1BASA

Three-dimensional structures of acidic and basic fibroblast growth factors
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'DPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BASIC FIBROBLAST GROWTH FACTOR
publication title Three-dimensional structures of acidic and basic fibroblast growth factors.
pubmed rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1992-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1basA00
5FNXA 3CRGA 3HBWA 3NBDA 4L4IA 3JRRA 5F8WA 3UDAA 2KLLA 4J2SA 2FO1A 4QD2B 1ISYA 5BOWA 4IY8A 2RQ9A 3V0AA 6I1BA 1EYLA 3OGFA 1ISZA 3NBEA 3SNVA 3N7MA 1DQOA 1JLXA 2MIBA 3O4OA 4I6IA 2E4MC 3FUOA 1BLDA 3B9UA 3CRIA 4OUJA 1DQGA 5BP5C 1WD4A 1V6WA 4JQ0A 3FJEA 4Q91A 1JT5A 3O5WB 4IONA 4II0A 1T9FA 1YTOA 3AH4A 3D7WB 2QYIB 2IHOA 4G1RA 4GP3A 4OWJA 3OBRA 1FV3A 3WINC 2DRZA 5DZUA 2UUSA 3VT1A 4QBVA 4X39A 5E24E 3WO3A 1BASA 4Q9PA 1HIBA 3C9ZA 3IAGC 4YOLA 4X37A 4TLPA 5BXSA 4I8MA 1Z4SA 1KNMA 4EFQA 1AXMA 3OJVA 1AVAC 1S0DA 3PMEA 4XKIA 4HR6C 3MALA 3O4CA 4X3AA 4OWLA 1WBAA 1WD3A 3CRHA 4XFTA 1AF9A 4DENA 3V0BA 3WA1A 3HSMA 3FGMA 5D62A 1K5VA 3HALA 3VEQA 1FGAA 3FFZA 1UPSA 1RG8A 3PG0A 3A23A 4R6UB 2HWAA 2KI6B 1EVTA 1BARA 2R9KB 2VLCA 1G9CA 2HZ9A 5F8YA 3CA4A 2NP0A 3FJ8A 1I1EA 1ISVA 1ISXA 4I3NA 3I2AA 1CVSA 3H6RB 3HMYA 4DEPA 4ZKTB 3BB2A 5BXPA 1ABRB 4ZOTA 41BIA 2J3PA 1OQLB 4J23B 1TP0A 4LO0C 2ZQOA 4LO1A 4GP0A 1EV2A 4I0YA 5BQUA 1JLYA 1MD6A 3AKHA 2MLLB 3CA5A 1YYNA 3P6JA 3NJ5A 3N7KA 2LIEA 1PUUB 1K5UA 1SZ6B 2Q9XA 3UJ0A 2X2SA 2VUAA 3AJ5A 3N7JA 1N4KA 2M49A 3V79C 4PC4A 1SR4C 1JTCA 5BXTA 1TOOA 3AKGA 4HJJA 3FJIA 1ISWA 1IOBA 31BIA 1FMMS 1R8NA 1S0CA 3P6IA 5DUYA 3FJDA 1MC9A 4LO3C 4GOYA 4I37A 4XFSA 5FZUA 4ZFUB 1PZZA 2D7IA 1P63A 3N7LA 1HWNB 2E4MA 5BXRA 1IJTA 3A07A 1BFBA 1DJSB 5BP5A 4LO7B 1V6XA 2K4AB 3UD9A 3IM6A 5FNWA 1E0OA 4F34A 1I1BA 3Q7YA 2NM1A 2F2FC 3UD8A 3RSJA 3VT0A 1BFGA 3W9TA 4OEGA 1JT7A 3WINA 2VXTI 3VSZA 4JKXB 3V0AB 3PHZA 4I4XA 2FGFA 4OW4A 3O49A 4I2SA 2VXRA 1HKNA 4FGFA 1DZCA 2FFUA 4EFRA 4XFUA 3FJCA 3I2XA 3QR5A 3FJAA 1M16A 4QC4A 3HN1A 4ENDA 4H9WA 3PUBA 1AVUA 1Q04A 4P0LA 4IY9A 3BAVA 2DS0A 4IZXA 3FJFA 1YBIA 1NUNA 1Q03A 1YXWA 3RMYA 3O4AA 5B2HA 1VCLA 4I4RA 2NVHA 1PUMB 2XOAA 4OEEA 8I1BA 4HA2A 3FJBA 5JMCA 1HCDA 2KI4A 2Y9GA 3MPPG 1R8OA 4QD2C 4D8HA 1DZDA 2ZQNA 1S0EA 3BAQA 3CA6A 2AQZA 1BFCA 4P0KA 2Y9FA 4I4VA 4QBCA 4ZFWB 3ZC8A 4LO0A 4J2XA 4WBCA 1AFCA 5EG6C 3JUTA 4A7KA 3FJHA 1T4QA 3BRFA 4G9NA 4ZLBB 1ILR1 1S0LA 2VSAA 3WO4A 1W3GA 3POKA 1RZOB 1XHBA 3BA5A 1G9BA 3BAHA 3O3QA 4G6JA 1S0FA 1SR4A 1QXMA 1QQLA 4JPZA 4IYBA 5D63A 3BADA 3BAOA 3CU1B 1JT4A 1DFCA 4Z9WB 2KH2A 4LO3A 1QQKA 4FVVA 1WBCA 1W3FA 3WMVA 5HPZA 1ONKB 5I1BA 4GAFA 1BFFA 2WRYA 4I4UA 1M2TB 3H6RA 4IHZA 1F31A 3CQAA 3VT2A 2FFVA 1Z2VA 2P23A 4LO8B 1EPWA 4IQPA 4QO3A 3VWCA 2RSTA 2L5XA 1IILA 1FWVA 2F2FA 4H04A 4P6AA 5EC5A 3AKFA 2VSEA 3FJKA 1FWUA 2GO2A 3QYDA 2IWTB 4J2YA 5BVPI 1ITBA 3LLPA 4KEIA 3RTIB 1DFQA 4ZBVB 1XYFA 2MC2A 3VUOA 4ZGRB 1AVXB 1L2HA 4KEJA 4X38A 4USOA 2Q3NB 2NZ9A 2D23A 2HWMA 1AVWB 3O4BA 3VSFA 4A7ZA 1IHKA 1TTUA 4J2KA 3AH2A 3EF2A 3ILAA 4JRAA 2P39A 2BEBA 2AAIB 3FUQA 3OGGA 5JLVA 3RTJB 3CA3A 4P0JA 2D7RA 3CA1A 3S8KA 4KEKA 1V6VA 2I1BA 1FQ9A 1NZKA 3I29B 2NTDA 2X2TA 2YUGA 4JP0A 2QN4A 4L4HA 1DIWA 1W3AA 4G6MA 1G9DA 2K8RA 3OJ2A 1HWPB 4IZEA 1JT3A 2D1ZA 2D24A 4OEFA 4DCKC 1IRPA 5F8SA 3AJ6A 4EEEB 4QKRA 3AKIA 3BTAA 4LO2C 3O44A 4ZA3B 3A21A 4GOVA 3A22A 4LO7C 1DLLA 3T8SA 1FMZA 1G9AA 4D0TA 2Y9XE 2Z48A 4A7YA 5FZYA 2BFHA 2D43A 3CAHA 3V0BB 1D0HA 1XG6A 3FJ9A 3HOMA 3ZC9A 2AFGA 1TWMA 4ISRA 3IM5A 3F1RA 4I4SA 3BRGC 3E8LC 1YF8B 2NYYA 1BLAA 2BEAA 3BA7A 3P53A 1IRAX 1BA7A 2HW9A 2RG9B 4ISQA 3H6SE 3AH1A 3CA0A 4EKXB 1A8DA 4Q9GA 3Q7XA 1XZZA 4EFPA 1S0BA 3OBTA 4USPA 1GGPB 4I1BA 2GZBA 2D20A 3BX1C 3Q7WA 1JY0A 1IT0A 3RMXA 4JKQA 3BRDA 2K43A 3WMUA 3ZXGA 3BAUA 4I96A 4KC3A 4OWKA 5DSSB 1TWEA 2D22A 3FJJA 3H6QA 1S0GA 4EB2B 5DVHA 5FZZA 1FV2A 1RMLA 1G82A 3UD7A 4ZFYB 1V6UA 5GAQA 5F90A 4QKSA 5G00A 4QALA 2D44A 4I4QA 3IM7A 9ILBA 3NBNA 3F62B 4I4PA 5D61A 3AZVA 3BA4A 1HWOB 4I4YA 2ET2A 3ZXDA 4F83A 3O4DA 3UJ4A 4AN6A 4GAIA 3TC2A 2F8XC 1JQZA 3S8JA 4CJMA 3R4UA 1FN0A 2AXMA 1HWMB 4JAWA 4I1EA 2ESUA 2ERMA 1HCEA 3N0KA 1TIEA 2Y9WC 3ZX7A 4G9MA 2Z49A 4D0ZA 1PC8B 4I7IA 1Q1UA 3BAGA 4LO1C 5BQUC 2WBCA 3R4SA 7I1BA 1TFMB 1RY7A 3IIRA 3LTQA 3WO2A 1CE7B 3OJMA 1Z0HA 4Z8SB 3NBCA 1PWAA 3KMVA 2LIQA 21BIA 2VU9A 4LO2A 3K1XA 2DREA 3AZWA 4KBBA 2FDBM 4AN7B 1J0SA 1II4A 4I4OA 2KKIA 2ZR1B 2DRYA 5EHAA
chains in the Genus database with same CATH superfamily
5FNXA 3CRGA 3HBWA 3NBDA 4L4IA 3JRRA 5F8WA 3UDAA 2KLLA 4J2SA 2FO1A 4QD2B 1ISYA 5BOWA 4IY8A 2RQ9A 3V0AA 6I1BA 1EYLA 3OGFA 1ISZA 3NBEA 3SNVA 3N7MA 1DQOA 1JLXA 2MIBA 3O4OA 4I6IA 2E4MC 3FUOA 1BLDA 3B9UA 3CRIA 4OUJA 1DQGA 5BP5C 1WD4A 1V6WA 4JQ0A 3FJEA 4Q91A 1JT5A 3O5WB 4IONA 4II0A 1T9FA 1YTOA 3AH4A 3D7WB 2QYIB 2IHOA 4G1RA 4GP3A 4OWJA 3OBRA 1FV3A 3WINC 2DRZA 5DZUA 2UUSA 3VT1A 4QBVA 4X39A 5E24E 3WO3A 1BASA 4Q9PA 1HIBA 3C9ZA 3IAGC 4YOLA 4X37A 4TLPA 5BXSA 4I8MA 1Z4SA 1KNMA 4EFQA 1AXMA 3OJVA 1AVAC 1S0DA 3PMEA 4XKIA 4HR6C 3MALA 3O4CA 4X3AA 4OWLA 1WBAA 1WD3A 3CRHA 4XFTA 1AF9A 4DENA 3V0BA 3WA1A 3HSMA 3FGMA 5D62A 1K5VA 3HALA 3VEQA 1FGAA 3FFZA 1UPSA 1RG8A 3PG0A 3A23A 4R6UB 2HWAA 2KI6B 1EVTA 1BARA 2R9KB 2VLCA 1G9CA 2HZ9A 5F8YA 3CA4A 2NP0A 3FJ8A 1I1EA 1ISVA 1ISXA 4I3NA 3I2AA 1CVSA 3H6RB 3HMYA 4DEPA 4ZKTB 3BB2A 5BXPA 1ABRB 4ZOTA 41BIA 2J3PA 1OQLB 4J23B 1TP0A 4LO0C 2ZQOA 4LO1A 4GP0A 1EV2A 4I0YA 5BQUA 1JLYA 1MD6A 3AKHA 2MLLB 3CA5A 1YYNA 3P6JA 3NJ5A 3N7KA 2LIEA 1PUUB 1K5UA 1SZ6B 2Q9XA 3UJ0A 2X2SA 2VUAA 3AJ5A 3N7JA 1N4KA 2M49A 3V79C 4PC4A 1SR4C 1JTCA 5BXTA 1TOOA 3AKGA 4HJJA 3FJIA 1ISWA 1IOBA 31BIA 1FMMS 1R8NA 1S0CA 3P6IA 5DUYA 3FJDA 1MC9A 4LO3C 4GOYA 4I37A 4XFSA 5FZUA 4ZFUB 1PZZA 2D7IA 1P63A 3N7LA 1HWNB 2E4MA 5BXRA 1IJTA 3A07A 1BFBA 1DJSB 5BP5A 4LO7B 1V6XA 2K4AB 3UD9A 3IM6A 5FNWA 1E0OA 4F34A 1I1BA 3Q7YA 2NM1A 2F2FC 3UD8A 3RSJA 3VT0A 1BFGA 3W9TA 4OEGA 1JT7A 3WINA 2VXTI 3VSZA 4JKXB 3V0AB 3PHZA 4I4XA 2FGFA 4OW4A 3O49A 4I2SA 2VXRA 1HKNA 4FGFA 1DZCA 2FFUA 4EFRA 4XFUA 3FJCA 4UY4A 3I2XA 3QR5A 3FJAA 1M16A 4QC4A 3HN1A 4ENDA 4H9WA 3PUBA 1AVUA 4MZFB 1Q04A 4P0LA 4IY9A 3BAVA 2DS0A 4IZXA 3FJFA 1YBIA 1NUNA 1Q03A 1YXWA 3RMYA 3O4AA 5B2HA 1VCLA 4I4RA 2NVHA 1PUMB 2XOAA 4OEEA 8I1BA 4HA2A 3FJBA 5JMCA 1HCDA 2KI4A 2Y9GA 3MPPG 1R8OA 4QD2C 4D8HA 1DZDA 2NS2A 2ZQNA 1S0EA 3BAQA 3CA6A 2AQZA 1BFCA 4P0KA 2Y9FA 4I4VA 4QBCA 4ZFWB 3ZC8A 4LO0A 4J2XA 4WBCA 1AFCA 5EG6C 3JUTA 4A7KA 3FJHA 1T4QA 3BRFA 4G9NA 4ZLBB 1ILR1 1S0LA 2VSAA 3WO4A 1W3GA 3POKA 1RZOB 1XHBA 3BA5A 1G9BA 3BAHA 3O3QA 4G6JA 1S0FA 1SR4A 1QXMA 1QQLA 4JPZA 4IYBA 5D63A 3BADA 3BAOA 3CU1B 1JT4A 1DFCA 4Z9WB 2KH2A 4LO3A 1QQKA 4FVVA 1WBCA 1W3FA 3WMVA 5HPZA 1ONKB 5I1BA 4GAFA 1BFFA 2WRYA 4I4UA 1M2TB 3H6RA 4IHZA 1F31A 3CQAA 3VT2A 2FFVA 1Z2VA 2P23A 4LO8B 1EPWA 4IQPA 4QO3A 3VWCA 2RSTA 2L5XA 1IILA 1FWVA 2F2FA 4H04A 4P6AA 5EC5A 3AKFA 2VSEA 3FJKA 1FWUA 2GO2A 3QYDA 2IWTB 4J2YA 5BVPI 4MZGB 1ITBA 3LLPA 4KEIA 3RTIB 1DFQA 4ZBVB 1XYFA 2MC2A 3VUOA 4ZGRB 1AVXB 1L2HA 4KEJA 4X38A 4USOA 2Q3NB 2NZ9A 2D23A 2HWMA 1AVWB 3O4BA 3VSFA 4A7ZA 1IHKA 1TTUA 4J2KA 3AH2A 3EF2A 3ILAA 4JRAA 2P39A 2BEBA 2AAIB 3FUQA 3OGGA 5JLVA 4H75A 3RTJB 3CA3A 4P0JA 2D7RA 3CA1A 3S8KA 4KEKA 1V6VA 2I1BA 1FQ9A 1NZKA 3I29B 2NTDA 2X2TA 2YUGA 4JP0A 2QN4A 4L4HA 1DIWA 1W3AA 4G6MA 1G9DA 2K8RA 3OJ2A 1HWPB 4IZEA 1JT3A 2D1ZA 2D24A 4OEFA 4DCKC 1IRPA 5F8SA 3AJ6A 4EEEB 4QKRA 3AKIA 3BTAA 4LO2C 3O44A 4ZA3B 3A21A 4GOVA 3A22A 4LO7C 1DLLA 3T8SA 1FMZA 1G9AA 4D0TA 2Y9XE 2Z48A 4A7YA 5FZYA 2BFHA 2D43A 3CAHA 3V0BB 1D0HA 1XG6A 3FJ9A 3HOMA 3ZC9A 2AFGA 1TWMA 4ISRA 3IM5A 3F1RA 4I4SA 3BRGC 3E8LC 1YF8B 2NYYA 1BLAA 2BEAA 3BA7A 3P53A 1IRAX 1BA7A 2HW9A 2RG9B 4ISQA 3H6SE 3AH1A 3CA0A 4EKXB 1A8DA 4Q9GA 3Q7XA 1XZZA 4EFPA 1S0BA 3OBTA 4USPA 1GGPB 4I1BA 2GZBA 2D20A 3BX1C 3Q7WA 1JY0A 1IT0A 3RMXA 4JKQA 3BRDA 2K43A 3WMUA 3ZXGA 3BAUA 4I96A 4KC3A 4OWKA 5DSSB 1TWEA 2D22A 3FJJA 3H6QA 1S0GA 4EB2B 5DVHA 5FZZA 1FV2A 1RMLA 1G82A 3UD7A 4ZFYB 1V6UA 5GAQA 5F90A 4MZHA 4QKSA 5G00A 4QALA 2D44A 4I4QA 3IM7A 9ILBA 3NBNA 3F62B 4I4PA 5D61A 3AZVA 3BA4A 1HWOB 4I4YA 2ET2A 3ZXDA 4F83A 3O4DA 3UJ4A 4AN6A 4GAIA 3TC2A 2F8XC 1JQZA 3S8JA 4CJMA 3R4UA 1FN0A 2AXMA 1HWMB 4JAWA 4I1EA 2ESUA 2ERMA 1HCEA 3N0KA 1TIEA 2Y9WC 3ZX7A 4G9MA 2Z49A 4D0ZA 1PC8B 4I7IA 1Q1UA 3BAGA 4LO1C 5BQUC 2WBCA 3R4SA 7I1BA 1TFMB 1RY7A 3IIRA 3LTQA 3WO2A 1CE7B 3OJMA 1Z0HA 4Z8SB 3NBCA 1PWAA 3KMVA 2LIQA 21BIA 2VU9A 4LO2A 3K1XA 2DREA 3AZWA 4KBBA 2FDBM 4AN7B 1J0SA 1II4A 4I4OA 2KKIA 2ZR1B 2DRYA 5EHAA
chains in the Genus database with same CATH topology
5FNXA 3CRGA 3HBWA 3NBDA 4L4IA 3JRRA 5F8WA 3UDAA 2KLLA 4J2SA 2FO1A 4QD2B 1ISYA 5BOWA 4IY8A 2RQ9A 3V0AA 6I1BA 1EYLA 3OGFA 1ISZA 3NBEA 3SNVA 3N7MA 1DQOA 1JLXA 2MIBA 3O4OA 4I6IA 2E4MC 3FUOA 1BLDA 3B9UA 3CRIA 4OUJA 1DQGA 5BP5C 1WD4A 1V6WA 4JQ0A 3FJEA 4Q91A 1JT5A 3O5WB 4IONA 4II0A 1T9FA 1YTOA 3AH4A 3D7WB 2QYIB 2IHOA 4G1RA 4GP3A 4OWJA 3OBRA 1FV3A 3WINC 2DRZA 5DZUA 2UUSA 3VT1A 4QBVA 4X39A 5E24E 3WO3A 1BASA 4Q9PA 1HIBA 3C9ZA 3IAGC 4YOLA 4X37A 4TLPA 5BXSA 4I8MA 1Z4SA 1KNMA 4EFQA 1AXMA 3OJVA 1AVAC 1S0DA 3PMEA 4XKIA 4HR6C 3MALA 3O4CA 4X3AA 4OWLA 1WBAA 1WD3A 3CRHA 4XFTA 1AF9A 4DENA 3V0BA 3WA1A 3HSMA 3FGMA 5D62A 1K5VA 3HALA 3VEQA 1FGAA 3FFZA 1UPSA 1RG8A 3PG0A 3A23A 4R6UB 2HWAA 2KI6B 1EVTA 1BARA 2R9KB 2VLCA 1G9CA 2HZ9A 5F8YA 3CA4A 2NP0A 3FJ8A 1I1EA 1ISVA 1ISXA 4I3NA 3I2AA 1CVSA 3H6RB 3HMYA 4DEPA 4ZKTB 3BB2A 5BXPA 1ABRB 4ZOTA 41BIA 2J3PA 1OQLB 4J23B 1TP0A 4LO0C 2ZQOA 4LO1A 4GP0A 1EV2A 4I0YA 5BQUA 1JLYA 1MD6A 3AKHA 2MLLB 3CA5A 1YYNA 3P6JA 3NJ5A 3N7KA 2LIEA 1PUUB 1K5UA 1SZ6B 2Q9XA 3UJ0A 2X2SA 2VUAA 3AJ5A 3N7JA 1N4KA 2M49A 3V79C 4PC4A 1SR4C 1JTCA 5BXTA 1TOOA 3AKGA 4HJJA 3FJIA 1ISWA 1IOBA 31BIA 1FMMS 1R8NA 1S0CA 3P6IA 5DUYA 3FJDA 1MC9A 4LO3C 4GOYA 4I37A 4XFSA 5FZUA 4ZFUB 1PZZA 2D7IA 1P63A 3N7LA 1HWNB 2E4MA 5BXRA 1IJTA 3A07A 1BFBA 1DJSB 5BP5A 4LO7B 1V6XA 2K4AB 3UD9A 3IM6A 5FNWA 1E0OA 4F34A 1I1BA 3Q7YA 2NM1A 2F2FC 3UD8A 3RSJA 3VT0A 1BFGA 3W9TA 4OEGA 1JT7A 3WINA 2VXTI 3VSZA 4JKXB 3V0AB 3PHZA 4I4XA 2FGFA 4OW4A 3O49A 4I2SA 2VXRA 1HKNA 4FGFA 1DZCA 2FFUA 4EFRA 4XFUA 3FJCA 4UY4A 3I2XA 3QR5A 3FJAA 1M16A 4QC4A 3HN1A 4ENDA 4H9WA 3PUBA 1AVUA 4MZFB 1Q04A 4P0LA 4IY9A 3BAVA 2DS0A 4IZXA 3FJFA 1YBIA 1NUNA 1Q03A 1YXWA 3RMYA 3O4AA 5B2HA 1VCLA 4I4RA 2NVHA 1PUMB 2XOAA 4OEEA 8I1BA 4HA2A 3FJBA 5JMCA 1HCDA 2KI4A 2Y9GA 3MPPG 1R8OA 4QD2C 4D8HA 1DZDA 2NS2A 2ZQNA 1S0EA 3BAQA 3CA6A 2AQZA 1BFCA 4P0KA 2Y9FA 4I4VA 4QBCA 4ZFWB 3ZC8A 4LO0A 4J2XA 4WBCA 1AFCA 5EG6C 3JUTA 4A7KA 3FJHA 1T4QA 3BRFA 4G9NA 4ZLBB 1ILR1 1S0LA 2VSAA 3WO4A 1W3GA 3POKA 1RZOB 1XHBA 3BA5A 1G9BA 3BAHA 3O3QA 4G6JA 1S0FA 1SR4A 1QXMA 1QQLA 4JPZA 4IYBA 5D63A 3BADA 3BAOA 3CU1B 1JT4A 1DFCA 4Z9WB 2KH2A 4LO3A 1QQKA 4FVVA 1WBCA 1W3FA 3WMVA 5HPZA 1ONKB 5I1BA 4GAFA 1BFFA 2WRYA 4I4UA 1M2TB 3H6RA 4IHZA 1F31A 3CQAA 3VT2A 2FFVA 1Z2VA 2P23A 4LO8B 1EPWA 4IQPA 4QO3A 3VWCA 2RSTA 2L5XA 1IILA 1FWVA 2F2FA 4H04A 4P6AA 5EC5A 3AKFA 2VSEA 3FJKA 1FWUA 2GO2A 3QYDA 2IWTB 4J2YA 5BVPI 4MZGB 1ITBA 3LLPA 4KEIA 3RTIB 1DFQA 4ZBVB 1XYFA 2MC2A 3VUOA 4ZGRB 1AVXB 1L2HA 4KEJA 4X38A 4USOA 2Q3NB 2NZ9A 2D23A 2HWMA 1AVWB 3O4BA 3VSFA 4A7ZA 1IHKA 1TTUA 4J2KA 3AH2A 3EF2A 3ILAA 4JRAA 2P39A 2BEBA 2AAIB 3FUQA 3OGGA 5JLVA 4H75A 3RTJB 3CA3A 4P0JA 2D7RA 3CA1A 3S8KA 4KEKA 1V6VA 2I1BA 1FQ9A 1NZKA 3I29B 2NTDA 2X2TA 2YUGA 4JP0A 2QN4A 4L4HA 1DIWA 1W3AA 4G6MA 1G9DA 2K8RA 3OJ2A 1HWPB 4IZEA 1JT3A 2D1ZA 2D24A 4OEFA 4DCKC 1IRPA 5F8SA 3AJ6A 4EEEB 4QKRA 3AKIA 3BTAA 4LO2C 3O44A 4ZA3B 3A21A 4GOVA 3A22A 4LO7C 1DLLA 3T8SA 1FMZA 1G9AA 4D0TA 2Y9XE 2Z48A 4A7YA 5FZYA 2BFHA 2D43A 3CAHA 3V0BB 1D0HA 1XG6A 3FJ9A 3HOMA 3ZC9A 2AFGA 1TWMA 4ISRA 3IM5A 3F1RA 4I4SA 3BRGC 3E8LC 1YF8B 2NYYA 1BLAA 2BEAA 3BA7A 3P53A 1IRAX 1BA7A 2HW9A 2RG9B 4ISQA 3H6SE 3AH1A 3CA0A 4EKXB 1A8DA 4Q9GA 3Q7XA 1XZZA 4EFPA 1S0BA 3OBTA 4USPA 1GGPB 4I1BA 2GZBA 2D20A 3BX1C 3Q7WA 1JY0A 1IT0A 3RMXA 4JKQA 3BRDA 2K43A 3WMUA 3ZXGA 3BAUA 4I96A 4KC3A 4OWKA 5DSSB 1TWEA 2D22A 3FJJA 3H6QA 1S0GA 4EB2B 5DVHA 5FZZA 1FV2A 1RMLA 1G82A 3UD7A 4ZFYB 1V6UA 5GAQA 5F90A 4MZHA 4QKSA 5G00A 4QALA 2D44A 4I4QA 3IM7A 9ILBA 3NBNA 3F62B 4I4PA 5D61A 3AZVA 3BA4A 1HWOB 4I4YA 2ET2A 3ZXDA 4F83A 3O4DA 3UJ4A 4AN6A 4GAIA 3TC2A 2F8XC 1JQZA 3S8JA 4CJMA 3R4UA 1FN0A 2AXMA 1HWMB 4JAWA 4I1EA 2ESUA 2ERMA 1HCEA 3N0KA 1TIEA 2Y9WC 3ZX7A 4G9MA 2Z49A 4D0ZA 1PC8B 4I7IA 1Q1UA 3BAGA 4LO1C 5BQUC 2WBCA 3R4SA 7I1BA 1TFMB 1RY7A 3IIRA 3LTQA 3WO2A 1CE7B 3OJMA 1Z0HA 4Z8SB 3NBCA 1PWAA 3KMVA 2LIQA 21BIA 2VU9A 4LO2A 3K1XA 2DREA 3AZWA 4KBBA 2FDBM 4AN7B 1J0SA 1II4A 4I4OA 2KKIA 2ZR1B 2DRYA 5EHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FNX A;  3CRG A;  3HBW A;  3NBD A;  4L4I A;  3JRR A;  5F8W A;  3UDA A;  2KLL A;  4J2S A;  2FO1 A;  4QD2 B;  1ISY A;  5BOW A;  4IY8 A;  2RQ9 A;  3V0A A;  6I1B A;  1EYL A;  3OGF A;  1ISZ A;  3NBE A;  3SNV A;  3N7M A;  1DQO A;  1JLX A;  2MIB A;  3O4O A;  4I6I A;  2E4M C;  3FUO A;  1BLD A;  3B9U A;  3CRI A;  4OUJ A;  1DQG A;  5BP5 C;  1WD4 A;  1V6W A;  4JQ0 A;  3FJE A;  4Q91 A;  1JT5 A;  3O5W B;  4ION A;  4II0 A;  1T9F A;  1YTO A;  3AH4 A;  3D7W B;  2QYI B;  2IHO A;  4G1R A;  4GP3 A;  4OWJ A;  3OBR A;  1FV3 A;  3WIN C;  2DRZ A;  5DZU A;  2UUS A;  3VT1 A;  4QBV A;  4X39 A;  5E24 E;  3WO3 A;  1BAS A;  4Q9P A;  1HIB A;  3C9Z A;  3IAG C;  4YOL A;  4X37 A;  4TLP A;  5BXS A;  4I8M A;  1Z4S A;  1KNM A;  4EFQ A;  1AXM A;  3OJV A;  1AVA C;  1S0D A;  3PME A;  4XKI A;  4HR6 C;  3MAL A;  3O4C A;  4X3A A;  4OWL A;  1WBA A;  1WD3 A;  3CRH A;  4XFT A;  1AF9 A;  4DEN A;  3V0B A;  3WA1 A;  3HSM A;  3FGM A;  5D62 A;  1K5V A;  3HAL A;  3VEQ A;  1FGA A;  3FFZ A;  1UPS A;  1RG8 A;  3PG0 A;  3A23 A;  4R6U B;  2HWA A;  2KI6 B;  1EVT A;  1BAR A;  2R9K B;  2VLC A;  1G9C A;  2HZ9 A;  5F8Y A;  3CA4 A;  2NP0 A;  3FJ8 A;  1I1E A;  1ISV A;  1ISX A;  4I3N A;  3I2A A;  1CVS A;  3H6R B;  3HMY A;  4DEP A;  4ZKT B;  3BB2 A;  5BXP A;  1ABR B;  4ZOT A;  41BI A;  2J3P A;  1OQL B;  4J23 B;  1TP0 A;  4LO0 C;  2ZQO A;  4LO1 A;  4GP0 A;  1EV2 A;  4I0Y A;  5BQU A;  1JLY A;  1MD6 A;  3AKH A;  2MLL B;  3CA5 A;  1YYN A;  3P6J A;  3NJ5 A;  3N7K A;  2LIE A;  1PUU B;  1K5U A;  1SZ6 B;  2Q9X A;  3UJ0 A;  2X2S A;  2VUA A;  3AJ5 A;  3N7J A;  1N4K A;  2M49 A;  3V79 C;  4PC4 A;  1SR4 C;  1JTC A;  5BXT A;  1TOO A;  3AKG A;  4HJJ A;  3FJI A;  1ISW A;  1IOB A;  31BI A;  1FMM S;  1R8N A;  1S0C A;  3P6I A;  5DUY A;  3FJD A;  1MC9 A;  4LO3 C;  4GOY A;  4I37 A;  4XFS A;  5FZU A;  4ZFU B;  1PZZ A;  2D7I A;  1P63 A;  3N7L A;  1HWN B;  2E4M A;  5BXR A;  1IJT A;  3A07 A;  1BFB A;  1DJS B;  5BP5 A;  4LO7 B;  1V6X A;  2K4A B;  3UD9 A;  3IM6 A;  5FNW A;  1E0O A;  4F34 A;  1I1B A;  3Q7Y A;  2NM1 A;  2F2F C;  3UD8 A;  3RSJ A;  3VT0 A;  1BFG A;  3W9T A;  4OEG A;  1JT7 A;  3WIN A;  2VXT I;  3VSZ A;  4JKX B;  3V0A B;  3PHZ A;  4I4X A;  2FGF A;  4OW4 A;  3O49 A;  4I2S A;  2VXR A;  1HKN A;  4FGF A;  1DZC A;  2FFU A;  4EFR A;  4XFU A;  3FJC A;  3I2X A;  3QR5 A;  3FJA A;  1M16 A;  4QC4 A;  3HN1 A;  4END A;  4H9W A;  3PUB A;  1AVU A;  1Q04 A;  4P0L A;  4IY9 A;  3BAV A;  2DS0 A;  4IZX A;  3FJF A;  1YBI A;  1NUN A;  1Q03 A;  1YXW A;  3RMY A;  3O4A A;  5B2H A;  1VCL A;  4I4R A;  2NVH A;  1PUM B;  2XOA A;  4OEE A;  8I1B A;  4HA2 A;  3FJB A;  5JMC A;  1HCD A;  2KI4 A;  2Y9G A;  3MPP G;  1R8O A;  4QD2 C;  4D8H A;  1DZD A;  2ZQN A;  1S0E A;  3BAQ A;  3CA6 A;  2AQZ A;  1BFC A;  4P0K A;  2Y9F A;  4I4V A;  4QBC A;  4ZFW B;  3ZC8 A;  4LO0 A;  4J2X A;  4WBC A;  1AFC A;  5EG6 C;  3JUT A;  4A7K A;  3FJH A;  1T4Q A;  3BRF A;  4G9N A;  4ZLB B;  1ILR 1;  1S0L A;  2VSA A;  3WO4 A;  1W3G A;  3POK A;  1RZO B;  1XHB A;  3BA5 A;  1G9B A;  3BAH A;  3O3Q A;  4G6J A;  1S0F A;  1SR4 A;  1QXM A;  1QQL A;  4JPZ A;  4IYB A;  5D63 A;  3BAD A;  3BAO A;  3CU1 B;  1JT4 A;  1DFC A;  4Z9W B;  2KH2 A;  4LO3 A;  1QQK A;  4FVV A;  1WBC A;  1W3F A;  3WMV A;  5HPZ A;  1ONK B;  5I1B A;  4GAF A;  1BFF A;  2WRY A;  4I4U A;  1M2T B;  3H6R A;  4IHZ A;  1F31 A;  3CQA A;  3VT2 A;  2FFV A;  1Z2V A;  2P23 A;  4LO8 B;  1EPW A;  4IQP A;  4QO3 A;  3VWC A;  2RST A;  2L5X A;  1IIL A;  1FWV A;  2F2F A;  4H04 A;  4P6A A;  5EC5 A;  3AKF A;  2VSE A;  3FJK A;  1FWU A;  2GO2 A;  3QYD A;  2IWT B;  4J2Y A;  5BVP I;  1ITB A;  3LLP A;  4KEI A;  3RTI B;  1DFQ A;  4ZBV B;  1XYF A;  2MC2 A;  3VUO A;  4ZGR B;  1AVX B;  1L2H A;  4KEJ A;  4X38 A;  4USO A;  2Q3N B;  2NZ9 A;  2D23 A;  2HWM A;  1AVW B;  3O4B A;  3VSF A;  4A7Z A;  1IHK A;  1TTU A;  4J2K A;  3AH2 A;  3EF2 A;  3ILA A;  4JRA A;  2P39 A;  2BEB A;  2AAI B;  3FUQ A;  3OGG A;  5JLV A;  3RTJ B;  3CA3 A;  4P0J A;  2D7R A;  3CA1 A;  3S8K A;  4KEK A;  1V6V A;  2I1B A;  1FQ9 A;  1NZK A;  3I29 B;  2NTD A;  2X2T A;  2YUG A;  4JP0 A;  2QN4 A;  4L4H A;  1DIW A;  1W3A A;  4G6M A;  1G9D A;  2K8R A;  3OJ2 A;  1HWP B;  4IZE A;  1JT3 A;  2D1Z A;  2D24 A;  4OEF A;  4DCK C;  1IRP A;  5F8S A;  3AJ6 A;  4EEE B;  4QKR A;  3AKI A;  3BTA A;  4LO2 C;  3O44 A;  4ZA3 B;  3A21 A;  4GOV A;  3A22 A;  4LO7 C;  1DLL A;  3T8S A;  1FMZ A;  1G9A A;  4D0T A;  2Y9X E;  2Z48 A;  4A7Y A;  5FZY A;  2BFH A;  2D43 A;  3CAH A;  3V0B B;  1D0H A;  1XG6 A;  3FJ9 A;  3HOM A;  3ZC9 A;  2AFG A;  1TWM A;  4ISR A;  3IM5 A;  3F1R A;  4I4S A;  3BRG C;  3E8L C;  1YF8 B;  2NYY A;  1BLA A;  2BEA A;  3BA7 A;  3P53 A;  1IRA X;  1BA7 A;  2HW9 A;  2RG9 B;  4ISQ A;  3H6S E;  3AH1 A;  3CA0 A;  4EKX B;  1A8D A;  4Q9G A;  3Q7X A;  1XZZ A;  4EFP A;  1S0B A;  3OBT A;  4USP A;  1GGP B;  4I1B A;  2GZB A;  2D20 A;  3BX1 C;  3Q7W A;  1JY0 A;  1IT0 A;  3RMX A;  4JKQ A;  3BRD A;  2K43 A;  3WMU A;  3ZXG A;  3BAU A;  4I96 A;  4KC3 A;  4OWK A;  5DSS B;  1TWE A;  2D22 A;  3FJJ A;  3H6Q A;  1S0G A;  4EB2 B;  5DVH A;  5FZZ A;  1FV2 A;  1RML A;  1G82 A;  3UD7 A;  4ZFY B;  1V6U A;  5GAQ A;  5F90 A;  4QKS A;  5G00 A;  4QAL A;  2D44 A;  4I4Q A;  3IM7 A;  9ILB A;  3NBN A;  3F62 B;  4I4P A;  5D61 A;  3AZV A;  3BA4 A;  1HWO B;  4I4Y A;  2ET2 A;  3ZXD A;  4F83 A;  3O4D A;  3UJ4 A;  4AN6 A;  4GAI A;  3TC2 A;  2F8X C;  1JQZ A;  3S8J A;  4CJM A;  3R4U A;  1FN0 A;  2AXM A;  1HWM B;  4JAW A;  4I1E A;  2ESU A;  2ERM A;  1HCE A;  3N0K A;  1TIE A;  2Y9W C;  3ZX7 A;  4G9M A;  2Z49 A;  4D0Z A;  1PC8 B;  4I7I A;  1Q1U A;  3BAG A;  4LO1 C;  5BQU C;  2WBC A;  3R4S A;  7I1B A;  1TFM B;  1RY7 A;  3IIR A;  3LTQ A;  3WO2 A;  1CE7 B;  3OJM A;  1Z0H A;  4Z8S B;  3NBC A;  1PWA A;  3KMV A;  2LIQ A;  21BI A;  2VU9 A;  4LO2 A;  3K1X A;  2DRE A;  3AZW A;  4KBB A;  2FDB M;  4AN7 B;  1J0S A;  1II4 A;  4I4O A;  2KKI A;  2ZR1 B;  2DRY A;  5EHA A; 
#chains in the Genus database with same CATH topology
 5FNX A;  3CRG A;  3HBW A;  3NBD A;  4L4I A;  3JRR A;  5F8W A;  3UDA A;  2KLL A;  4J2S A;  2FO1 A;  4QD2 B;  1ISY A;  5BOW A;  4IY8 A;  2RQ9 A;  3V0A A;  6I1B A;  1EYL A;  3OGF A;  1ISZ A;  3NBE A;  3SNV A;  3N7M A;  1DQO A;  1JLX A;  2MIB A;  3O4O A;  4I6I A;  2E4M C;  3FUO A;  1BLD A;  3B9U A;  3CRI A;  4OUJ A;  1DQG A;  5BP5 C;  1WD4 A;  1V6W A;  4JQ0 A;  3FJE A;  4Q91 A;  1JT5 A;  3O5W B;  4ION A;  4II0 A;  1T9F A;  1YTO A;  3AH4 A;  3D7W B;  2QYI B;  2IHO A;  4G1R A;  4GP3 A;  4OWJ A;  3OBR A;  1FV3 A;  3WIN C;  2DRZ A;  5DZU A;  2UUS A;  3VT1 A;  4QBV A;  4X39 A;  5E24 E;  3WO3 A;  1BAS A;  4Q9P A;  1HIB A;  3C9Z A;  3IAG C;  4YOL A;  4X37 A;  4TLP A;  5BXS A;  4I8M A;  1Z4S A;  1KNM A;  4EFQ A;  1AXM A;  3OJV A;  1AVA C;  1S0D A;  3PME A;  4XKI A;  4HR6 C;  3MAL A;  3O4C A;  4X3A A;  4OWL A;  1WBA A;  1WD3 A;  3CRH A;  4XFT A;  1AF9 A;  4DEN A;  3V0B A;  3WA1 A;  3HSM A;  3FGM A;  5D62 A;  1K5V A;  3HAL A;  3VEQ A;  1FGA A;  3FFZ A;  1UPS A;  1RG8 A;  3PG0 A;  3A23 A;  4R6U B;  2HWA A;  2KI6 B;  1EVT A;  1BAR A;  2R9K B;  2VLC A;  1G9C A;  2HZ9 A;  5F8Y A;  3CA4 A;  2NP0 A;  3FJ8 A;  1I1E A;  1ISV A;  1ISX A;  4I3N A;  3I2A A;  1CVS A;  3H6R B;  3HMY A;  4DEP A;  4ZKT B;  3BB2 A;  5BXP A;  1ABR B;  4ZOT A;  41BI A;  2J3P A;  1OQL B;  4J23 B;  1TP0 A;  4LO0 C;  2ZQO A;  4LO1 A;  4GP0 A;  1EV2 A;  4I0Y A;  5BQU A;  1JLY A;  1MD6 A;  3AKH A;  2MLL B;  3CA5 A;  1YYN A;  3P6J A;  3NJ5 A;  3N7K A;  2LIE A;  1PUU B;  1K5U A;  1SZ6 B;  2Q9X A;  3UJ0 A;  2X2S A;  2VUA A;  3AJ5 A;  3N7J A;  1N4K A;  2M49 A;  3V79 C;  4PC4 A;  1SR4 C;  1JTC A;  5BXT A;  1TOO A;  3AKG A;  4HJJ A;  3FJI A;  1ISW A;  1IOB A;  31BI A;  1FMM S;  1R8N A;  1S0C A;  3P6I A;  5DUY A;  3FJD A;  1MC9 A;  4LO3 C;  4GOY A;  4I37 A;  4XFS A;  5FZU A;  4ZFU B;  1PZZ A;  2D7I A;  1P63 A;  3N7L A;  1HWN B;  2E4M A;  5BXR A;  1IJT A;  3A07 A;  1BFB A;  1DJS B;  5BP5 A;  4LO7 B;  1V6X A;  2K4A B;  3UD9 A;  3IM6 A;  5FNW A;  1E0O A;  4F34 A;  1I1B A;  3Q7Y A;  2NM1 A;  2F2F C;  3UD8 A;  3RSJ A;  3VT0 A;  1BFG A;  3W9T A;  4OEG A;  1JT7 A;  3WIN A;  2VXT I;  3VSZ A;  4JKX B;  3V0A B;  3PHZ A;  4I4X A;  2FGF A;  4OW4 A;  3O49 A;  4I2S A;  2VXR A;  1HKN A;  4FGF A;  1DZC A;  2FFU A;  4EFR A;  4XFU A;  3FJC A;  4UY4 A;  3I2X A;  3QR5 A;  3FJA A;  1M16 A;  4QC4 A;  3HN1 A;  4END A;  4H9W A;  3PUB A;  1AVU A;  4MZF B;  1Q04 A;  4P0L A;  4IY9 A;  3BAV A;  2DS0 A;  4IZX A;  3FJF A;  1YBI A;  1NUN A;  1Q03 A;  1YXW A;  3RMY A;  3O4A A;  5B2H A;  1VCL A;  4I4R A;  2NVH A;  1PUM B;  2XOA A;  4OEE A;  8I1B A;  4HA2 A;  3FJB A;  5JMC A;  1HCD A;  2KI4 A;  2Y9G A;  3MPP G;  1R8O A;  4QD2 C;  4D8H A;  1DZD A;  2NS2 A;  2ZQN A;  1S0E A;  3BAQ A;  3CA6 A;  2AQZ A;  1BFC A;  4P0K A;  2Y9F A;  4I4V A;  4QBC A;  4ZFW B;  3ZC8 A;  4LO0 A;  4J2X A;  4WBC A;  1AFC A;  5EG6 C;  3JUT A;  4A7K A;  3FJH A;  1T4Q A;  3BRF A;  4G9N A;  4ZLB B;  1ILR 1;  1S0L A;  2VSA A;  3WO4 A;  1W3G A;  3POK A;  1RZO B;  1XHB A;  3BA5 A;  1G9B A;  3BAH A;  3O3Q A;  4G6J A;  1S0F A;  1SR4 A;  1QXM A;  1QQL A;  4JPZ A;  4IYB A;  5D63 A;  3BAD A;  3BAO A;  3CU1 B;  1JT4 A;  1DFC A;  4Z9W B;  2KH2 A;  4LO3 A;  1QQK A;  4FVV A;  1WBC A;  1W3F A;  3WMV A;  5HPZ A;  1ONK B;  5I1B A;  4GAF A;  1BFF A;  2WRY A;  4I4U A;  1M2T B;  3H6R A;  4IHZ A;  1F31 A;  3CQA A;  3VT2 A;  2FFV A;  1Z2V A;  2P23 A;  4LO8 B;  1EPW A;  4IQP A;  4QO3 A;  3VWC A;  2RST A;  2L5X A;  1IIL A;  1FWV A;  2F2F A;  4H04 A;  4P6A A;  5EC5 A;  3AKF A;  2VSE A;  3FJK A;  1FWU A;  2GO2 A;  3QYD A;  2IWT B;  4J2Y A;  5BVP I;  4MZG B;  1ITB A;  3LLP A;  4KEI A;  3RTI B;  1DFQ A;  4ZBV B;  1XYF A;  2MC2 A;  3VUO A;  4ZGR B;  1AVX B;  1L2H A;  4KEJ A;  4X38 A;  4USO A;  2Q3N B;  2NZ9 A;  2D23 A;  2HWM A;  1AVW B;  3O4B A;  3VSF A;  4A7Z A;  1IHK A;  1TTU A;  4J2K A;  3AH2 A;  3EF2 A;  3ILA A;  4JRA A;  2P39 A;  2BEB A;  2AAI B;  3FUQ A;  3OGG A;  5JLV A;  4H75 A;  3RTJ B;  3CA3 A;  4P0J A;  2D7R A;  3CA1 A;  3S8K A;  4KEK A;  1V6V A;  2I1B A;  1FQ9 A;  1NZK A;  3I29 B;  2NTD A;  2X2T A;  2YUG A;  4JP0 A;  2QN4 A;  4L4H A;  1DIW A;  1W3A A;  4G6M A;  1G9D A;  2K8R A;  3OJ2 A;  1HWP B;  4IZE A;  1JT3 A;  2D1Z A;  2D24 A;  4OEF A;  4DCK C;  1IRP A;  5F8S A;  3AJ6 A;  4EEE B;  4QKR A;  3AKI A;  3BTA A;  4LO2 C;  3O44 A;  4ZA3 B;  3A21 A;  4GOV A;  3A22 A;  4LO7 C;  1DLL A;  3T8S A;  1FMZ A;  1G9A A;  4D0T A;  2Y9X E;  2Z48 A;  4A7Y A;  5FZY A;  2BFH A;  2D43 A;  3CAH A;  3V0B B;  1D0H A;  1XG6 A;  3FJ9 A;  3HOM A;  3ZC9 A;  2AFG A;  1TWM A;  4ISR A;  3IM5 A;  3F1R A;  4I4S A;  3BRG C;  3E8L C;  1YF8 B;  2NYY A;  1BLA A;  2BEA A;  3BA7 A;  3P53 A;  1IRA X;  1BA7 A;  2HW9 A;  2RG9 B;  4ISQ A;  3H6S E;  3AH1 A;  3CA0 A;  4EKX B;  1A8D A;  4Q9G A;  3Q7X A;  1XZZ A;  4EFP A;  1S0B A;  3OBT A;  4USP A;  1GGP B;  4I1B A;  2GZB A;  2D20 A;  3BX1 C;  3Q7W A;  1JY0 A;  1IT0 A;  3RMX A;  4JKQ A;  3BRD A;  2K43 A;  3WMU A;  3ZXG A;  3BAU A;  4I96 A;  4KC3 A;  4OWK A;  5DSS B;  1TWE A;  2D22 A;  3FJJ A;  3H6Q A;  1S0G A;  4EB2 B;  5DVH A;  5FZZ A;  1FV2 A;  1RML A;  1G82 A;  3UD7 A;  4ZFY B;  1V6U A;  5GAQ A;  5F90 A;  4MZH A;  4QKS A;  5G00 A;  4QAL A;  2D44 A;  4I4Q A;  3IM7 A;  9ILB A;  3NBN A;  3F62 B;  4I4P A;  5D61 A;  3AZV A;  3BA4 A;  1HWO B;  4I4Y A;  2ET2 A;  3ZXD A;  4F83 A;  3O4D A;  3UJ4 A;  4AN6 A;  4GAI A;  3TC2 A;  2F8X C;  1JQZ A;  3S8J A;  4CJM A;  3R4U A;  1FN0 A;  2AXM A;  1HWM B;  4JAW A;  4I1E A;  2ESU A;  2ERM A;  1HCE A;  3N0K A;  1TIE A;  2Y9W C;  3ZX7 A;  4G9M A;  2Z49 A;  4D0Z A;  1PC8 B;  4I7I A;  1Q1U A;  3BAG A;  4LO1 C;  5BQU C;  2WBC A;  3R4S A;  7I1B A;  1TFM B;  1RY7 A;  3IIR A;  3LTQ A;  3WO2 A;  1CE7 B;  3OJM A;  1Z0H A;  4Z8S B;  3NBC A;  1PWA A;  3KMV A;  2LIQ A;  21BI A;  2VU9 A;  4LO2 A;  3K1X A;  2DRE A;  3AZW A;  4KBB A;  2FDB M;  4AN7 B;  1J0S A;  1II4 A;  4I4O A;  2KKI A;  2ZR1 B;  2DRY A;  5EHA A; 
#chains in the Genus database with same CATH homology
 5FNX A;  3CRG A;  3HBW A;  3NBD A;  4L4I A;  3JRR A;  5F8W A;  3UDA A;  2KLL A;  4J2S A;  2FO1 A;  4QD2 B;  1ISY A;  5BOW A;  4IY8 A;  2RQ9 A;  3V0A A;  6I1B A;  1EYL A;  3OGF A;  1ISZ A;  3NBE A;  3SNV A;  3N7M A;  1DQO A;  1JLX A;  2MIB A;  3O4O A;  4I6I A;  2E4M C;  3FUO A;  1BLD A;  3B9U A;  3CRI A;  4OUJ A;  1DQG A;  5BP5 C;  1WD4 A;  1V6W A;  4JQ0 A;  3FJE A;  4Q91 A;  1JT5 A;  3O5W B;  4ION A;  4II0 A;  1T9F A;  1YTO A;  3AH4 A;  3D7W B;  2QYI B;  2IHO A;  4G1R A;  4GP3 A;  4OWJ A;  3OBR A;  1FV3 A;  3WIN C;  2DRZ A;  5DZU A;  2UUS A;  3VT1 A;  4QBV A;  4X39 A;  5E24 E;  3WO3 A;  1BAS A;  4Q9P A;  1HIB A;  3C9Z A;  3IAG C;  4YOL A;  4X37 A;  4TLP A;  5BXS A;  4I8M A;  1Z4S A;  1KNM A;  4EFQ A;  1AXM A;  3OJV A;  1AVA C;  1S0D A;  3PME A;  4XKI A;  4HR6 C;  3MAL A;  3O4C A;  4X3A A;  4OWL A;  1WBA A;  1WD3 A;  3CRH A;  4XFT A;  1AF9 A;  4DEN A;  3V0B A;  3WA1 A;  3HSM A;  3FGM A;  5D62 A;  1K5V A;  3HAL A;  3VEQ A;  1FGA A;  3FFZ A;  1UPS A;  1RG8 A;  3PG0 A;  3A23 A;  4R6U B;  2HWA A;  2KI6 B;  1EVT A;  1BAR A;  2R9K B;  2VLC A;  1G9C A;  2HZ9 A;  5F8Y A;  3CA4 A;  2NP0 A;  3FJ8 A;  1I1E A;  1ISV A;  1ISX A;  4I3N A;  3I2A A;  1CVS A;  3H6R B;  3HMY A;  4DEP A;  4ZKT B;  3BB2 A;  5BXP A;  1ABR B;  4ZOT A;  41BI A;  2J3P A;  1OQL B;  4J23 B;  1TP0 A;  4LO0 C;  2ZQO A;  4LO1 A;  4GP0 A;  1EV2 A;  4I0Y A;  5BQU A;  1JLY A;  1MD6 A;  3AKH A;  2MLL B;  3CA5 A;  1YYN A;  3P6J A;  3NJ5 A;  3N7K A;  2LIE A;  1PUU B;  1K5U A;  1SZ6 B;  2Q9X A;  3UJ0 A;  2X2S A;  2VUA A;  3AJ5 A;  3N7J A;  1N4K A;  2M49 A;  3V79 C;  4PC4 A;  1SR4 C;  1JTC A;  5BXT A;  1TOO A;  3AKG A;  4HJJ A;  3FJI A;  1ISW A;  1IOB A;  31BI A;  1FMM S;  1R8N A;  1S0C A;  3P6I A;  5DUY A;  3FJD A;  1MC9 A;  4LO3 C;  4GOY A;  4I37 A;  4XFS A;  5FZU A;  4ZFU B;  1PZZ A;  2D7I A;  1P63 A;  3N7L A;  1HWN B;  2E4M A;  5BXR A;  1IJT A;  3A07 A;  1BFB A;  1DJS B;  5BP5 A;  4LO7 B;  1V6X A;  2K4A B;  3UD9 A;  3IM6 A;  5FNW A;  1E0O A;  4F34 A;  1I1B A;  3Q7Y A;  2NM1 A;  2F2F C;  3UD8 A;  3RSJ A;  3VT0 A;  1BFG A;  3W9T A;  4OEG A;  1JT7 A;  3WIN A;  2VXT I;  3VSZ A;  4JKX B;  3V0A B;  3PHZ A;  4I4X A;  2FGF A;  4OW4 A;  3O49 A;  4I2S A;  2VXR A;  1HKN A;  4FGF A;  1DZC A;  2FFU A;  4EFR A;  4XFU A;  3FJC A;  4UY4 A;  3I2X A;  3QR5 A;  3FJA A;  1M16 A;  4QC4 A;  3HN1 A;  4END A;  4H9W A;  3PUB A;  1AVU A;  4MZF B;  1Q04 A;  4P0L A;  4IY9 A;  3BAV A;  2DS0 A;  4IZX A;  3FJF A;  1YBI A;  1NUN A;  1Q03 A;  1YXW A;  3RMY A;  3O4A A;  5B2H A;  1VCL A;  4I4R A;  2NVH A;  1PUM B;  2XOA A;  4OEE A;  8I1B A;  4HA2 A;  3FJB A;  5JMC A;  1HCD A;  2KI4 A;  2Y9G A;  3MPP G;  1R8O A;  4QD2 C;  4D8H A;  1DZD A;  2NS2 A;  2ZQN A;  1S0E A;  3BAQ A;  3CA6 A;  2AQZ A;  1BFC A;  4P0K A;  2Y9F A;  4I4V A;  4QBC A;  4ZFW B;  3ZC8 A;  4LO0 A;  4J2X A;  4WBC A;  1AFC A;  5EG6 C;  3JUT A;  4A7K A;  3FJH A;  1T4Q A;  3BRF A;  4G9N A;  4ZLB B;  1ILR 1;  1S0L A;  2VSA A;  3WO4 A;  1W3G A;  3POK A;  1RZO B;  1XHB A;  3BA5 A;  1G9B A;  3BAH A;  3O3Q A;  4G6J A;  1S0F A;  1SR4 A;  1QXM A;  1QQL A;  4JPZ A;  4IYB A;  5D63 A;  3BAD A;  3BAO A;  3CU1 B;  1JT4 A;  1DFC A;  4Z9W B;  2KH2 A;  4LO3 A;  1QQK A;  4FVV A;  1WBC A;  1W3F A;  3WMV A;  5HPZ A;  1ONK B;  5I1B A;  4GAF A;  1BFF A;  2WRY A;  4I4U A;  1M2T B;  3H6R A;  4IHZ A;  1F31 A;  3CQA A;  3VT2 A;  2FFV A;  1Z2V A;  2P23 A;  4LO8 B;  1EPW A;  4IQP A;  4QO3 A;  3VWC A;  2RST A;  2L5X A;  1IIL A;  1FWV A;  2F2F A;  4H04 A;  4P6A A;  5EC5 A;  3AKF A;  2VSE A;  3FJK A;  1FWU A;  2GO2 A;  3QYD A;  2IWT B;  4J2Y A;  5BVP I;  4MZG B;  1ITB A;  3LLP A;  4KEI A;  3RTI B;  1DFQ A;  4ZBV B;  1XYF A;  2MC2 A;  3VUO A;  4ZGR B;  1AVX B;  1L2H A;  4KEJ A;  4X38 A;  4USO A;  2Q3N B;  2NZ9 A;  2D23 A;  2HWM A;  1AVW B;  3O4B A;  3VSF A;  4A7Z A;  1IHK A;  1TTU A;  4J2K A;  3AH2 A;  3EF2 A;  3ILA A;  4JRA A;  2P39 A;  2BEB A;  2AAI B;  3FUQ A;  3OGG A;  5JLV A;  4H75 A;  3RTJ B;  3CA3 A;  4P0J A;  2D7R A;  3CA1 A;  3S8K A;  4KEK A;  1V6V A;  2I1B A;  1FQ9 A;  1NZK A;  3I29 B;  2NTD A;  2X2T A;  2YUG A;  4JP0 A;  2QN4 A;  4L4H A;  1DIW A;  1W3A A;  4G6M A;  1G9D A;  2K8R A;  3OJ2 A;  1HWP B;  4IZE A;  1JT3 A;  2D1Z A;  2D24 A;  4OEF A;  4DCK C;  1IRP A;  5F8S A;  3AJ6 A;  4EEE B;  4QKR A;  3AKI A;  3BTA A;  4LO2 C;  3O44 A;  4ZA3 B;  3A21 A;  4GOV A;  3A22 A;  4LO7 C;  1DLL A;  3T8S A;  1FMZ A;  1G9A A;  4D0T A;  2Y9X E;  2Z48 A;  4A7Y A;  5FZY A;  2BFH A;  2D43 A;  3CAH A;  3V0B B;  1D0H A;  1XG6 A;  3FJ9 A;  3HOM A;  3ZC9 A;  2AFG A;  1TWM A;  4ISR A;  3IM5 A;  3F1R A;  4I4S A;  3BRG C;  3E8L C;  1YF8 B;  2NYY A;  1BLA A;  2BEA A;  3BA7 A;  3P53 A;  1IRA X;  1BA7 A;  2HW9 A;  2RG9 B;  4ISQ A;  3H6S E;  3AH1 A;  3CA0 A;  4EKX B;  1A8D A;  4Q9G A;  3Q7X A;  1XZZ A;  4EFP A;  1S0B A;  3OBT A;  4USP A;  1GGP B;  4I1B A;  2GZB A;  2D20 A;  3BX1 C;  3Q7W A;  1JY0 A;  1IT0 A;  3RMX A;  4JKQ A;  3BRD A;  2K43 A;  3WMU A;  3ZXG A;  3BAU A;  4I96 A;  4KC3 A;  4OWK A;  5DSS B;  1TWE A;  2D22 A;  3FJJ A;  3H6Q A;  1S0G A;  4EB2 B;  5DVH A;  5FZZ A;  1FV2 A;  1RML A;  1G82 A;  3UD7 A;  4ZFY B;  1V6U A;  5GAQ A;  5F90 A;  4MZH A;  4QKS A;  5G00 A;  4QAL A;  2D44 A;  4I4Q A;  3IM7 A;  9ILB A;  3NBN A;  3F62 B;  4I4P A;  5D61 A;  3AZV A;  3BA4 A;  1HWO B;  4I4Y A;  2ET2 A;  3ZXD A;  4F83 A;  3O4D A;  3UJ4 A;  4AN6 A;  4GAI A;  3TC2 A;  2F8X C;  1JQZ A;  3S8J A;  4CJM A;  3R4U A;  1FN0 A;  2AXM A;  1HWM B;  4JAW A;  4I1E A;  2ESU A;  2ERM A;  1HCE A;  3N0K A;  1TIE A;  2Y9W C;  3ZX7 A;  4G9M A;  2Z49 A;  4D0Z A;  1PC8 B;  4I7I A;  1Q1U A;  3BAG A;  4LO1 C;  5BQU C;  2WBC A;  3R4S A;  7I1B A;  1TFM B;  1RY7 A;  3IIR A;  3LTQ A;  3WO2 A;  1CE7 B;  3OJM A;  1Z0H A;  4Z8S B;  3NBC A;  1PWA A;  3KMV A;  2LIQ A;  21BI A;  2VU9 A;  4LO2 A;  3K1X A;  2DRE A;  3AZW A;  4KBB A;  2FDB M;  4AN7 B;  1J0S A;  1II4 A;  4I4O A;  2KKI A;  2ZR1 B;  2DRY A;  5EHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...