RGA A;  1RGC A;  5IG0 A;  1W2B 2;  1VQ4 3;  2V1L A;  2R41 A;  4N6M A;  1GY7 A;  2I9W A;  3LTC A;  3QRD A;  3CCE 3;  1BNI A;  1UUW B;  1T3B A;  1B2X A;  1X1X A;  3LTD A;  1Q86 4;  4JF8 A;  1I0X A;  3EN8 A;  1JZD A;  2OWP A;  4Q53 A;  1IT7 A;  2CH9 A;  1WMN A;  2F5W A;  3BNE A;  5D81 A;  2OOV A;  2ZHX B;  1D6Y A;  1UCK A;  3HOH A;  3CC7 3;  3UL6 A;  3AHS A;  4ORL A;  7RNT A;  3CCR 3;  1JB5 A;  1AVL A;  5ELJ A;  1GOY A;  2LQV A;  3OWU A;  5DRV A;  2P0X A;  2L1S A;  4K61 A;  2B24 B;  5EVH A;  1ULI B;  1GY5 A;  1JZO A;  1A2K A;  1VQO 3;  3EN1 B;  2UGI A;  3HX8 A;  1I2F A;  3DY5 A;  5AI1 A;  1KD1 4;  3MG1 A;  1JBS A;  3I56 3;  3F40 A;  3ROB A;  2F99 A;  2CWV A;  2F56 A;  5D83 A;  1O7P B;  4HZ9 B;  1IDP A;  2L4V A;  1PYL A;  4CJN A;  1OF5 A;  1LXE A;  3ER7 A;  3F7X A;  1VQP 3;  3VF1 A;  2W2C A;  5KP3 A;  3BU4 A;  5AEU B;  2KXG A;  3X3X A;  1B2U A;  3DGL A;  3CNX A;  3OWY A;  2XSO B;  3FCS B;  3EQQ B;  3NBJ A;  2GSP A;  4L8P A;  3RGR A;  3CCV 3;  2MC8 A;  3J7Y d;  4MMX B;  3U97 A;  2CIU A;  1BNF A;  1DVC A;  2M7O A;  1JKG B;  3Q90 A;  3PCS A;  8CHO A;  3NQY A;  2BHM A;  3PS8 A;  4WP5 A;  1TP6 A;  1RTU A;  5HGR A;  3EF8 A;  4R9K A;  3F9S A;  1T2H A;  2GXF A;  4IPB A;  1Q81 4;  1JB2 A;  3CPW 2;  3HIG A;  2KF6 A;  4IIA A;  4X2O A;  7STD A;  1VQM 3;  4X2H A;  4BTY A;  1MNL A;  1O7H B;  1TTO A;  3LML A;  2RFR A;  1OCV A;  1NNV A;  3SOA A;  3I0Y A;  5FW5 A;  3T8N A;  3PYJ A;  1IT8 A;  1STF I;  1QVG 2;  1WQL B;  1AQZ A;  2E2U A;  3PZW A;  4MMY B;  5LC7 A;  3X3Z A;  1VQ5 3;  3G4S 3;  1WMO A;  3JUM A;  2INX A;  3A76 A;  2RGQ A;  4HOH A;  1VQ8 3;  2BO9 B;  4LYL B;  1K8A 4;  1F8N A;  2Z77 A;  4HBR A;  1NO3 A;  3GZB A;  5CK6 A;  3STD A;  2Y74 A;  3OWS A;  1UCL A;  1RMS A;  3CMA 3;  8RNT A;  2R4I A;  1ZS7 A;  3N54 B;  3HK4 A;  1ASK A;  1A67 A;  3SLU A;  4L8O A;  3G16 A;  4WHA A;  3X42 A;  1FZU A;  3NV0 A;  3BB9 A;  3WHO A;  2IMJ A;  1G96 A;  1SJW A;  3B4O A;  1STD A;  3AMO A;  1W6Y A;  1EEJ A;  1BAN A;  3GWR A;  1IQX A;  3D79 A;  3DXO A;  3A5E A;  3SXX A;  4EBG A;  1AV4 A;  3KN4 A;  1PU4 A;  2IYJ A;  1UCI A;  4OVM A;  1T2I A;  1NJI 4;  4I4K A;  1IV9 A;  1M1X B;  2BMO B;  1B21 A;  2BT3 A;  5LC6 A;  1DE3 A;  3KKG A;  3CCL 3;  1TU5 A;  1W6G A;  2Q07 A;  1BSC A;  3WDG B;  2GU3 A;  3VGN A;  3URP A;  1QMA A;  1DMN A;  3MG3 A;  3DGM A;  3MYT A;  2PNC A;  1W7C A;  1M1K 4;  1OHS A;  3B4P A;  1BNR A;  3GSP A;  3BLZ A;  3BIR A;  1V57 A;  1OH0 A;  1RCK A;  1DMM A;  1KC8 4;  3FF0 A;  5JBS A;  1QVF 2;  1YVB I;  7GSP A;  2H0I A;  5AYR B;  1Q40 A;  1I3F A;  5I97 A;  1LNI A;  3TDG A;  1YNV X;  1VZZ A;  1R4Y A;  1S5A A;  2XGL A;  2YX9 A;  1OGX A;  3F14 A;  4BU4 A;  5BIR A;  3Q3F A;  2H0G A;  1AY7 A;  3SED A;  3S67 A;  1GYB A;  5BXQ A;  3KCH A;  1BRG A;  4RBN A;  3NM7 A;  3D3L A;  4LZI A;  3GZY B;  5IG5 A;  5CF1 A;  3AGN A;  1RN7 A;  3ALA A;  3BND A;  4GL6 A;  1Q82 4;  4GSP A;  1RHL A;  1I2G A;  1BNS A;  2O9U X;  9RNT A;  5D82 A;  1IYY A;  1NU3 A;  4ILF A;  4RNT A;  2Z76 A;  1B3S A;  1C54 A;  1LOW A;  3NBB A;  3KSE D;  1RDS A;  4IT7 A;  1ZO2 A;  4MEI A;  1OHO A;  1D6Z A;  1UGI A;  2HMM B;  5STD A;  4BTW A;  2C11 A;  1SPU A;  4J5G A;  1BRS A;  4HM3 B;  1G02 A;  2XH9 A;  1JN5 B;  1IVX A;  3JUN A;  2HOH A;  4FCZ A;  4O2H A;  1RKY A;  1K73 4;  4FR9 A;  3CCM 3;  3NQZ A;  4BL2 A;  1VQ6 3;  1FGR A;  3LOY A;  4HM6 B;  1TFK A;  2CHC A;  1W2Z A;  2UX0 A;  3D5I A;  3DGY A;  5BVB A;  1GMQ A;  2W0Q A;  4HM7 B;  3WR2 A;  1RN4 A;  3UNL A;  2BMR B;  1RNT A;  5HOH A;  5KP1 A;  1MWU A;  1LQG C;  3LYG A;  2FNQ A;  3CNM A;  1RRH A;  3N9H A;  1BSA A;  4HJL B;  1DYU A;  1IV7 A;  1I2E A;  2GU1 A;  2P05 A;  4R4K A;  3UJM A;  1FW7 A;  1BRK A;  4N6O B;  3D9R A;  3ECF A;  1FUT A;  1BGS A;  2GEY A;  2UUG C;  2Z6B A;  5TGN A;  4FCM A;  1BUJ A;  4R1K A;  5A0O B;  4LSO A;  3ZFZ A;  2XSH B;  4J9A A;  1W00 A;  2BU4 A;  3WA3 A;  1WNH A;  2OQE C;  4JRF A;  1RLS A;  1JB4 A;  1ROA A; 
#chains in the Genus database with same CATH homology
 1Q9E A;  3AGO A;  1HYF A;  1MGR A;  1RCL A;  1RLS A;  1BU4 A;  4HOH A;  1BRN L;  1JBR A;  3RNT A;  2RBI A;  1UCL A;  1RMS A;  1B20 A;  8RNT A;  1BRJ A;  1RGG A;  1DET A;  1FZU A;  3WHO A;  1B2S A;  2AAE A;  1BSD A;  4HAA A;  1BSE A;  1BIR A;  1UCJ A;  1BAN A;  1RGK A;  1RNB A;  4GHO A;  3A5E A;  1FYS A;  4J5K A;  1UCI A;  1T2I A;  1RGL A;  1B21 A;  1MGW A;  1BOX A;  1DE3 A;  1RGF A;  1BSC A;  1BSB A;  1RGH A;  3URP A;  1TRP A;  3DH2 A;  1BAO A;  1YVS A;  5GSP A;  2BIR A;  1RGE A;  1GMP A;  1JBT A;  1BNR A;  1GMR A;  1GOV A;  3GSP A;  1RGA A;  1RGC A;  1I8V A;  1HZ1 A;  3BIR A;  1RCK A;  3D5G A;  7GSP A;  1BNI A;  2C4B A;  1B2X A;  1BNJ A;  1I3F A;  1X1X A;  1LNI A;  1PY3 A;  1I0X A;  6RNT A;  3D4A A;  1YNV X;  1FUS A;  1R4Y A;  4BU4 A;  1RN1 A;  2F5W A;  1B2M A;  1A2P A;  1GOU A;  5BIR A;  2KF4 A;  3Q3F A;  1B27 A;  1AY7 A;  3HOH A;  1UCK A;  3KCH A;  1LOY A;  1BRG A;  3AHS A;  2RNT A;  7RNT A;  3AGN A;  1GOY A;  4GSP A;  2KF3 A;  1RHL A;  1I2G A;  1BNS A;  3SYU A;  1I3I A;  9RNT A;  1IYY A;  1CH0 A;  4RNT A;  1I70 A;  1B3S A;  1I2F A;  1C54 A;  1LOW A;  1JBS A;  1RDS A;  1BNG A;  2F56 A;  1RSN A;  1LRA A;  4J5G A;  1PYL A;  1BRS A;  1ZGX A;  1G02 A;  1LOV A;  1SAR A;  2HOH A;  1YGW A;  2KAA A;  1I0V A;  1X1U A;  2ZA4 A;  3BU4 A;  1B2U A;  1BVI A;  5BU4 A;  1BRI A;  1GSP A;  2KF5 A;  2F5M A;  2GSP A;  1B2Z A;  3D5I A;  3DGY A;  6GSP A;  1GMQ A;  3WR2 A;  1BNF A;  1RN4 A;  5HOH A;  1RNT A;  5RNT A;  4BIR A;  2F4Y A;  1BSA A;  1RTU A;  2AAD A;  1I2E A;  1FW7 A;  1T2H A;  1BRK A;  3AHW A;  1FUT A;  1BGS A;  2KF6 A;  2SAR A;  1BUJ A;  1BNE A;  1TTO A;  1X1Y A;  1TRQ A;  2BU4 A;  1BRH A;  1X1W A;  1AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...