1BANA

The contribution of buried hydrogen bonds to protein stability: the crystal structures of two barnase mutants
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYASDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of buried hydrogen bonds to protein stability. The crystal structures of two barnase mutants.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 27
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1993-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1banA00
1I2EA 1YNVX 1DE3A 3GSPA 1RLSA 1ZGXA 1BSDA 2F56A 1FZUA 1B21A 1I70A 1I2FA 1TTOA 1B20A 1AQZA 1B2SA 1X1WA 1RNTA 1B2MA 1MGRA 1FUSA 1MGWA 1BRIA 1BVIA 1BNRA 1X1UA 2BU4A 1YVSA 1GMPA 2KF3A 1HYFA 3D5IA 1RGLA 1G02A 3D4AA 1T2IA 3SYUA 3D5GA 1BANA 1BOXA 1X1YA 1PY3A 1RCKA 3DH2A 3AGNA 1SARA 1C54A 1BRSA 6GSPA 1RSNA 2ZA4A 1BSCA 1I2GA 7RNTA 1B3SA 1RNBA 1R4YA 1GSPA 1RMSA 2F4YA 2SARA 6RNTA 1LOVA 3RNTA 1BGSA 1GOYA 8RNTA 2KF6A 3A5EA 1BSAA 1I3FA 2BIRA 1T2HA 1A2PA 1GMQA 3Q3FA 3DGYA 2AADA 1LRAA 1BRNL 1BRHA 3URPA 3WR2A 3WHOA 9RNTA 7GSPA 1PYLA 2GSPA 1BNEA 1UCIA 4RNTA 1BU4A 1HZ1A 4HAAA 4J5GA 1BRKA 4J5KA 1BSEA 1GOVA 1RGKA 1RGFA 2RNTA 1BRGA 2KF4A 1RGEA 5HOHA 1FW7A 1RCLA 1RDSA 1Q9EA 1UCKA 1BUJA 1DETA 1BNSA 1RN4A 1UCLA 1BNIA 2HOHA 3KCHA 1FUTA 5BIRA 1RGGA 1RGCA 2F5MA 2KAAA 4GHOA 1RGAA 1BIRA 1TRPA 5GSPA 3BU4A 4BIRA 1I0XA 1GMRA 1LNIA 2KF5A 1BNJA 3AHWA 1JBRA 2C4BA 1BSBA 3HOHA 1JBTA 1I8VA 1RHLA 3AHSA 1FYSA 1BNGA 1RGHA 1TRQA 1I0VA 1LOWA 5RNTA 2RBIA 5BU4A 1BRJA 3BIRA 1B2UA 1GOUA 1YGWA 1CH0A 4HOHA 1X1XA 1BNFA 1RTUA 1B27A 1RN1A 4GSPA 1JBSA 1B2XA 1B2ZA 1IYYA 1BAOA 1LOYA 1AY7A 2AAEA 3AGOA 4BU4A 1I3IA 1UCJA 2F5WA
chains in the Genus database with same CATH superfamily
3WODG 1IT7A 1PFPA 3MG2A 3VF1A 5CXOA 3GSPA 3FG1A 1ULJB 2XF3A 5CLKA 1W02A 3CME3 1I70A 3CNMA 1TTOA 1VQN3 3CD63 3A76A 1AQZA 3LTAA 4FCMA 4O3VA 3S28A 1O7MB 3VGNA 1MGWA 4HZBB 3NV0A 1WQLB 1BRIA 1FGMA 8CHOA 1N9EA 3PGBA 3MPHA 1VQ83 1BNRA 1X1UA 2WGQA 3JUMA 1GMPA 3D5IA 1G02A 3CCM3 2CK3H 4RNYA 1X1YA 3DH2A 1JN5B 1DYUA 1OACA 2BT3A 2J8XB 3D3LA 1L5GB 4RBNA 5AI1A 5LC7A 3SX1A 2HMLB 3FF0A 2ZA4A 1W4NA 1WMPA 4WFOA 7RNTA 1SQWA 1YI23 3JVCA 1RMSA 2SARA 3N54B 6RNTA 5AIFA 4OK0A 4R9LA 3WA2X 3Q2PA 1BGSA 3BB9A 1JN5A 1WMNA 2FGTA 2W6JH 2JQ5A 3DGYA 4KZ1A 1OH0A 1NJI4 2AADA 2F86B 2BMOB 1BRHA 3BNEA 4KVHA 3NBJA 4XDWA 4CDLA 3G16A 3LT9A 2GSPA 3RGAA 1KWIA 2YX9A 1OHOA 3PXMA 5A0OB 3WA3A 4R80A 2P0MA 1Y4KA 4ZM8A 1BU4A 4O8SA 1QVG2 4J5GA 3GWRA 1BRKA 1K41A 3JUQA 1OUNA 3LH4A 3NV0B 1EEJA 4XDVA 5BXQA 3NQZA 3CMA3 4MMXB 1VQ73 1KD14 4MMZB 3NM7A 4CCVA 3RDEA 3DM8A 3F40A 3GZRA 1BRGA 1M1K4 1MWTA 2CWUA 1JJ22 1FGQA 3FH1A 2BMRB 1K9M4 4XBTA 3RGRA 1W01A 5EVHA 3S67A 1RJOA 4HM5B 2RSXA 2ZDJA 3DUKA 2XEPA 1RGGA 2F5MA 1TIJA 1RGAA 2CFWA 3OX9A 4BIRA 1Z1SA 5AIHA 1VQO3 1I0XA 2OTJ3 3G8ZA 5G1LA 1NB3I 1LNIA 4LMIA 1BNJA 1J2BA 1HKXA 1VQ63 1IQYA 2PZVA 3S27A 3EJVA 1QMAA 4LZIA 4CJNA 1BSBA 5IG3A 1Q864 1JB4A 1JKGA 1NWWA 1IVWA 1JBTA 1W6CA 2W9PA 3ER7A 2W56B 1YJ93 4N6V0 3WOEB 2QEX3 2BHMA 3AHSA 3EE1A 1IVUA 1GD3A 3NM2A 5IW9A 3I553 1RGHA 3N8BA 2Y74A 4O2HA 1CEWI 1VQK3 3OV4A 1YGWA 4HOHA 4CPKA 1BNFA 1TJDA 1ZO2A 2E2VA 2OOVC 1RTUA 4K90B 2W9QA 3JUPA 4GSPA 1SIHA 1B2XA 1B2ZA 3B4OA 3FKAA 2O3OA 3F8XA 3U1WA 3CU3A 1LOYA 1AY7A 3QK9A 3V92A 1VQ53 1CYUA 1I3IA 2F5WA 1I2EA 3ALAA 1BUQA 1UGIA 1YNVX 4QWTA 4EXRA 1DE3A 1MOLA 3CCJ3 2H0HA 1ZGXA 1BSDA 2F56A 3WMDA 1JZDA 1NU3A 1B21A 4L7KA 3IMAB 2CIUA 1QAFA 3EBYA 4N6LA 1ZS7A 4G1MB 2CFDA 3KSED 1GD4A 4BL2A 1M904 3DY5A 1K8A4 3UJMA 1VQM3 1IQXA 1M9GA 5M19A 4HM7B 1CYVA 3FG4A 2E2TA 3CCS3 1W2B2 1HYFA 2Z77A 1OCVA 1RGLA 3PYJA 3SOAA 2ML5A 1VQ93 1BANA 2L4VA 3BNDA 3ZG0A 4BTWA 2W2CA 1IDPA 3AGNA 4FCZA 1SARA 1ULIB 4FMCA 3GAXA 5IG4A 1VQL3 3GZXB 3H3HA 1TFOA 3I0YA 4HBRA 1BSCA 1I2GA 1OHSA 3NXJA 1RNBA 2CH9A 1R4YA 1VQ43 2F4YA 4EBGA 1HU9A 2YFIB 1A2KA 3CNXA 3FGYA 1OF5A 3OWUA 4AEQA 2HMMB 1GY6A 5JBSA 1O7WB 3OWYA 3D9RA 2Y73A 3EX9A 3LTDA 3G6E3 2OQEC 3Q3FA 2CG0A 1JB5A 3T0UA 2UGIA 2XH9A 2CKFB 4IIAA 1T5YA 3WR2A 3LYGA 3CCR3 1UCIA 2GBXB 1DMMA 1O7GB 1S5AA 4IPBA 1IVVA 2WOFA 2XFTA 2K0MA 3UB1A 1W7CA 4HAAA 1TU5A 2KRTA 3V99A 3D79A 1IT8A 4HKVB 5G2GA 7STDA 3KKGA 1WTHA 4FMDA 5AIGA 3NUVA 5CF2A 1RGKA 1RGFA 2RNTA 5KP4A 2KF4A 3DGNA 3AMOA 3EHCA 1RGEA 3KFQC 1UGHI 3PS8A 4FCJA 4OVMA 1FW7A 1IU7A 4GB5A 1V58A 2GXFA 1UCKA 1BUJA 1DETA 1UUWB 4HM3B 1W5ZA 3IPTA 4AKZA 3G0KA 3NHXA 5AEUB 1QAKA 3G4S3 2Q07A 4HM1B 3NBRA 5BIRA 2KAAA 3PZWA 4HJLB 4MJDA 2V1LA 1TRPA 2P0XA 1O7PB 3LTBA 1GMRA 2KF5A 1LVNA 4HM4B 5EQLA 5HGRA 4LYLB 1JBRA 1AVKA 5ELJA 1PU4A 4XBXA 4J9AA 1M1XB 2KCDA 3GZBA 3HOHA 4X2OA 4XM4A 2MC8A 3FG3A 1Q814 1E3RA 4FR9A 4STDA 2OCTA 3CPOA 2ML6A 5AYRB 3MYTA 1TRQA 5RNTA 1EUIC 2O9UX 3KE7A 3M8CA 2RBIA 5BU4A 3EN8A 1ROAA 1D6ZA 3BIRA 1N5HA 4DKIA 1NO3A 4JF8A 2IYJA 1KSIA 1X1XA 3FSDA 4AKYA 1VQQA 2QIYA 1C7HA 3CCL3 5ELUA 1A90A 3EBTA 1RN1A 2IY2A 2M7OA 4EC6A 1Q40A 5IG0A 2HMOB 1UUGB 2P05A 3HIGA 1O7HB 4BTXA 4X2HA 1FA3A 1TP6A 3KIIA 2UX0A 1BAOA 2AAEA 1GS3A 4HM0B 3NX0A 1EKMA 2XGLA 1YGEA 1O7NB 3MG1A 2STDA 5AIIA 3DGOA 5M1AA 3B8LA 1U8CB 1ZX2A 5TGNA 2QA43 1V57A 1Q824 3MSOA 1D6YA 3FCSB 4WHAA 1I2FA 3EB8A 1IV7A 2XR8B 3HIIA 1RNTA 1RKYA 1MGRA 5JPPA 2I9WA 3MKIA 3HZPA 3T8NA 4N6MA 1BVIA 4KFFA 2WO0A 3K5TA 1YJW3 2RFRA 2BU4A 3SVAA 5I97A 3O8YA 1YVSA 2K54A 2KF3A 4WWUC 3KZTA 3SOYA 2MF7A 4ILFA 3OWSA 2WOHA 3X40A 2CW9A 1SIIA 3F7XA 2UUGC 3SYUA 2CWVA 4ORLA 4XB5A 2ZL8A 3NBBA 2D1WA 1NB5I 4MMYB 4XBYA 3X42A 3Q1CA 1C54A 1BRSA 2D42A 1RSNA 6GSPA 1N5PA 1GY7A 2IUKA 1B3SA 1JNQA 1G0TA 2IA7A 3GRDA 5D82A 1GSPA 2WGOA 2RGQA 2CHCA 1LOVA 4K1VA 5AEWB 3RNTA 3LXUX 4I5QA 4TX4A 4EV2A 3MG3A 3CC23 3A5EA 1BSAA 1GY5A 1I3FA 4NREA 1T2HA 1IVXA 1IV9A 1GMQA 2INXA 1JRQA 2OWPA 3MWZA 4FMBA 4HM8B 1LRAA 1BRNL 1E3VA 1MNLA 3URPA 5DREA 3WHOA 3CPW2 6STDA 1PYLA 4KT3B 1BNEA 5EEOA 4HZ9B 3SXXA 3X3YA 5M18A 2E2UA 4LGQA 1OPYA 1FGTA 2CX1A 1MWUA 4HYZA 5IG5A 1GYBA 4R9KA 5IEOA 5BVBA 2L1SA 1UI7A 4J5KA 1T3BA 1BSEA 1GOVA 3BLZA 1US1A 2IMJA 4H3UA 1OGZA 4BL3A 4JRFA 2Z76A 2XFSA 1RCLA 3EC9A 3HI7A 1RDSA 4LEHA 3EQQB 1Q7Y4 1UCLA 5CK6A 3F9SA 1A67A 1UDII 3KCHA 1FUTA 1VQP3 1RGCA 2CWTA 2W04A 3AMOB 1YHQ3 1SJWA 1BIRA 3JUNA 5GSPA 3BU4A 1YIT3 2QGUA 2K3DA 2C4BA 3S5CA 4KFDA 4I4KA 4U13A 1N8R4 2C10A 1K734 1I8VA 1LQMB 4R1KA 3KSPA 5AYSC 1FYSA 1JV2B 1BNGA 1LOWA 1ASKA 1Q40B 1RRLA 1SPUA 3EF8A 5IENA 5IF6A 1BRJA 1OGXA 4RZMA 1B2UA 2W03A 3L0RA 1W6YA 2CG1A 1CH0A 2ZHXB 1YVBI 2B1XB 1FGRA 3X3XA 2YFLB 3BNBA 5G1KA 2W0QA 5STDA 2KXGA 1A2VA 2B24B 1JBSA 1QVF2 1RRHA 2GBWB 1STFI 2F98A 3LT8A 2HMNB 3UL5A 1IYYA 1Q42A 3PCRA 2XSOB 3V98A 3DXOA 3CXC2 2CFKA 1U5OA 1MWSA 4J8TA 3UNLA 3H51A 5IEPA 1WNHA 1QALA 4N6OB 3G713 1RLSA 2PNCA 1E97A 3DGLA 1FZUA 4K61A 4MEIA 2LQVA 3S29A 1QJGA 1WMOA 3MHEA 3OW22 1JB2A 3PCSA 2RCDA 1B20A 1X1WA 1B2SA 3B7CA 4EW5A 1STDA 2JDIH 3DZLA 1B2MA 1FUSA 3CCV3 1DVDA 2BNGA 1DMNA 1TUHA 4K1UA 3VSYA 2P38A 3K7CA 1DMQA 1LNHA 2CX0A 2R41A 2OQEA 3D4AA 3FLJA 1DVCA 1T2IA 3QRDA 4R4KA 3D5GA 1KQS2 1BOXA 2FXTA 4NHFA 1PY3A 1RCKA 3WDGB 1NDOB 4O02B 4H61A 1S723 1FGOA 3ROBA 2GU1A 3Q90A 1MWRA 3ZG5A 2XRXB 3E99A 3K63A 3TDGA 1UUVB 4HM2B 2SBLA 2Z6BA 4Q53A 2GEXA 3CC43 5FGOA 3LOYA 4BTYA 3SEDA 3EN1B 3K0ZA 4L8PA 4WP5A 1W2ZA 4KFEA 3CC73 4EV5A 1GOYA 2F99A 2KF6A 5D83A 1IQ8A 1EA2A 8RNTA 1ROVA 2BIRA 3CCQ3 5KP1A 1A2PA 1VZZA 3JUOA 3ECFA 3NQYA 3LTCA 3CCE3 3UL6A 2IUJA 4PEJA 1N9JA 3F14A 3SLUA 5IERA 1UI8A 1OHPA 1Q7HA 9RNTA 7GSPA 3B4PA 3BNCA 3K9MC 4RNTA 1YJN3 4L8OA 1HZ1A 2H0IA 1LQGC 2XGNA 4GL6A 3CCU3 1UW1A 2GEYA 2CFLA 2FNQA 1YIJ3 1F8NA 4N6UA 5HOHA 2BO9B 3FZWA 3DGMA 4EYCA 1Q9EA 3IJEB 5FW5A 3J7Yd 1BNSA 1OF5B 1RN4A 1BNIA 1D6UA 2Z7AA 2HMJB 4NPBA 3DMCA 3LMLA 4LSOA 1ISKA 2H0GA 1V74A 2HOHA 4RNZA 5D81A 2OOVA 5DRVA 1AVLA 2BMQB 3KN4A 3OXAA 3LZAA 4GHOA 1N8QA 1W00A 3F7SA 4N6TA 1G96A 2P09A 2GU3A 3X41A 2R4IA 4N6NB 4WYKB 2XSHB 3I563 1KC84 2OTL3 1NNVA 3AHWA 3F8HA 2CC3A 4N3VA 1AV4A 2C11A 3N9HA 1LOXA 3WOFB 5LC6A 1K28A 4IT7A 3STDA 1RHLA 1AR0A 4FMAA 3U97A 1CQSA 3FF2A 4HM6B 4OUQA 3HX8A 1I0VA 5KP3A 3HK4A 1IK3A 4HVNA 1EG9B 3T8UA 5JPUA 1GOUA 1JKGB 3GZYB 1W6GA 2CFGA 1FUWA 2YFJB 1EQKA 5CF1A 3ZFZA 1B27A 1JZOA 2LYXA 4WYKA 1RN7A 2HMKB 3X3ZA 1LXEA 2A15A 1TFKA 1R4CA 2W56A 3AGOA 4BU4A 1UCJA
chains in the Genus database with same CATH topology
1I2EA 1YNVX 1DE3A 3GSPA 1RLSA 1ZGXA 1BSDA 2F56A 1FZUA 1B21A 1I70A 1I2FA 1TTOA 1B20A 1AQZA 1B2SA 1X1WA 1RNTA 1B2MA 1MGRA 1FUSA 1MGWA 1BRIA 1BVIA 1BNRA 1X1UA 2BU4A 1YVSA 1GMPA 2KF3A 1HYFA 3D5IA 1RGLA 1G02A 3D4AA 1T2IA 3SYUA 3D5GA 1BANA 1BOXA 1X1YA 1PY3A 1RCKA 3DH2A 3AGNA 1SARA 1C54A 1BRSA 6GSPA 1RSNA 2ZA4A 1BSCA 1I2GA 7RNTA 1B3SA 1RNBA 1R4YA 1GSPA 1RMSA 2F4YA 2SARA 6RNTA 1LOVA 3RNTA 1BGSA 1GOYA 8RNTA 2KF6A 3A5EA 1BSAA 1I3FA 2BIRA 1T2HA 1A2PA 1GMQA 3Q3FA 3DGYA 2AADA 1LRAA 1BRNL 1BRHA 3URPA 3WR2A 3WHOA 9RNTA 7GSPA 1PYLA 2GSPA 1BNEA 1UCIA 4RNTA 1BU4A 1HZ1A 4HAAA 4J5GA 1BRKA 4J5KA 1BSEA 1GOVA 1RGKA 1RGFA 2RNTA 1BRGA 2KF4A 1RGEA 5HOHA 1FW7A 1RCLA 1RDSA 1Q9EA 1UCKA 1BUJA 1DETA 1BNSA 1RN4A 1UCLA 1BNIA 2HOHA 3KCHA 1FUTA 5BIRA 1RGGA 1RGCA 2F5MA 2KAAA 4GHOA 1RGAA 1BIRA 1TRPA 5GSPA 3BU4A 4BIRA 1I0XA 1GMRA 1LNIA 2KF5A 1BNJA 3AHWA 1JBRA 2C4BA 1BSBA 3HOHA 1JBTA 1I8VA 1RHLA 3AHSA 1FYSA 1BNGA 1RGHA 1TRQA 1I0VA 1LOWA 5RNTA 2RBIA 5BU4A 1BRJA 3BIRA 1B2UA 1GOUA 1YGWA 1CH0A 4HOHA 1X1XA 1BNFA 1RTUA 1B27A 1RN1A 4GSPA 1JBSA 1B2XA 1B2ZA 1IYYA 1BAOA 1LOYA 1AY7A 2AAEA 3AGOA 4BU4A 1I3IA 1UCJA 2F5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I2E A;  1YNV X;  1DE3 A;  3GSP A;  1RLS A;  1ZGX A;  1BSD A;  2F56 A;  1FZU A;  1B21 A;  1I70 A;  1I2F A;  1TTO A;  1B20 A;  1AQZ A;  1B2S A;  1X1W A;  1RNT A;  1B2M A;  1MGR A;  1FUS A;  1MGW A;  1BRI A;  1BVI A;  1BNR A;  1X1U A;  2BU4 A;  1YVS A;  1GMP A;  2KF3 A;  1HYF A;  3D5I A;  1RGL A;  1G02 A;  3D4A A;  1T2I A;  3SYU A;  3D5G A;  1BAN A;  1BOX A;  1X1Y A;  1PY3 A;  1RCK A;  3DH2 A;  3AGN A;  1SAR A;  1C54 A;  1BRS A;  6GSP A;  1RSN A;  2ZA4 A;  1BSC A;  1I2G A;  7RNT A;  1B3S A;  1RNB A;  1R4Y A;  1GSP A;  1RMS A;  2F4Y A;  2SAR A;  6RNT A;  1LOV A;  3RNT A;  1BGS A;  1GOY A;  8RNT A;  2KF6 A;  3A5E A;  1BSA A;  1I3F A;  2BIR A;  1T2H A;  1A2P A;  1GMQ A;  3Q3F A;  3DGY A;  2AAD A;  1LRA A;  1BRN L;  1BRH A;  3URP A;  3WR2 A;  3WHO A;  9RNT A;  7GSP A;  1PYL A;  2GSP A;  1BNE A;  1UCI A;  4RNT A;  1BU4 A;  1HZ1 A;  4HAA A;  4J5G A;  1BRK A;  4J5K A;  1BSE A;  1GOV A;  1RGK A;  1RGF A;  2RNT A;  1BRG A;  2KF4 A;  1RGE A;  5HOH A;  1FW7 A;  1RCL A;  1RDS A;  1Q9E A;  1UCK A;  1BUJ A;  1DET A;  1BNS A;  1RN4 A;  1UCL A;  1BNI A;  2HOH A;  3KCH A;  1FUT A;  5BIR A;  1RGG A;  1RGC A;  2F5M A;  2KAA A;  4GHO A;  1RGA A;  1BIR A;  1TRP A;  5GSP A;  3BU4 A;  4BIR A;  1I0X A;  1GMR A;  1LNI A;  2KF5 A;  1BNJ A;  3AHW A;  1JBR A;  2C4B A;  1BSB A;  3HOH A;  1JBT A;  1I8V A;  1RHL A;  3AHS A;  1FYS A;  1BNG A;  1RGH A;  1TRQ A;  1I0V A;  1LOW A;  5RNT A;  2RBI A;  5BU4 A;  1BRJ A;  3BIR A;  1B2U A;  1GOU A;  1YGW A;  1CH0 A;  4HOH A;  1X1X A;  1BNF A;  1RTU A;  1B27 A;  1RN1 A;  4GSP A;  1JBS A;  1B2X A;  1B2Z A;  1IYY A;  1BAO A;  1LOY A;  1AY7 A;  2AAE A;  3AGO A;  4BU4 A;  1I3I A;  1UCJ A;  2F5W A; 
#chains in the Genus database with same CATH topology
 3WOD G;  1IT7 A;  1PFP A;  3MG2 A;  3VF1 A;  5CXO A;  3GSP A;  3FG1 A;  1ULJ B;  2XF3 A;  5CLK A;  1W02 A;  3CME 3;  1I70 A;  3CNM A;  1TTO A;  1VQN 3;  3CD6 3;  3A76 A;  1AQZ A;  3LTA A;  4FCM A;  4O3V A;  3S28 A;  1O7M B;  3VGN A;  1MGW A;  4HZB B;  3NV0 A;  1WQL B;  1BRI A;  1FGM A;  8CHO A;  1N9E A;  3PGB A;  3MPH A;  1VQ8 3;  1BNR A;  1X1U A;  2WGQ A;  3JUM A;  1GMP A;  3D5I A;  1G02 A;  3CCM 3;  2CK3 H;  4RNY A;  1X1Y A;  3DH2 A;  1JN5 B;  1DYU A;  1OAC A;  2BT3 A;  2J8X B;  3D3L A;  1L5G B;  4RBN A;  5AI1 A;  5LC7 A;  3SX1 A;  2HML B;  3FF0 A;  2ZA4 A;  1W4N A;  1WMP A;  4WFO A;  7RNT A;  1SQW A;  1YI2 3;  3JVC A;  1RMS A;  2SAR A;  3N54 B;  6RNT A;  5AIF A;  4OK0 A;  4R9L A;  3WA2 X;  3Q2P A;  1BGS A;  3BB9 A;  1JN5 A;  1WMN A;  2FGT A;  2W6J H;  2JQ5 A;  3DGY A;  4KZ1 A;  1OH0 A;  1NJI 4;  2AAD A;  2F86 B;  2BMO B;  1BRH A;  3BNE A;  4KVH A;  3NBJ A;  4XDW A;  4CDL A;  3G16 A;  3LT9 A;  2GSP A;  3RGA A;  1KWI A;  2YX9 A;  1OHO A;  3PXM A;  5A0O B;  3WA3 A;  4R80 A;  2P0M A;  1Y4K A;  4ZM8 A;  1BU4 A;  4O8S A;  1QVG 2;  4J5G A;  3GWR A;  1BRK A;  1K41 A;  3JUQ A;  1OUN A;  3LH4 A;  3NV0 B;  1EEJ A;  4XDV A;  5BXQ A;  3NQZ A;  3CMA 3;  4MMX B;  1VQ7 3;  1KD1 4;  4MMZ B;  3NM7 A;  4CCV A;  3RDE A;  3DM8 A;  3F40 A;  3GZR A;  1BRG A;  1M1K 4;  1MWT A;  2CWU A;  1JJ2 2;  1FGQ A;  3FH1 A;  2BMR B;  1K9M 4;  4XBT A;  3RGR A;  1W01 A;  5EVH A;  3S67 A;  1RJO A;  4HM5 B;  2RSX A;  2ZDJ A;  3DUK A;  2XEP A;  1RGG A;  2F5M A;  1TIJ A;  1RGA A;  2CFW A;  3OX9 A;  4BIR A;  1Z1S A;  5AIH A;  1VQO 3;  1I0X A;  2OTJ 3;  3G8Z A;  5G1L A;  1NB3 I;  1LNI A;  4LMI A;  1BNJ A;  1J2B A;  1HKX A;  1VQ6 3;  1IQY A;  2PZV A;  3S27 A;  3EJV A;  1QMA A;  4LZI A;  4CJN A;  1BSB A;  5IG3 A;  1Q86 4;  1JB4 A;  1JKG A;  1NWW A;  1IVW A;  1JBT A;  1W6C A;  2W9P A;  3ER7 A;  2W56 B;  1YJ9 3;  4N6V 0;  3WOE B;  2QEX 3;  2BHM A;  3AHS A;  3EE1 A;  1IVU A;  1GD3 A;  3NM2 A;  5IW9 A;  3I55 3;  1RGH A;  3N8B A;  2Y74 A;  4O2H A;  1CEW I;  1VQK 3;  3OV4 A;  1YGW A;  4HOH A;  4CPK A;  1BNF A;  1TJD A;  1ZO2 A;  2E2V A;  2OOV C;  1RTU A;  4K90 B;  2W9Q A;  3JUP A;  4GSP A;  1SIH A;  1B2X A;  1B2Z A;  3B4O A;  3FKA A;  2O3O A;  3F8X A;  3U1W A;  3CU3 A;  1LOY A;  1AY7 A;  3QK9 A;  3V92 A;  1VQ5 3;  1CYU A;  1I3I A;  2F5W A;  1I2E A;  3ALA A;  1BUQ A;  1UGI A;  1YNV X;  4QWT A;  4EXR A;  1DE3 A;  1MOL A;  3CCJ 3;  2H0H A;  1ZGX A;  1BSD A;  2F56 A;  3WMD A;  1JZD A;  1NU3 A;  1B21 A;  4L7K A;  3IMA B;  2CIU A;  1QAF A;  3EBY A;  4N6L A;  1ZS7 A;  4G1M B;  2CFD A;  3KSE D;  1GD4 A;  4BL2 A;  1M90 4;  3DY5 A;  1K8A 4;  3UJM A;  1VQM 3;  1IQX A;  1M9G A;  5M19 A;  4HM7 B;  1CYV A;  3FG4 A;  2E2T A;  3CCS 3;  1W2B 2;  1HYF A;  2Z77 A;  1OCV A;  1RGL A;  3PYJ A;  3SOA A;  2ML5 A;  1VQ9 3;  1BAN A;  2L4V A;  3BND A;  3ZG0 A;  4BTW A;  2W2C A;  1IDP A;  3AGN A;  4FCZ A;  1SAR A;  1ULI B;  4FMC A;  3GAX A;  5IG4 A;  1VQL 3;  3GZX B;  3H3H A;  1TFO A;  3I0Y A;  4HBR A;  1BSC A;  1I2G A;  1OHS A;  3NXJ A;  1RNB A;  2CH9 A;  1R4Y A;  1VQ4 3;  2F4Y A;  4EBG A;  1HU9 A;  2YFI B;  1A2K A;  3CNX A;  3FGY A;  1OF5 A;  3OWU A;  4AEQ A;  2HMM B;  1GY6 A;  5JBS A;  1O7W B;  3OWY A;  3D9R A;  2Y73 A;  3EX9 A;  3LTD A;  3G6E 3;  2OQE C;  3Q3F A;  2CG0 A;  1JB5 A;  3T0U A;  2UGI A;  2XH9 A;  2CKF B;  4IIA A;  1T5Y A;  3WR2 A;  3LYG A;  3CCR 3;  1UCI A;  2GBX B;  1DMM A;  1O7G B;  1S5A A;  4IPB A;  1IVV A;  2WOF A;  2XFT A;  2K0M A;  3UB1 A;  1W7C A;  4HAA A;  1TU5 A;  2KRT A;  3V99 A;  3D79 A;  1IT8 A;  4HKV B;  5G2G A;  7STD A;  3KKG A;  1WTH A;  4FMD A;  5AIG A;  3NUV A;  5CF2 A;  1RGK A;  1RGF A;  2RNT A;  5KP4 A;  2KF4 A;  3DGN A;  3AMO A;  3EHC A;  1RGE A;  3KFQ C;  1UGH I;  3PS8 A;  4FCJ A;  4OVM A;  1FW7 A;  1IU7 A;  4GB5 A;  1V58 A;  2GXF A;  1UCK A;  1BUJ A;  1DET A;  1UUW B;  4HM3 B;  1W5Z A;  3IPT A;  4AKZ A;  3G0K A;  3NHX A;  5AEU B;  1QAK A;  3G4S 3;  2Q07 A;  4HM1 B;  3NBR A;  5BIR A;  2KAA A;  3PZW A;  4HJL B;  4MJD A;  2V1L A;  1TRP A;  2P0X A;  1O7P B;  3LTB A;  1GMR A;  2KF5 A;  1LVN A;  4HM4 B;  5EQL A;  5HGR A;  4LYL B;  1JBR A;  1AVK A;  5ELJ A;  1PU4 A;  4XBX A;  4J9A A;  1M1X B;  2KCD A;  3GZB A;  3HOH A;  4X2O A;  4XM4 A;  2MC8 A;  3FG3 A;  1Q81 4;  1E3R A;  4FR9 A;  4STD A;  2OCT A;  3CPO A;  2ML6 A;  5AYR B;  3MYT A;  1TRQ A;  5RNT A;  1EUI C;  2O9U X;  3KE7 A;  3M8C A;  2RBI A;  5BU4 A;  3EN8 A;  1ROA A;  1D6Z A;  3BIR A;  1N5H A;  4DKI A;  1NO3 A;  4JF8 A;  2IYJ A;  1KSI A;  1X1X A;  3FSD A;  4AKY A;  1VQQ A;  2QIY A;  1C7H A;  3CCL 3;  5ELU A;  1A90 A;  3EBT A;  1RN1 A;  2IY2 A;  2M7O A;  4EC6 A;  1Q40 A;  5IG0 A;  2HMO B;  1UUG B;  2P05 A;  3HIG A;  1O7H B;  4BTX A;  4X2H A;  1FA3 A;  1TP6 A;  3KII A;  2UX0 A;  1BAO A;  2AAE A;  1GS3 A;  4HM0 B;  3NX0 A;  1EKM A;  2XGL A;  1YGE A;  1O7N B;  3MG1 A;  2STD A;  5AII A;  3DGO A;  5M1A A;  3B8L A;  1U8C B;  1ZX2 A;  5TGN A;  2QA4 3;  1V57 A;  1Q82 4;  3MSO A;  1D6Y A;  3FCS B;  4WHA A;  1I2F A;  3EB8 A;  1IV7 A;  2XR8 B;  3HII A;  1RNT A;  1RKY A;  1MGR A;  5JPP A;  2I9W A;  3MKI A;  3HZP A;  3T8N A;  4N6M A;  1BVI A;  4KFF A;  2WO0 A;  3K5T A;  1YJW 3;  2RFR A;  2BU4 A;  3SVA A;  5I97 A;  3O8Y A;  1YVS A;  2K54 A;  2KF3 A;  4WWU C;  3KZT A;  3SOY A;  2MF7 A;  4ILF A;  3OWS A;  2WOH A;  3X40 A;  2CW9 A;  1SII A;  3F7X A;  2UUG C;  3SYU A;  2CWV A;  4ORL A;  4XB5 A;  2ZL8 A;  3NBB A;  2D1W A;  1NB5 I;  4MMY B;  4XBY A;  3X42 A;  3Q1C A;  1C54 A;  1BRS A;  2D42 A;  1RSN A;  6GSP A;  1N5P A;  1GY7 A;  2IUK A;  1B3S A;  1JNQ A;  1G0T A;  2IA7 A;  3GRD A;  5D82 A;  1GSP A;  2WGO A;  2RGQ A;  2CHC A;  1LOV A;  4K1V A;  5AEW B;  3RNT A;  3LXU X;  4I5Q A;  4TX4 A;  4EV2 A;  3MG3 A;  3CC2 3;  3A5E A;  1BSA A;  1GY5 A;  1I3F A;  4NRE A;  1T2H A;  1IVX A;  1IV9 A;  1GMQ A;  2INX A;  1JRQ A;  2OWP A;  3MWZ A;  4FMB A;  4HM8 B;  1LRA A;  1BRN L;  1E3V A;  1MNL A;  3URP A;  5DRE A;  3WHO A;  3CPW 2;  6STD A;  1PYL A;  4KT3 B;  1BNE A;  5EEO A;  4HZ9 B;  3SXX A;  3X3Y A;  5M18 A;  2E2U A;  4LGQ A;  1OPY A;  1FGT A;  2CX1 A;  1MWU A;  4HYZ A;  5IG5 A;  1GYB A;  4R9K A;  5IEO A;  5BVB A;  2L1S A;  1UI7 A;  4J5K A;  1T3B A;  1BSE A;  1GOV A;  3BLZ A;  1US1 A;  2IMJ A;  4H3U A;  1OGZ A;  4BL3 A;  4JRF A;  2Z76 A;  2XFS A;  1RCL A;  3EC9 A;  3HI7 A;  1RDS A;  4LEH A;  3EQQ B;  1Q7Y 4;  1UCL A;  5CK6 A;  3F9S A;  1A67 A;  1UDI I;  3KCH A;  1FUT A;  1VQP 3;  1RGC A;  2CWT A;  2W04 A;  3AMO B;  1YHQ 3;  1SJW A;  1BIR A;  3JUN A;  5GSP A;  3BU4 A;  1YIT 3;  2QGU A;  2K3D A;  2C4B A;  3S5C A;  4KFD A;  4I4K A;  4U13 A;  1N8R 4;  2C10 A;  1K73 4;  1I8V A;  1LQM B;  4R1K A;  3KSP A;  5AYS C;  1FYS A;  1JV2 B;  1BNG A;  1LOW A;  1ASK A;  1Q40 B;  1RRL A;  1SPU A;  3EF8 A;  5IEN A;  5IF6 A;  1BRJ A;  1OGX A;  4RZM A;  1B2U A;  2W03 A;  3L0R A;  1W6Y A;  2CG1 A;  1CH0 A;  2ZHX B;  1YVB I;  2B1X B;  1FGR A;  3X3X A;  2YFL B;  3BNB A;  5G1K A;  2W0Q A;  5STD A;  2KXG A;  1A2V A;  2B24 B;  1JBS A;  1QVF 2;  1RRH A;  2GBW B;  1STF I;  2F98 A;  3LT8 A;  2HMN B;  3UL5 A;  1IYY A;  1Q42 A;  3PCR A;  2XSO B;  3V98 A;  3DXO A;  3CXC 2;  2CFK A;  1U5O A;  1MWS A;  4J8T A;  3UNL A;  3H51 A;  5IEP A;  1WNH A;  1QAL A;  4N6O B;  3G71 3;  1RLS A;  2PNC A;  1E97 A;  3DGL A;  1FZU A;  4K61 A;  4MEI A;  2LQV A;  3S29 A;  1QJG A;  1WMO A;  3MHE A;  3OW2 2;  1JB2 A;  3PCS A;  2RCD A;  1B20 A;  1X1W A;  1B2S A;  3B7C A;  4EW5 A;  1STD A;  2JDI H;  3DZL A;  1B2M A;  1FUS A;  3CCV 3;  1DVD A;  2BNG A;  1DMN A;  1TUH A;  4K1U A;  3VSY A;  2P38 A;  3K7C A;  1DMQ A;  1LNH A;  2CX0 A;  2R41 A;  2OQE A;  3D4A A;  3FLJ A;  1DVC A;  1T2I A;  3QRD A;  4R4K A;  3D5G A;  1KQS 2;  1BOX A;  2FXT A;  4NHF A;  1PY3 A;  1RCK A;  3WDG B;  1NDO B;  4O02 B;  4H61 A;  1S72 3;  1FGO A;  3ROB A;  2GU1 A;  3Q90 A;  1MWR A;  3ZG5 A;  2XRX B;  3E99 A;  3K63 A;  3TDG A;  1UUV B;  4HM2 B;  2SBL A;  2Z6B A;  4Q53 A;  2GEX A;  3CC4 3;  5FGO A;  3LOY A;  4BTY A;  3SED A;  3EN1 B;  3K0Z A;  4L8P A;  4WP5 A;  1W2Z A;  4KFE A;  3CC7 3;  4EV5 A;  1GOY A;  2F99 A;  2KF6 A;  5D83 A;  1IQ8 A;  1EA2 A;  8RNT A;  1ROV A;  2BIR A;  3CCQ 3;  5KP1 A;  1A2P A;  1VZZ A;  3JUO A;  3ECF A;  3NQY A;  3LTC A;  3CCE 3;  3UL6 A;  2IUJ A;  4PEJ A;  1N9J A;  3F14 A;  3SLU A;  5IER A;  1UI8 A;  1OHP A;  1Q7H A;  9RNT A;  7GSP A;  3B4P A;  3BNC A;  3K9M C;  4RNT A;  1YJN 3;  4L8O A;  1HZ1 A;  2H0I A;  1LQG C;  2XGN A;  4GL6 A;  3CCU 3;  1UW1 A;  2GEY A;  2CFL A;  2FNQ A;  1YIJ 3;  1F8N A;  4N6U A;  5HOH A;  2BO9 B;  3FZW A;  3DGM A;  4EYC A;  1Q9E A;  3IJE B;  5FW5 A;  3J7Y d;  1BNS A;  1OF5 B;  1RN4 A;  1BNI A;  1D6U A;  2Z7A A;  2HMJ B;  4NPB A;  3DMC A;  3LML A;  4LSO A;  1ISK A;  2H0G A;  1V74 A;  2HOH A;  4RNZ A;  5D81 A;  2OOV A;  5DRV A;  1AVL A;  2BMQ B;  3KN4 A;  3OXA A;  3LZA A;  4GHO A;  1N8Q A;  1W00 A;  3F7S A;  4N6T A;  1G96 A;  2P09 A;  2GU3 A;  3X41 A;  2R4I A;  4N6N B;  4WYK B;  2XSH B;  3I56 3;  1KC8 4;  2OTL 3;  1NNV A;  3AHW A;  3F8H A;  2CC3 A;  4N3V A;  1AV4 A;  2C11 A;  3N9H A;  1LOX A;  3WOF B;  5LC6 A;  1K28 A;  4IT7 A;  3STD A;  1RHL A;  1AR0 A;  4FMA A;  3U97 A;  1CQS A;  3FF2 A;  4HM6 B;  4OUQ A;  3HX8 A;  1I0V A;  5KP3 A;  3HK4 A;  1IK3 A;  4HVN A;  1EG9 B;  3T8U A;  5JPU A;  1GOU A;  1JKG B;  3GZY B;  1W6G A;  2CFG A;  1FUW A;  2YFJ B;  1EQK A;  5CF1 A;  3ZFZ A;  1B27 A;  1JZO A;  2LYX A;  4WYK A;  1RN7 A;  2HMK B;  3X3Z A;  1LXE A;  2A15 A;  1TFK A;  1R4C A;  2W56 A;  3AGO A;  4BU4 A;  1UCJ A; 
#chains in the Genus database with same CATH homology
 1I2E A;  1YNV X;  1DE3 A;  3GSP A;  1RLS A;  1ZGX A;  1BSD A;  2F56 A;  1FZU A;  1B21 A;  1I70 A;  1I2F A;  1TTO A;  1B20 A;  1AQZ A;  1B2S A;  1X1W A;  1RNT A;  1B2M A;  1MGR A;  1FUS A;  1MGW A;  1BRI A;  1BVI A;  1BNR A;  1X1U A;  2BU4 A;  1YVS A;  1GMP A;  2KF3 A;  1HYF A;  3D5I A;  1RGL A;  1G02 A;  3D4A A;  1T2I A;  3SYU A;  3D5G A;  1BAN A;  1BOX A;  1X1Y A;  1PY3 A;  1RCK A;  3DH2 A;  3AGN A;  1SAR A;  1C54 A;  1BRS A;  6GSP A;  1RSN A;  2ZA4 A;  1BSC A;  1I2G A;  7RNT A;  1B3S A;  1RNB A;  1R4Y A;  1GSP A;  1RMS A;  2F4Y A;  2SAR A;  6RNT A;  1LOV A;  3RNT A;  1BGS A;  1GOY A;  8RNT A;  2KF6 A;  3A5E A;  1BSA A;  1I3F A;  2BIR A;  1T2H A;  1A2P A;  1GMQ A;  3Q3F A;  3DGY A;  2AAD A;  1LRA A;  1BRN L;  1BRH A;  3URP A;  3WR2 A;  3WHO A;  9RNT A;  7GSP A;  1PYL A;  2GSP A;  1BNE A;  1UCI A;  4RNT A;  1BU4 A;  1HZ1 A;  4HAA A;  4J5G A;  1BRK A;  4J5K A;  1BSE A;  1GOV A;  1RGK A;  1RGF A;  2RNT A;  1BRG A;  2KF4 A;  1RGE A;  5HOH A;  1FW7 A;  1RCL A;  1RDS A;  1Q9E A;  1UCK A;  1BUJ A;  1DET A;  1BNS A;  1RN4 A;  1UCL A;  1BNI A;  2HOH A;  3KCH A;  1FUT A;  5BIR A;  1RGG A;  1RGC A;  2F5M A;  2KAA A;  4GHO A;  1RGA A;  1BIR A;  1TRP A;  5GSP A;  3BU4 A;  4BIR A;  1I0X A;  1GMR A;  1LNI A;  2KF5 A;  1BNJ A;  3AHW A;  1JBR A;  2C4B A;  1BSB A;  3HOH A;  1JBT A;  1I8V A;  1RHL A;  3AHS A;  1FYS A;  1BNG A;  1RGH A;  1TRQ A;  1I0V A;  1LOW A;  5RNT A;  2RBI A;  5BU4 A;  1BRJ A;  3BIR A;  1B2U A;  1GOU A;  1YGW A;  1CH0 A;  4HOH A;  1X1X A;  1BNF A;  1RTU A;  1B27 A;  1RN1 A;  4GSP A;  1JBS A;  1B2X A;  1B2Z A;  1IYY A;  1BAO A;  1LOY A;  1AY7 A;  2AAE A;  3AGO A;  4BU4 A;  1I3I A;  1UCJ A;  2F5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...