1BBDL

Three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
219
Chain Sequence
b'DIVMTQSPSSLTVTTGEKVTMTCKSSQSLLNSRTQKNYLTWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQNNYNYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 8F5 FAB (LIGHT CHAIN)
molecule tags Immunoglobulin
source organism Mus musculus
publication title Three-dimensional structure of the Fab fragment of a neutralizing antibody to human rhinovirus serotype 2.
pubmed rcsb
total genus 51
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1992-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bbdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bbdL01
1U8MA 5I8CB 4JM2C 5KTEL 4YHLH 1FO0B 4M7KH 5EU5A 3L3DA 2CDFB 3RUGE 1JHLL 3BP6B 2ZCLH 1U8NB 2GJZA 1E0OB 2Z31B 5T3ZL 1J1XL 5JXED 4QCIB 1J87A 43C9B 3I6LE 1YY8B 3L7FB 3LN9A 4HUWB 4I0CC 5E7FA 2EC8A 1UVQA 4L5FL 3S36L 2W9DH 5F9AC 1NBZB 1FIGL 4G8FB 3FT4A 3QUXC 5DHXB 2H2SD 1A14L 4HS8L 3UYRL 4XAKD 1D7FA 3QISA 2AXGB 4P9MH 5IMOB 4XPHH 4E5XB 5DT1L 4PLJC 4P4KB 4OD3H 1T1YB 4TSAH 3LN5B 5ETUB 3RAJH 3T0AA 2A74B 1ZT1A 4K3EH 4LASL 4S1RH 1KG0B 2X4TA 5IVXE 1G9NH 2YPLD 3K46A 4TSBH 2QV2A 5D4QA 5JOFB 4GH7B 5F1IB 4U3XA 1QHOA 4XZUB 1ZHLA 1EFXD 1MJ7H 3LKOA 5D93B 1FFNB 1YNLL 2C26A 4TTDD 4XXDA 4HXBL 3ZDXE 1LO5B 1B9ZA 1GC1C 1S7RB 2X05A 4D0BB 2APFA 2X1OA 4XP1H 4JDTL 1IEAA 5J1TC 4WVRA 3GI8H 4HJJL 1KJVB 1I1AA 1S7XB 5K59F 2ESVB 1DN0A 4JKPL 1KBGL 1P9MA 3TT1H 2LU4A 1CLOH 3N1QC 4JO1H 5IK3A 2ZUQB 3JTTB 3MRIA 5IEHA 1TJGL 2I27N 1BVKB 4P57A 5HHNA 3C60C 1MCKA 3O11B 4R3SB 2F19H 3ZE0E 2OCFD 1LD9A 2DD8H 3QQ9D 2QHRH 1INQB 3C09B 1FL5A 1MCIA 1CE1L 2JCCA 5TQ0H 2BVPA 3O6MH 3CX5K 1JF1A 2ADFH 2JJTA 4MA7H 3V8OA 5BZDA 4KUZH 2PTTB 3LPGA 5TGBB 2P44B 1LO4H 4R96A 2AJSH 5DVKA 1PYWA 4QF1A 4EQ2A 5L2JB 5DD0H 3OAUL 2M8XA 4UIKL 1T0NA 5J3HC 2NXYC 5E9DA 5EZJA 1CQYA 1HXMA 4QYOA 1JI1A 1J1OL 2PF6A 1F4YL 4PS4H 4IOIB 1FRGH 3MGOB 4MD0B 4NFDA 4XCYA 2NQCA 5ESVA 3VXSE 3MLUH 4NO5B 5CS7A 1ADQA 4GBXB 5KS9F 1YUHA 2Q20A 1F90H 1TZHA 4M6AA 3VXSD 2BOBB 2AJYH 2LTQB 4PJEA 5I75B 4J8RA 2GI7A 3PDOA 1T0MB 4JO1L 5AAMA 1QBLH 2DWEA 4HBCH 3FOLB 1OM3L 4ZPTA 4R7NA 4WHYH 2NX5D 3NN8B 1MPAH 5IB2A 3RPIA 5I30H 4JLRA 4O4YL 2VITB 2P8MB 1GXEA 4RDQG 1PY4A 4K23H 2D31A 3CSPA 4ZUUB 4WUKL 4LSRH 5JXAL 3TBVA 5B22A 3RA7L 1XF4A 1OSZB 2VAAA 1AIFB 4U1IA 2EE2A 2VXUH 2V7NB 4EDWH 1QRNE 5I1KL 3CLFL 1WFTA 3QUZB 2AJZB 4OF6A 1HSBA 1NBQA 1ZKAA 4RFOL 4NQED 4TYUA 1XAUA 1DUYB 3D3VE 5KSVB 4PJ9B 1X5XA 4XC3L 4OT1H 1ORSA 3O3EB 4JKKA 4WFGE 3KJ6L 1I7UB 2DTSA 4NC1E 5FECA 2M26A 3KLAA 2VO5A 4N1CA 4P48A 2VLJE 1EH9A 3Q5YA 1RJCA 5C70A 4P3WA 3DXAB 1R3LA 2O5XL 4NO3B 4ETYA 2R0KL 3B4NA 5HI3D 5DMJB 2AEQL 3X17A 3W11C 2X4NA 5FOJA 5CBAB 4KTDH 1FYTE 1CE6B 1MCWW 3T0VA 2X4UB 3ABZA 4HH8A 1YNTB 4Q9QH 3S4SB 4M1GL 4Y4FD 3QUMB 3ZKMD 1NGZA 4JFEA 2GFBB 4U7MA 3VXRD 1WT5A 1K3ZA 3FO9A 4K8RD 4XBPB 3U0TB 1MHHA 2WMPA 4X6EB 1A7QL 2FO4B 4P5TC 3H9HA 3UX9B 1QFOA 4AEHH 3MRPA 5FYJH 5BVPL 5HHXL 4HUWA 1IAIL 4HPOL 4X8JB 5I9QC 3JVGC 4XMLH 2GSIA 3QXDB 1KPRB 1NC4D 2XN9A 3MFGB 3N85L 4MJID 4N0CD 1FGVH 2C5DC 4RWYH 5D7JC 1XF5B 5L0QC 5JUEL 1QFWL 2NY1C 2YPKB 1MCDA 4YHYC 2UVFA 3UAJC 4P5TB 4HZAA 1ZA3B 1NCWL 3LN5A 2OTPA 5GS0C 3MRGA 3HA0A 1I1AC 5GGQL 3QNZB 1XR9B 3HHRB 1I9EA 2R39A 1IEBB 2A1WL 3IAPA 2W07A 5F9OH 4IOSD 1UGNA 1WGOA 1JZ7A 3I9GL 3TPKA 1JCKA 4U1KB 4MZ2A 4PJIE 2VR4A 4KHTL 2E9WA 4Y7MA 1M71B 3FB7B 3IXTA 2DQDL 1BIIA 5KSBF 3VXPB 3I02A 1ZLVK 4X6CE 1QLFB 4YIQB 3I6GA 3EKCA 1CBVH 3QO0A 2EE9A 2R15A 5F7DB 3UJJL 4O2EB 3U4BH 3BEVB 5D1XC 1ES0B 1AP2B 1DJSA 3QIUC 3L7EA 3UTPE 1QNZL 3D25A 5LXGH 1JNLH 2VUYA 5F72S 5DJAB 1YMHA 5FKPA 1Q8MA 3VGFA 4LCIL 4MD5A 4Q9CA 3RTQC 3O11A 1NLBH 1T2JA 5I17A 2B39A 1I1YA 4G6MH 2EICA 2QQQA 1UQSA 5DMIL 1QSFA 4Z7QE 4Z7QF 1MIML 1QSED 3OKDA 4LF3A 4M02A 5TH2B 3V95A 3VFTB 4OQTA 3ARFA 9CGTA 5CZXD 4BKLA 1KJMB 2PW2A 3HE6D 4MA7L 1Q9WA 4UUJA 3VI4E 4ZTOH 3VFPB 2W1NA 1LWRA 2W0KA 3CFKB 4LGSB 1OAUH 1YUHB 4KMTH 2OYPA 3OKMB 3QRGH 5HDBE 3LRHA 3UTZB 3ESVF 2X70B 1FVEA 1NGXB 2HLFD 3AXLB 3EFDL 2FB4H 3NN8A 3QA3B 2KPNA 3NCJH 5GGVY 4E0RB 4RFNB 1I4FA 3A6BH 3QHFL 3VXUB 43CAB 3S96B 3C6LC 3BGFC 2XOTA 3P4NB 1F3DH 1OSZA 1H8NA 2FDBP 3ROLA 3SY0A 3V4VL 3WLWD 3WFZA 4HFWB 3MR9B 4UQ3B 3TWCH 5H94A 3SOBL 5CSZB 3BKCH 3U79A 3C08H 4IMLA 3EOBA 3QUZA 5JDJA 5LGHH 2OR7A 3AY4A 5KVGL 5D7KE 1QPXA 2E27H 5FGSA 3VXOB 3QG7L 4H25B 1OSPH 4HS8H 3LEXA 5F70A 4OZFA 5IVOA 3QXWA 1I8LC 1FYTB 2EDNA 2ZJSL 4O5LH 3RKPA 4Y2OA 3D1MC 4FQIL 3TA3C 4J6RH 3GFUA 3CFCL 3WJLA 3PQYE 4WO4D 5C0AA 1JWSB 3D85D 4MJ4A 2ZUUA 3FO0H 1CE6A 2ZUYA 5DQDH 4ONFL 3RBGA 1RUQH 1QG3A 2EDYA 3MV8E 3N0PB 2PXYC 4QTIL 3OXSA 5ESQA 2VZSA 5HSFA 4JO2H 3HMXH 1KYOK 3IDJA 1MHHB 4G43A 1QRNA 4IRSD 4WW2C 1I9IH 2YA0A 3FRUB 3T3ME 4JJHA 4QRRA 3HC4L 3V6BR 3N1FC 4YC2C 4HV8A 4YBHA 1D5MB 1QO3A 1DFBH 5CCKL 4PJFE 1Q9LB 4HF5H 1X7QB 1DLFH 4LU5H 1YN7B 1ZT4A 3DBXA 1OLLA 4KMLB 3I50L 3GK8L 1X5IA 4N8CL 5AYUH 5FDWA 2X4SA 3DX6B 4IDLA 1DSFL 2F9BT 5KSBA 1HIMH 2VN4A 2Y5TA 3BISA 1NGYB 1FZJB 4G8GE 2J6EA 1OP3H 4DOHB 3SDYH 5T1LB 2YN5A 5KVMC 5HVGB 1FAIL 1CI5A 1XR9A 2PW1A 2ZNXA 3HAEG 25C8H 3JZ7A 3E6HA 2WSKA 5FA3A 4P59L 4G9FB 2Y06H 3CFBB 4U1KA 3V6OC 1XF2A 2IJ0C 2LABA 1AE6H 2B4CL 4AJ0A 2OTUA 3OJDB 3MNWA 4M7LH 1P7QD 4MA8L 1RFDL 4JLRB 4LVHB 1HILB 2DB8A 1IMHC 3PGFH 2J1KA 1U3ZA 3HI5H 2K7QA 3IRZA 3BI9X 3L7EB 1BLNB 1GL4B 2DQDH 3D25B 5DEFA 5DRNA 1NFIB 3K2UH 4FQ1H 4QHKI 1R24A 3Q5OA 4ZSOB 5ILTH 3FOMA 5B3NA 3PWVA 2CK2A 4MD4B 1BF2A 3R1GL 3EDKA 2WUBH 1MWAA 4GUPA 2EC9U 3SDXE 1UQSB 5K9JH 2JJWA 5F71A 1UB5B 5DQ9B 3QP3A 4GFTB 5D7LD 5DLML 1TZIA 5I1KH 1NSNL 1P2CB 5IHBA 2PW2B 2XA8L 3SPVB 4Z9KB 4M7LT 3O2VH 5I18H 3MACH 4AL8H 4N0YH 3PGFL 4FABH 4LIQE 3ETBF 4OCSH 2GFBA 5DFVC 4ZFGL 3VI3F 4XBPA 1N0LA 5F88B 4ACPA 5CCKH 5F89A 3C6SA 3QA3A 2ITCB 1HH6B 1L9MA 1I8IA 2V2XB 3QJFA 1OGTA 4X8JA 4NPYB 2IGFL 1Q0XL 4N1HB 1YEFL 1U3HC 1FZKB 2YWYA 4X9IA 3MRMB 3FHQA 4JQXC 2KL6A 1NBYB 1FYHB 1S7VA 4JFHE 5D9SA 4JHWL 5ACMA 4HFWA 3L5XH 1IARB 1HQRB 3IJYA 4KXZI 2IEPA 4O2CA 3KPMA 3LAFA 3KYOB 2LAAA 3FB5B 2BX5A 4NN5C 3MLXH 1MNUH 1WT5C 1RQ5A 4P23D 4X7EC 3KLHC 5C6PB 1OHQA 1UB6A 2YUWA 2DQIL 1ZHNB 4BFIA 2XWJB 4ZO7A 3OAYH 3G04B 5ITBL 1BIIB 2UWEF 5C3TA 4JANA 4WHCA 3MREB 4F33A 4OCMC 5GGSA 3QO0B 4DN3H 1S7UB 3E8UL 5KVEH 3WIIL 2ZUSA 4OZFG 3FFDA 3HMWH 1IAKB 1I7RA 3BP4B 4PJDB 1AP2A 5TF1H 3RWDA 4LBEA 1CVRA 2J2ZA 1J5OH 1PKQA 3O3DB 4YE4L 1D3CA 4FQLH 3C5JB 2NPLX 3U9PL 4WI3A 3HCVA 3RWHA 5DJ0B 4DUVA 3QEHB 3DOSA 5A2LH 3DUHA 3MLXL 4PJDE 1FRGL 1WIPA 2NY6B 2ZG1A 4X4ME 3RWJB 1DFBL 2YR3A 2P7TB 4IRSB 2MPAH 1S78D 5EZIL 2A6DA 3VXUE 4NJ9H 3N06B 4OGAC 2VZ3A 5D2LB 5FYLD 4M00A 1MCWM 3H9SE 5JHLL 3MLTA 4WHTB 3GBNH 12E8L 1UYWL 4UBDD 5CZVH 4NKMB 1TNNA 3BHBA 2WBWB 2V9TA 4XBEL 4LK4A 5HYSB 4PTUB 2F54B 5C0JA 4LSSL 1TENA 1IM3B 3KLHD 3C5ZC 5IM7A 2VC2H 1KB9J 2Z92A 4X6DE 5L88L 1AGDA 4YXKL 5GZNC 1EFXA 5CINH 2DF3A 2EDEA 2DLFH 2QBWA 1YYML 3TBTB 3QT2A 4L29A 1AO7A 4E0RA 1NC4B 3NCBB 5D5ME 2R1YB 2AV1B 2QR0A 3EGSB 4OCWL 1DQDH 1OAUL 1PSKH 2BFVL 3P0YL 1FH5H 5BXFA 4KDWA 2D0HA 5GS0H 1JGDA 1VEPA 1Z0MA 5F9WB 4CVZB 1XGPA 4PRPE 3LKPA 3RY6C 3RNQA 3VFNB 3W9DB 3HNVL 4Y1AD 1U93B 2Q87A 4NRYA 3QDMD 1F4WH 2VDLL 3T2PA 2GJ6A 4G9DB 5DD1L 1MLCA 1MWAB 1KN4L 2AEPL 1LMKA 4OLEA 3FL7A 1X5LA 2XZAL 3R1GH 3OGCA 3MRQB 3PL6D 1IQDB 2GK2A 4YHKL 4MA1C 1UCBL 5DJXA 5EORH 5FUZL 4GKSA 1MVFA 3F5WB 3KPRE 2I9TB 5DZOA 5GGRB 3JWOC 3G5ZB 5C0BD 4X5XB 2IWGA 3TN0B 1N3NB 1FYTD 4JQXA 2W9DL 3OX8B 3U30C 2FX8L 5E95B 1U9KA 4JFFA 4M6NH 2R0KH 2BCKA 1AH1A 4ZDHB 3T4YA 4X6DF 2YPVL 4FQ2L 4I3GA 3T0ED 1KJ2B 3VU2A 4AH2B 5F3BB 4LHUG 2RR3A 1C1EL 2VNCA 3IU4L 1HZHH 5CJQH 4DN4H 4PYGA 5I16B 2BXYA 1YN7A 3DUSA 1CZ8H 1G7IB 1ZHBB 4EOWL 3MODL 3UP1A 4PJXA 3MXVL 4ONGH 2MQ3A 2Y5TB 3D9AH 2ZG2A 2XZQH 4YC2B 1WFNA 4TTDC 5AEAA 3TJHC 1HQRA 1JPTH 4YFLF 2DQFA 5CZXC 4HKZB 3KPMB 1FGVL 1UC6A 3O8XD 4DW2L 3GB7A 2VQ1B 3LB6D 1Z9OA 4FQQA 5JXEA 1RZ7L 1CBVL 3OKEB 1S7TB 3V6OE 3OXRB 1RURH 3HR5A 4M43L 4X5WA 1UH4A 1U3YA 3AY4C 4OM0L 4XI5D 1HSAA 4FMFA 3ILQC 4EBQH 4PRHA 4KJQD 4G8EB 5DJYA 5EU7C 3SDDA 4P23B 1T80A 4FFWC 2FH6A 2Y5EA 3MCKB 3LD8C 3DV4A 1D6VL 5FYLL 2BHUA 2ZSWA 1TJHH 1NFIA 4U2ZA 1BHGA 4HKBA 3ALPA 2GSGB 3OPZH 4Y4FC 1GJIA 4HEPG 5EH1A 1YEIL 3NACL 2PXYA 5GXBB 4Y0GA 3GMMA 3O6KH 4JZJB 2APXA 3D39E 4MAYA 4Z0XB 3OV6A 5FUZH 3TO4A 5DYOA 1TMCB 4KRPB 5T3XE 1BAFL 3UBXA 2OSLA 1Y0LA 3ARUA 3MRFA 5DJ2B 4CMHB 4KKLC 4WO4C 1A4KB 2NY1D 3BIAX 1MSPA 1LEGA 3TH3T 5T3ZD 3U4EB 2EDXA 2VZUA 1K85A 5KVDL 3HZMB 4PRBB 3UTQA 4NRXB 4L29B 4P5KB 2DYPA 1MFCL 2DKMA 3HUJF 1RIHH 4LCUB 4ELMA 2AXFB 4D9LH 5JTWA 5ISZD 5I1LA 4LEOA 4BH7A 4FP8L 2EZ0D 1T1ZA 1EHLH 4AIZB 4YXKH 4OD2B 5D2NB 2MSPA 3BDYH 4M6MH 2JIXA 2W0FA 1YMMA 4PD4K 3BAEH 4OQTL 3TPUB 1S7VB 3PGDA 2Y4SA 4GG6F 4Y4KD 3UTTA 3DLQR 3TV3L 1IGJA 1WK0A 1RVFH 1DVFD 1YN6A 1SMOA 3IJYB 5DK3A 5GZOC 3VXNB 1NFKA 3ZSSA 2BSED 4HMDA 1R5VA 3MRBA 2CLVB 2XKNB 5D7KD 3WUZA 2VDLH 4ZO6A 2DLIA 5FUCE 3TC9A 3MXWL 3FKUS 4RGMC 4JAMB 4U6XA 4GAGH 4AQOA 3BKML 3BPOB 4KROB 4LP5A 4DZBA 2VL5A 3TZVC 5DJXB 4MQTB 1J11A 3QUKA 5ESAB 3F5WA 4OFVA 1P4BL 4KJWC 3TN0A 4S0TD 5IVXB 1ITBB 4NN5B 2R29L 1VDGA 3V2AR 1I7RB 2BMKA 3L3JA 3KPSA 3O9WB 4P5MA 5CEXB 3V5KA 1VB9A 3OPZL 2QQLH 4O58L 1OGAE 2LU3A 1FVDB 3V5HB 3BPOC 4KROC 1KJ2A 1RJZA 4PFEA 4CVXA 4M7JL 3ZTJH 5CLTA 5I19L 3QAZC 1AXSA 3NZHL 1PG7X 4M62H 4E41E 1F4YH 1AGBB 3KXFE 1F97A 2OP4H 1G6RB 3GUTB 3ET9F 1G9ML 3MLTB 2VXSH 3UYRH 2DQFB 4Y1AA 2FYYA 3TBSA 5CD5C 4PPTA 5CFHA 2AEIT 1X5JA 1QFHA 3GB7B 3VD4A 1QP1A 4JFYA 1LEKB 4U31A 5DK0B 2OL3L 1IM3A 2HKFH 2CQVA 4HIHB 3ROOA 3W39B 4DEPB 3RKDC 5JPNA 3QIUB 2VDPH 5EOCH 3GHBL 2IBZY 1CU4H 3MYZA 5GZOD 1GOFA 1A47A 3S98A 3T0DA 2G5BB 4HC1H 5EZLB 1YNLH 3KPPB 4R9HA 5CJ8A 4KJYA 3MJ9A 1JNLL 2IALA 4KQ4L 4OLZH 1R3HB 2AJUL 5F3HA 2Q8BH 3O4LB 3TZVD 1G7QB 3K7UA 4V2CB 4JDTH 5E24E 3C8KA 3FFCA 2ZSWB 1INDH 4DFHA 3BP5A 4Z5RA 2YPVH 3BH8B 1A21A 1LO0L 4U2YA 1EUTA 1I85C 3ZE1F 3VRLF 2GSGA 3VRLE 2R69L 1AC0A 3TBYB 4WDIA 4QT5A 4EN3D 5I66A 1LO3H 1MLCB 5LCVL 1SVCP 2OL3H 3MACL 1U3HD 2Y7QA 5J1SC 3M1BB 3FT2A 3TO4B 2EIDA 1VFAB 1AXTH 3RVUC 5LG1A 3U6RA 3ZTJG 5KSAB 4CUCA 4HLZG 2UVEA 5FV1L 3DX7B 5JW5A 2B1HL 3FQUB 5CEYB 4LFHG 1FBIH 3QUML 3VWKA 4JO4H 1J8HD 3WIIH 5IP4A 3KPRD 4E41A 1F4HA 2ICWA 3B6SA 2ICES 2K3TA 1GGCL 3AS3A 4G80B 4XCNB 4BJLA 4ELKB 5B8CA 1GZPB 3MRDA 5C1MB 1ZT7A 4OM1H 1DR9A 3B8YA 2WBJD 2GTZA 3ZYOA 5JW4R 1KIPA 2Y25A 3HAEA 3DMMC 3RDTB 2BCKB 3QI9B 1FNAA 3H3BC 4GKZA 3T4YB 2AJ3A 1SY6A 3IDIA 4EI5D 1L6ZA 3JWOH 2IAMD 1KIUA 5F8RC 3L3IA 1OM3H 2AABH 3IS0X 4HBCL 1HCFX 5D7IE 1JP5A 5I16A 4HWEL 3DUSB 4Z0BL 1F8TL 3B9DA 4QNPE 3FT3B 1BM3H 4BSVB 5SWQA 4LL9A 3SGEI 1KLGB 3FQTA 1V3MA 4YR6B 3RDTC 5I1CL 4Z7VB 3TT3L 1GC1H 3QCVH 2DQEL 5J13B 3P2TA 4R4FL 2DM3A 1XIWD 4IIQB 5D7JD 2DQTH 3BGFB 2HVJB 3NZ8B 4LHUD 5T1DH 1QACA 3BD3A 1HINH 4NNYB 5J0BA 4NO0A 2P45B 3KYMB 1RZJC 2IH1A 3QEGL 1A4JB 5DS8B 5EBLB 5T1KD 4YWGL 2IQAB 3L3KA 4NCDA 1JTOA 4OT1L 5GS3A 3OXRA 3HR5B 3QQ4A 3WNMA 3JWOL 5GZND 1JYXA 4ELME 2V5TA 5DHVH 5CUSL 1CGYA 3M8OH 4KJQC 1UXWB 4OIBA 1AKJB 4QRSB 4PBWD 4MNQD 4NKOA 3QZWG 4KAQH 1DBAL 2CDFA 3MBEC 4HGWA 4NN6C 4XTRD 5FHBL 4PB0H 2IAMC 3DV4B 1P5UA 4HX1B 4TVPE 5E0QA 3DVGB 3WO4C 4AK1A 2F5BH 1YY8A 5DUPH 2DKUA 5E5UB 1R3JA 5I30L 4CVXB 2XWTA 1H5BB 1EX0A 1BX2A 2OM5A 2A38A 1EMTH 2XXMB 5FGCE 2YWZA 4M61A 4LDOB 8FABB 3GMMB 4DW2H 5ISZB 1RZJL 4JZJA 3SDCC 4Z77A 3CK0H 3X14B 1ZGLB 1QBAA 5DJCB 1Z9LA 4OGZA 3DX8B 1KCRL 1KTKE 1QVOA 2HFGL 1QUNA 1URLA 3V7AE 1Y0LB 2IH3B 2CIIA 5C0BA 4M62L 4ESKA 3PDDA 1KFAH 1ZWIB 4RMVA 3H42H 4U6VH 4ODHL 4M6OL 4I0PC 3N9GH 4IRJD 1PLGH 3LKOB 4IHOB 3U9UB 4JRYE 1FFOA 5T3ZE 2V5MA 4LVOB 3ARPA 2Z91A 3EJZC 1X3DA 4I2XE 3UTQB 3FCTB 2IADA 3GSWA 1I9IL 3EYFB 3LPFA 4C55A 3D48R 4MZ3A 3CXHJ 1PKOA 3KDMB 1S7RA 4OFYA 1SJVA 4NQDE 4YDKL 5TF0A 1TLKA 4GBXD 4LSSH 2EZ0C 1J7VR 3BH9B 5DZLA 4L4JA 2R29H 2QL1A 3WD5H 2F74A 1R5IB 1AD9A 3MRJB 1MWAH 1N6QL 3O4LA 4PGZA 4J3SA 5JOPE 4KI5D 1JN6A 1I3RA 4P2OD 1NSNH 4GW5B 3S7GA 4U1HA 4WNQA 2BP3A 3OAZK 5C0DA 3P9LB 5F7EL 1T83A 3PP4L 4M7ZC 4WDIB 3G6JA 3H3PL 3GSQB 2IBGA 5T1LD 1R5VB 3CVHA 4FQXA 2DIAA 4X7SH 4LCIH 1RZKC 5E8NA 1JGUL 2BVPB 4KGJA 1FJ1B 1FAKT 4J4PA 4G6KH 4IMKA 4JM2D 4PJEE 4YBQC 5TGBA 4XNXH 1FPTH 2DLHA 4WFGD 5GQBA 1V3LA 4LGRB 1QR1B 2I60L 3VXME 4LLQB 1MCOH 2HA1A 4XWOD 4QYOB 3BGMB 2R0LH 2ICWB 1BFOA 4K3HA 3P0GB 4NO5A 3U7YL 1D5IL 2CIKB 3HZYB 3P0VL 1WV7T 5C9JB 4J2XA 1IGCL 4FP8H 4LOUC 4PJEB 3KPSB 4UNVA 1Q9OA 3RDTA 2FBOJ 2O5YH 3QI9A 3IDNB 1GVIA 1G1YA 3BD5A 2LFGA 5SWSD 3RPIB 3O6LH 5A16A 3WS3B 3V5HA 3AM8A 2APWA 2VITA 3CSGA 4RGOL 3WHE1 2MCPL 3EHBC 2BHYA 4X6CF 2A9NL 3HG1A 5BOZG 1UENA 2ZCLL 1RAMA 1L9NA 4U6HB 2D7PA 4L4VE 2BNRA 4WV1A 3FT3A 4BSVA 2VLKD 3I6KB 1LNUA 2YRZA 5MP6H 4CADB 1E27B 5JW3H 2SEBB 2ICEB 5F8QC 3QDAA 4GRLB 2DQIH 4NKDA 4F7CA 1IBGL 1G7JA 3O4LE 3VH8G 1VKXB 1HSBB 1N2RB 5MENA 3MLRL 3G6AB 5D6CB 3R06A 1DLFL 1YEGH 5F9JA 5ECJE 3SKOA 4YQXH 1VCAA 4H8WH 3GKZA 3MNVA 4HIHA 5IBTL 3GKWL 3LZFL 1UM6H 5LGHL 1CE1H 5IGXH 5DD5H 3TBWA 2YXMA 3NCFB 2WP3T 4WY7L 3BRFA 4R4ND 1YC7A 2KQMA 3VH8A 2V5SA 1H3GA 4FHBD 3ARDA 5ACLA 4ZUTA 3VXMA 1GGTA 3S5LG 3S4SA 2WINB 4U1SA 1G7HA 5DC0A 3INUL 1VHPA 5C2BL 4NUJB 1ZOXA 4O2FA 1NBVL 3RY4A 1HQ4A 2CKBL 1M4KA 4OSUL 3VFGH 3X13B 4HJGB 5FO8B 2YC1A 2Q1EA 3BH8A 4QHMA 4WEBL 4YGVB 3I85A 4W70A 1MVUB 1A7NH 1B0RB 1YEGL 1MFEL 3RVVD 2OTWA 4RCAA 3DO3A 4QOKA 1JRHI 4W6WB 4RAUA 5KW9L 1WIOA 2NY3D 5H2BB 1TNMA 2X7LA 3C6LD 3F58H 3RVXC 1OCWH 1IC7H 3F7VB 5CZVL 1QHPA 5DJCA 1HEZB 4QRRD 5I6XB 4OI9A 1MLBB 2I5YL 2NR6D 4ONHA 1H15A 3GIVA 3V0AC 3PWNB 3WLWC 2MKLC 2ED9A 2O26U 2BNQE 2C4FU 4Z7UE 4RDQF 4G5ZL 2Z35A 3EYVB 5J9PB 3B6SB 3KXFB 4EXPX 2Z4QB 4GXUM 1F6AB 1WWBX 1KIQB 1EV2E 4ZNCD 2MQCA 4ODSL 5E9DD 1FFPB 1SEBB 1LEIA 2OI9C 4D9QD 2BVOA 4NHUB 1U8KA 2C4FT 3WO3B 2DLGA 2BNQB 1D9KA 4LLWB 4PJ7F 2MHAB 5FK9A 3FO2A 4HGKC 1IFHL 5IQ7L 3VDBA 4Z78B 3BH9A 3V6FB 3BEVA 1ES0A 1QBLL 5CBEA 4HIXH 2DQGH 5HVFB 3NGBB 1VEOA 3F7RA 1GIGH 1EJOL 2C3HA 2XQBL 5I0ZA 1I3RB 2VXSL 4MQ7B 1ZEAL 4O9HL 3CVHH 1NPUA 3OR6B 3K81A 1WFUA 1C16B 4PJGB 4JN1L 1I1YB 3G9VA 2CJUL 2NCMA 4CN1A 5FUOL 5HHXH 3CVHB 2UWEB 1CFNA 3GMLA 4JJ5B 5F7EH 2CR3A 3QXTA 5HYJA 2XNAB 1A4JA 4P2RE 2IQAA 3L3KB 1EGJA 4NWTL 3DMMA 4J3XA 5C0FA 1BBJB 3RX5A 2PR4L 3MUHL 3NFPB 3SN6N 1DQQB 5GGRY 4K3DH 1MOEA 1IAOA 4LKCA 3RWGA 4I3SL 4FQ2H 2CKBA 1CFBA 4IRZH 2J12B 4HGWB 1T5XA 2GKIA 3THML 4JR9H 4MXQD 5GGUA 1ZTXH 4DN4L 4IOFC 3BDBA 3CAFA 2NYYD 2ZG3A 3FQRB 3B2UC 4DTGH 1ZVSB 5K9QI 5C0CA 1A9BB 3H7BA 5E1AB 5F93C 4TTGA 3I84A 4D9RE 3BD4A 3P73B 3RUGA 3VXRA 3RAJL 2FGWL 3G5XB 4PRIE 2D4FA 1JPSL 1A6TB 5ACZB 1P4LB 4POUB 1XF1A 3Q48A 2PO6B 1FCCA 5F9DC 4WEMB 2P4AB 4HUXB 1AQDA 2NY5C 5MI0B 1MELA 5J11C 1OT2A 5H8DA 4N8PA 5C07A 1HHIB 4PJBA 4CAGA 2E8YA 3F12A 3EOBB 1A6UL 1SM3L 2CIIB 4YXHL 3MA7A 1ZWIA 1B0GA 5EOTA 3SGDI 2Y07H 4H25A 1R3KA 1MI5A 3LEXB 1VACB 1KCSH 1U91A 5LWYH 1JZ5A 2O61A 3NCJL 4X4XB 2IAMA 5D72H 3TF7C 3GSOA 1OTUC 4WFFD 3HZKB 2NX5E 2E9BA 2Q8BL 4FTVB 2GAZA 4U6YA 1D6EA 2JELL 1YEEH 4WJ5A 2HJKB 4Q7DA 2FR4B 3LN4B 4PJFA 1G6VK 4NQCB 3VXMB 5B39A 4L4VA 3HNVH 5C0GA 4YHPB 2PUQT 4FABL 4NUJA 1IGIL 3QULB 1OPGL 3IDJB 3PQYB 4Y2DA 4MQXD 4KZDH 1IT9H 2EH7L 1E4XH 3RHWF 4QNPF 2H32B 5DRWB 3ZKND 1A5FL 5FO8A 2AQ1A 5FA4A 2H3NA 4MWFB 5TQ0L 2OL3A 5MENE 5ALBH 4RGNB 5K93A 4XVJH 5DTFA 1BAFH 3CIQA 1JHTB 4X9HA 1RMFL 1JGLH 3GNML 2J8OA 1G9NL 4GKOA 4L3CA 3EW3B 1HWHB 5C8JA 2VLRA 2R1XA 4XVSH 5I8EA 3QNXA 1MLBA 1K4CB 4RNRB 3C60A 3QHZH 4IJ3B 5TE6H 3BMWA 5FEBA 4KK6C 1KUMA 4PJ5D 4YX2H 3MCG1 5D6DC 1XZ0A 4OAWA 3F58L 4CNIA 1JPFA 1U8PA 5E5RB 3ZE2E 3R0NA 1YEKL 4XCEA 4LLUB 4XHQA 1KIQA 4QXTA 2NTFA 3QQ3B 1NEZG 3ULVH 2AK4A 3WKMH 2VLLA 2B1AL 5BZWA 1JYVA 3FN0L 1WBYA 1KEGH 4G7VH 3AGVA 3UPRB 1BOGB 5H35A 4W6YB 2HLFC 4H0HB 1T20B 3WS3A 3I9GH 4ODSH 3L6FB 3PDGA 5GRVL 4F2MA 5KTEH 4PTTB 2ZSVB 4Z78A 3ARGB 1AGFA 4OD1L 5TDPB 1CLCA 2FHFA 3SQOL 1JWMA 1KCLA 4NNXA 1LNUB 3TGXA 1FNEB 4IMKC 4UIKH 1WCBB 4RGMB 4DCQB 3V4UL 3MRRB 2HRLA 3SGKA 1N4XH 2ED8A 4TUOB 3T8XA 3OR6A 1AHWA 3TIDB 3S36H 2A73B 4HWZA 3L95B 5C6TH 4GUPB 1KJ2H 2Y1VA 3SKOB 1EGJH 5IB3B 4YFDB 1EFQA 3RGHA 2Z8SA 5FUOH 3SGJA 2DQEH 3PHOB 5C0FB 2BHZA 2H26B 1NCCH 4OKVA 3S3SA 1HHJA 2BY3A 3ARTA 4BZ2H 2WINA 4PJHE 4U1SB 2X9XA 4HZLA 4Y8AA 1IGFH 4MJIA 3LH2H 4HQQH 1C7TA 4J3UA 5DHYA 3X13A 2D2OA 4XPBL 2YC1B 1UKQA 1I8IB 4KRMB 3PIQB 4EUPH 5IB4A 3LS5L 4YHOH 3SE8L 3PV6B 3QJFB 3P73A 4DZ8B 5C09A 1JGVL 4PRID 1FZKA 2HMID 4DVBA 5BJTB 1A6TA 4LGPB 4EI6B 2YZ1A 1D9KD 3IU3A 4QTHA 1P4LA 1GSMA 2X7LB 1QSEE 4NHCL 4EUPG 3F7VA 5AUMA 3RY5A 4HT1L 2D7TH 1H15B 3GIVB 5TE4H 5CJ5A 1FC1A 1YEJH 1WBZB 2XY2A 4HDIB 1YEIH 3ZKXC 2L7JA 5F7YC 4ODBD 1DBKL 5F1IA 2WWKO 3B9VA 1ZHLB 3MMEA 4FXLA 2WLYA 5D7JB 1U58B 3B9KA 4LPVA 2QQLL 5IEKB 2P5ED 2YHGA 1MEXL 4FTVA 2AQ3A 1RIUL 2P5EE 2R0WL 3HPJA 3O8XA 4NBZB 5I74B 1UM5H 4EJ1C 3V4VH 3HC0B 1GGIL 1CDHA 4OM0H 4GRWE 4DEPC 3TO2A 4XNQA 4ONFH 2DMBA 2V9QA 4LOUD 1QBBA 1AXTL 1U95B 3ARFD 5MEND 3OHXB 5EC2A 5E8PB 3O3DA 1FPTL 3UDWA 3ZSTA 5DD6A 2F8XC 1XGYL 4KK8D 3IYLW 5C86A 5J06A 3AB0B 4XCFH 5ALCL 3QDME 3GHEH 3ULVC 4ODTH 5CSBA 1N7ML 4X9GA 4L3CB 2VISB 3GRWH 1VENA 4KMTL 2EXYC 3U1SL 4HAFA 3HRZB 3CDYA 2NXYD 2R23A 3I3DA 2VTFA 5D2LA 4OFDA 1CXEA 4PG2A 5AD0A 2VXTH 1S9XA 4R4BB 3V52H 2QKIA 1CDJA 5DUMH 5EG6C 1EHNA 3HC3H 2HKHL 4R0LA 5C07D 3PP3H 2WWMD 1JPFB 1U8PB 3L3OB 2CKBB 4LSPH 2EDQA 4QHKJ 4HIIB 2AABL 3WN5A 2CUMA 1U8NA 2GJZB 2CR6A 2Z31A 3B2UD 4F9PC 5C0RL 1WBYB 2P8PA 4PY8I 3WE6B 4NRZA 5EU3A 3UPCA 3WHXA 2YK1H 5IB2B 3JXAA 4UTBL 1YPZE 3NOIA 4CW1B 4TNWK 5EO0B 2B4CC 4BSWB 1MF2H 2QR0B 3EGSA 2GJ6E 5GGTH 3H6JA 1CXIA 5TFSH 1FNHA 1FHGA 1M7IA 1BREA 3KS0J 5I1DA 2XTJC 4YHML 1CGVA 3E2HC 4L4VD 2V7NA 2B1HH 3IJHA 3QG6B 4KDTC 3V7MA 1HHIA 4PJBB 2LQRA 5EUOB 3VD7A 2AJZA 1UWGH 3Q3GB 1KC5H 3UO1H 1AD0B 4ODVH 3BOVA 2EYRA 3EOYG 1LO2L 2H2SC 3OGCB 1L7IL 3UTTD 2IAMB 4U1NA 2M2DA 2DKSA 3HZKA 4WFEE 4WFFE 1DQJB 4AEFA 3BIKB 4GKSB 4PB0L 1HHJB 1CLOL 2VLRD 2K9UA 1AGEB 1IKFL 3VWJD 1J1PH 2R4RH 1FG9C 4NQCA 3SCMA 5IW6B 5EB9A 3PV7A 1NCCL 2DMCA 5E03A 3BZDA 1F8TH 5JMOC 1NGZB 4JFEB 3RIAK 3RU8L 1UJ3C 4JFFB 1PX4A 4Y2DB 3VGHA 4JY4B 4ZTPH 3MRIB 1PQZB 3NA9H 1ED3B 1S78C 4LHUA 1ZVHA 3MLPA 3LH2L 1XGRA 1CDYA 1PG7L 4LHQB 3WSQH 4LVNC 3O9WD 2J5LB 4P46D 4P3DA 3QFJD 1NUFA 2VXVH 4JHAL 4JZNB 1OF2B 1E28A 4JEGB 2OMBA 3V6OA 3LS4L 3IDGB 1RUPL 3SQOH 5M7QA 1G1CA 3TVMB 4A6YL 4A2LA 5F1NB 4ZD3H 1KCVH 2A6IB 5T3XD 3NZHH 3RJDA 4FMKA 4HKZA 3S9DB 5GRJL 3MGOA 1E4KC 3FTGA 3WIHL 1BVLB 1SJEA 3MJ7B 5E6IC 2F58L 5LAXB 1M6OB 3TYFA 3KGRA 1S7TA 4MNQB 2NTFB 4U3HA 5IF0B 2EDJA 1HHKB 2VZVA 4XVUD 3SDDD 4J3OC 3UPRA 5E9DE 5MEOA 1WAAE 4JY5H 1JJUA 4HG4J 3GSNL 1NMBH 1U92A 4TNVF 4Z7VE 3RGVB 5JIHA 4D0DB 5CEZL 2NNAB 4RISL 4IDJL 1E6JH 1OAZH 2BOCB 5D5MB 2ARJA 1CXHA 3LS4H 4OLVL 1SQ2N 5DD0L 3SDYL 1V7ML 5J56B 1IL1B 7CGTA 2VERN 4Y89A 3QQNA 1HXYA 1ZV5A 1H3WM 1XCQB 1FLRL 3B5TA 5GS2D 4YHOL 1DE4A 3SE8H 2D9CA 4LCYA 1F90L 4CDGC 1KCUH 2DM4A 1RJLA 4BELD 5LGJB 3CJJA 4FTVE 3MV9D 1Z6JT 3F65A 1CFTB 3H8NA 2H26A 4NBYB 1A7BA 1SVZA 3LKNA 3NCMA 3OKYA 4OZIA 4PJ9C 2YEZA 4EKXA 4KZDL 3WD5L 4PBVC 1IGMH 2X70A 1NEUA 4B41A 2A6JB 4KDVA 1PG7H 4ZO9A 4NRXA 3WSQL 3QEQA 1B2WH 1K6QH 5GJSH 2VC2L 1RZGA 4HXBH 1OTUD 2VDPL 5EOCL 3DGGB 4LMQI 5D1QA 5IMKB 1CG9B 4LCUA 1CTOA 4YZFE 3IF1A 1FLRH 1G0XA 5BJTA 1KLFA 1JYWA 1N64H 1M7IB 1GPOL 1QEWA 2DQJL 1H9VA 1N6VA 3HNSL 4YK4B 4YQXL 4KMQA 2W0FB 1MRDL 2F8VA 3KPOB 4BK5A 3STLB 3MR9A 7FABH 3QG6A 5FYKD 5EUOA 4GMSL 2Y36L 1CS6A 3KXFD 3Q3GA 5I9QB 2AERT 4DFIA 2E3VA 1FE8H 2XKNA 1F4XH 2N56A 4O51B 2FSEB 3C08L 1NGPL 4XPTH 2APBA 3S8WA 1NJ9A 5DD3H 1NL0H 4TSBL 2EDBA 1M7XA 2VL5B 3BO8A 2BY0A 4JO3H 3TEUA 3O8XB 5DURD 3RX7A 5A1AA 1XGUA 3KPQB 3EOTL 4HGMA 4OBRA 1F42A 1I8LA 3U0WH 3JSSA 4TNWF 4YPJA 4GAYA 3QIWD 5E99H 4GLRH 3BWUC 4UTBH 2QQKL 3EYQC 3OHXA 3ZT7A 3S6CA 3MLVH 3QSKB 4YAQA 2Y72A 4F3FA 5DVNA 3KLDA 3MSPA 3MNZA 3D2UD 5DGQA 4GW1B 3BVNA 1MH5B 1AXSB 1M1SA 1A5FH 1H3PH 1QLRA 4XAKE 5L7XL 2LVCA 2FEEI 3ELAT 5KSBB 4OLXL 1MFDL 1X5ZA 2COQA 3QNYA 3QO1A 4ZUVA 2RFXB 5E8OA 5IVNA 4FQPA 3EDFA 2YPLE 2BVYA 5IMMA 3CZJA 4NQUA 4R0LB 3HTLX 5KG9B 1LEKA 2X09A 2IC2A 1ZGLP 1NGXA 3H9SA 3KR3L 2HJFA 3EZJB 3WIHA 5IOPA 3UTSD 1FO0H 3IJSA 1MHCA 3UROR 4OCRH 3WV0A 5EO0A 4TUKH 1LDPH 2FJFB 4N0YL 2IALB 2CO7B 3S96A 4AY0A 1AC6A 1TQCC 4XNZC 2JB5L 5IR1B 4R6UA 2JKXA 3MQIA 1OCWL 5D5MA 2QADB 1KTRL 3RVWC 3ARQA 3IJHB 1WTLA 3VFVA 3ILPB 5TDNB 1V05A 1N5AA 4PG9A 4IMLB 3A6CL 3UYPA 1FFQA 2HTLD 1RK0A 2P1YA 5J3HD 4CN4A 1X6NA 3OJ2C 5AG8A 3HE7A 1R6VA 4TUJA 4DGIH 3F6IA 4I3RH 1JV5A 2R2BB 3EO0A 1GCFA 3CVIH 4M48H 3HNTH 3ISWA 4TVPL 4FTVD 4X7SL 1T3FA 3QJHB 4O00A 1Z5LB 1CICA 3KHOA 3QXAB 5B38A 5C0AB 1C8PA 1J86A 4R26H 5SV4A 3T0EA 1RUPH 1X5FA 1JGEB 1RV6X 4JFDE 4KXZH 5IW6A 4M03A 5DA0B 3QDGB 3TCLB 2NY1B 4MYWB 5FGBC 2CSPA 1HZHL 4JRXD 5IB1B 3FRUA 2ITCA 2Q7YA 1YECL 2V2XA 1OGTB 1T7ZA 2CJUH 4LCCB 3ARSA 5EZOL 4JGUA 3R0MA 4OTXL 2NY0B 3QFJE 2FWOA 1UM4H 2Q76B 4GJTB 4YXHH 1KLGA 3FQTB 3ARGD 4NGHH 4P0DA 3A67L 4Y5XA 3STLA 1RSFA 3VG9C 5GS1A 1XGTA 4M4PA 1T7VA 2A6IA 4G6FD 2APVA 2ZZUT 4JRYB 1LP9E 5GSRA 5KS9A 4JQVA 2WIMA 4OBSA 4X6BA 4KK8C 5B4MD 1MHEA 2PW1B 4NNYA 1A6WH 2FSEA 5LAXA 1X44A 2IH1B 4MNQA 5DS8A 5FA3B 5IF0A 1JK8A 2ESVE 3QQ4B 4V1DD 4UDUA 4D9QE 3O6FD 4I4WB 2AS5M 4FFVD 1B4JL 1BFVH 1X4ZA 4L8SA 5I2IA 1RZIB 4JANB 1HYSC 1ONQA 4NM4H 3VXSB 4R2GD 2B7DT 3ZO0A 4MHHI 1UT9A 4A6YB 2G60L 3B5GA 1UJTA 3IDYC 4MAYC 4UOW0 1D5IH 1A3LL 5CD3B 3DV6B 5EUOE 4OGYH 3SKJH 2YD6A 2ZCKH 3GSNH 3UYOD 2XWBA 3QQ9C 4F3FB 3EDJA 2OS7A 1V3JA 3KYNA 3JTSB 3MRKB 4DGYL 2RQ8A 5HYQA 2F53D 1WEJL 1FAIH 4YWGH 5I8OH 4ODWA 2IF7A 1X5HA 4M9OA 1UB5A 3OAYK 3BJLA 1TETL 3TWCL 1BOYA 1W8OA 2R69H 1CFTA 3MX0A 5DDHB 3SPVA 2ZPKL 1KXQE 2Y36H 4WHTA 4NQDA 5C0BB 1J05A 1H3UA 1GC1L 2J8UF 3SDAC 2VIRB 3NH7L 2HLAB 4ZXBA 5HHMB 1T6VN 5KG9A 3TT1L 3VJ6A 1YQVL 4LSVL 2IBBA 3MROB 4NFBA 1EHLL 3DPBA 3L3DB 5TFSL 5FYJL 2Z92B 1LP9A 5KS9E 1AGDB 1CLZH 2ARJQ 4LPWA 2CDGA 4XNUH 2IADB 5IBTH 1A7OL 5EBWB 3LQMA 1HH6A 2PCPB 4X6FB 4LQFL 1RIVL 4F7TB 5KBNC 3EO1B 4J3WA 2EH8L 4P46A 1GOHA 4I3SH 4XP1L 5C6TL 2FX8H 4MXQC 4U1JA 1YA5A 3E1F1 4KPHL 2F74B 4X80L 5J89A 1O7VA 1XGPB 1UADC 3KPOA 5I1GH 3BZEA 2HWZH 5KAQG 3WDHA 1XGQB 4XP6L 2VDQH 1TQBC 3ILPA 4PV9A 4P4KA 5TDNA 1BPVA 2Z9TA 3FB8B 1NLDL 1TTGA 3P9MB 2A74A 1INEL 5MEPA 5DFWH 3VFMA 3MLVL 3S3JA 4XX1E 1NMAL 1BJ8A 2VR9A 5HHOA 3UTTE 5DUBB 1IGTB 5LJYH 4YEFA 3RRQA 4APQD 1RJYB 3VDAA 1KEGL 3N1PC 5CJOL 5CD5D 5IW3A 1VGEL 5HJ3A 1IC4H 1U8JB 5C0ND 4D0BA 3HB3C 3MREA 1G6RH 4PLJD 4LSRL 4UV4H 1BQLL 5C08E 1H8OA 3KPQA 3QEUB 4UTAH 3KHQA 4L4TD 1SJHB 4RZCB 1BFSA 3TCLA 6FABL 4H8WC 3O2WH 5J6HA 1L4IA 1WIUA 1EEYB 5IK3B 3KNBB 2F54E 4LBEB 2YKLH 4PRNB 1W0YT 4AM0B 1S9VA 3FQWB 4P57B 2DL9A 5EFIB 1A3RH 3BPNC 4PG2C 2Q8AL 5HY9B 1J9CT 2JK5B 4JR9L 4I1NB 4K7PL 2ZP0T 1I1FA 3M07A 1F3DJ 3ZDZF 3MNZB 1INEH 3GMOB 4JPVH 1EGJL 2P8LA 1G7IA 1ZHBA 3BVNB 2AI0H 3I6KA 2P7TA 1QLRB 4IRSA 5J7CC 4JQIH 2IPUG 1OVZA 4U1LB 4JFXA 3JBG7 1OAXL 1PYWB 2Z31C 5HTSA 1MWAL 1OAQL 5L2KA 2DQHL 2H8PA 5GS1B 3RI5K 5GISL 4YXLH 1ITCA 1KTLA 1S9WB 1OD9A 5BS0A 5AYUL 4QRPB 4HUKB 5F9JB 3U46A 4UAOC 4W4OC 5K9JL 4LRNH 2V7HB 1VERA 3CC5B 4POZC 4YK4C 1JK8B 4AEHL 3O6LL 4GKNA 3O3AA 1ZVYA 5IOPB 3U0WL 3PQYD 1MHCB 1PZUB 4HG4K 4F15B 4H1LA 4GS7B 4MDIB 2R1YA 4Z7NF 2AV1A 2FJFA 5DO2C 4UT9H 4I0KA 1T7YA 4BUHA 4ZUUA 1G7HB 2HTKC 3O2DL 5CUSH 4A6YA 4XPGL 4ZOEA 5L9DL 2VWEC 3IB4A 2W59A 5F1SA 2NY2C 4RWHA 2JCCF 4R90L 4F57H 3RTQD 4L3EE 3G6DH 4KRPC 1BQHB 5IB5B 4QHMB 2XWBB 2A6KB 5F6HI 3DYPA 3PHQB 1FE8L 2ZJSH 1J8HA 3KYNB 3IKCA 4OCYH 1UH3A 4D8PA 2OTWB 4FFZL 3J7HA 4UB0H 1CD0A 2BRRH 1JV5B 5FECB 1YEDB 5IW1A 1KV3A 2PYEE 2V6HA 3HE6C 3MRQA 2NY5L 4GOSA 5E00B 1HEZA 2YD4A 3KPLB 3BRGC 2OSLB 5DDHA 1U8HB 3PWPA 4NP4H 5DJ2A 2X4NB 5C3LD 2E8ZA 1FV1A 1ZLVH 5GGRA 1PGRB 3MUY1 1P1ZB 4X5XA 1F3RB 1N5YL 4IS6A 2JB6B 5BS0E 1U8OA 4BQ8A 3MV7D 4RAVB 1LP9B 4MDJA 5IFHH 3SQBA 1YEHL 4JVUA 3H9HB 2Q7YB 3MRPB 1ZE3C 4F7TA 4LLWA 1LDSA 2XTJE 2J8HA 5FK9B 5F3BA 1D5BB 1JMXA 3V6FA 3L5WA 1TPXC 5FF6B 3IGAA 2HVKA 4TPRH 1W0WB 1NGWB 3EYSL 1L0QA 2ADIA 1IGJB 1CICC 3HFML 1EAJA 1C16A 2VXTL 5L8LB 2H32H 4PGCA 3LOWA 2OJEA 3DRQB 5BV7L 3VFMB 1WZLA 4MJ5A 3QUXA 1N4XL 3PG2A 4XPAH 3UTSB 3OSKA 4AMKL 35C8L 4YBLC 4XP9H 3UZQA 1CFSB 3P11H 3MYJA 4JAMA 4K9EL 4U6XB 5J4MA 1G7MB 2G2RB 3VGDA 1HYSD 2ZKHH 4HK0A 4HXAH 2UWEE 3REVA 2A0LD 5C0CE 3NFPA 3WXWL 4JFPA 3CMGA 1T89A 4PJGF 3IU4H 1X9QA 5F7DA 2NY6C 2OLDA 4HCRA 1FN4B 5EZOH 4FNLH 4P23A 4UV4L 4WUUB 1MAKA 3F6LA 3EAKA 3ARFC 3VA6A 5HHPA 2P49B 2C1OA 4JFDB 5T5FH 2V17L 3RWCA 3SJVE 3D5OF 4IJ3C 1FVDA 2ICWJ 1DSFH 4HKBB 4MD5B 1S8DB 3ULVD 3B9EA 4QXUH 5DR5L 5EDXA 4DOHE 3RUGB 1A6ZA 3G5XA 3FRPG 4PJXF 4PGDA 1UA6H 3ILQD 5GRJH 4MSWA 1MI5E 5FAAA 1KCVL 3VFWB 4YHIB 2G5RA 3VFTA 3RVXD 1AGBA 4XP6H 1ERNA 2XQBH 4Y4FB 1Q9WB 4UUJB 4NZJA 1OAXH 4QRPA 1H5BC 4HT1H 4LCCC 1T1XB 4JQIL 4JRXB 3U46B 3ZKSD 1ZGLM 2CDEB 3ROOB 1S5IL 4NQTA 1QBML 1XF3A 1IM9D 1T66D 2DOCA 4R7DB 5ANME 3V0VA 4M1CC 4Y5YA 2VDOH 3IS1X 4Z7WA 4M5YH 5SWSE 5IIEA 2DYPB 4N8VA 4PLOB 3BPCB 2HKHH 3AS2A 2B8OT 1GGCH 1YQVH 5JHDD 4BH7B 4YHPA 3MUJA 1JNHA 2VDRH 4OD2A 4U1JB 1AY1H 3RUGF 4H26A 4WHDA 4K3GA 5L2KE 2HH0H 3FRPA 1CQKA 4G7YL 4L3ED 2KQNA 1J0IA 3QIBC 4Z5RB 5ABDE 1QLEH 1EZVX 5GS0D 4F7PB 5TPWH 1YN6B 3FB6B 4Y16C 1HI6B 3Q1SH 5T33H 4NQXA 2BY2A 3HAEH 1MCBA 2CLVA 5DHVB 5I71C 1R3IH 4DGVH 4X98A 1U8LB 1A7NL 3DARA 3FMGL 3VXUD 1GHFL 5K9KA 1HHHB 3CU7A 3DX7A 5DT1H 1ZLSL 5JW5B 4RNRA 2MPAL 2VLKB 1J0JA 4WTXA 5IJVA 4PRDB 4KKCC 3AM8C 5IVXF 2YBRA 3S34L 2IPKB 3VCLB 3WFEL 5DQJA 2E6PA 2H9GA 4P2RB 1UZ6F 1FL6A 1JWUA 3EFFA 2XRAL 4WUKH 2NZ9C 4LLUA 1ND0B 3MV7E 4QRPE 4S1DC 4GXVL 1YJDL 1X5GA 1YYLL 3QH3A 4JDVB 3VFUB 4RSVA 2FX9L 1DQTA 5C71A 1FZMA 3GMNA 4K3DL 3AROA 3NFNA 2X4RA 3SDAA 4PJCE 1M7DB 1JHLH 1KB5A 5D7SH 4V1DB 4PTTA 2BNUA 4JM2B 4YHLL 3GSUB 2P8LB 5B3JE 3DBXB 1CD9B 5B8CC 1RUMH 3OKOB 5F7LB 1MCJA 1AQKH 1BP3B 2VDML 3MLRH 1FNEA 1SEQL 3O3BA 4PJ7A 1OGAA 3FQXB 3N50A 4LFHD 4GAGL 1CZ8L 3RZWA 1S9WA 2O5XH 3HG1E 1BM3L 1EJOH 4P46C 4NQEE 3BGAA 4OTXH 3DRQA 3D9AL 2DD8L 3ARBC 2AI0L 4P23C 1JFQL 3VWJB 4PJHA 1OQOA 3AU1A 4PP1C 4K9EC 4PJAF 2Y6SC 1NAMA 4R4FH 1ORQA 4EI5B 2YD1A 4V2BA 3LEVH 4A6YH 3NPSC 4ZYKA 5HPOA 3DO7B 1I1RA 2ORBL 4FQJH 4OKVB 2YD2A 5EZLA 3NBNA 1AY1L 4B50A 1WCQA 4OGYL 4OGXL 4KK9C 1DN2A 1NANH 4QRTB 3VFGL 2EIZA 4JFPB 1XH3B 2XT1B 2HN7A 3ZYZA 1GIGL 5ICYA 5GHWL 1FN4A 3AREB 4KTDL 3TCXA 4MX7B 1IILE 5FYKU 5GGVH 5IT2L 4WW1B 4HIJA 2VE6A 4JY5L 5DRNB 1UCTA 4AT6A 3BP5B 4MQXC 3MV7A 3ZYJA 5CMAB 4JKMA 5D8JH 5KVDH 3Q5TA 5DMYA 2FZ3A 4NQCD 3HN3A 4DZ8A 2HYMA 1SBBA 4IRJC 4XBGB 1KB5L 3GKWH 3LZFH 5D1XA 4DVBB 5I15H 4YHKH 2EECA 3IU3B 4W4OA 4X0KA 3BN3B 4N5ED 5DQ9A 1D6VH 5A3ID 5EORL 5D7IB 4UU9A 3U6RB 1CN4A 3DECA 1X5AA 5FCUH 4FRWA 3RVUD 2IANA 4D0CB 1FGNH 4QOKE 4K55A 3QDHA 4PR5A 3IDMA 4HJ0C 2K7PA 3VFSB 2AAVA 1KLUB 2ADFL 2GY7B 4XCNA 1ZA6B 4J3VA 4X7TB 4ZFOL 5ICZB 3CSYB 1NDMB 3P4MB 1FFOB 1XF3B 3E6FA 1S7WA 3V0VB 3QUXD 4PJAE 1NCAH 3FCTA 3GSWB 2BJMH 4UINL 2BSSB 1V7NH 3D2UA 3KDMA 1INDL 1A7PH 2VJXA 4O02L 3V6ZB 4BFGA 4L8DB 2VDOL 4GMTH 1GGUA 1BWMA 1PW3A 2YRLA 1J0ZA 2C3WA 3GIZH 5DF0A 3SEPA 1JNHB 3ZDZE 4H20L 4JVPA 2GEEA 4NJ9L 4XNQB 2X4QB 3MO1B 3BYTA 1CXFA 1OARL 5E8PA 5EC2B 4M8QA 3G6JB 3KPNB 2YD3A 3D0LA 1KNOA 4LCWD 4UDTB 2D9QB 5JXAH 2PTUA 3IAGC 1TPXB 1YJDC 4FQXB 3MA9H 5DEGB 5BQ7A 5KJRH 4XVJL 3FB5A 2JIXD 2R9HC 3UTSA 2GCYB 5HXMA 2P42B 1BQSA 3ZTNL 3QFDB 3L3HA 2XG5A 2F53B 4R8WL 2L4OA 2W91A 4RMTA 3JV6A 1DVFA 1G9MH 4JFFD 5AD0B 4HK0B 1MRCH 2Z31D 3OG4B 3REVB 5IJVB 2YKLL 3O4OB 4F33B 4OV6F 2XG4A 1UXWA 4L4TE 4JFOB 4YDJA 2P48B 5A3IC 3GIZL 4LSQL 3CH1A 4PJCB 3KG5A 1A7RH 1EEQA 4PREB 1HWGB 1ZLSH 4PV8A 5E6ID 4I18C 4AEEA 3BDXA 4FXKB 5L88H 1JZ4A 1DZBA 1PKQB 1UZ8A 1R3JB 3RNKA 4BSWA 2ZCHH 2D7OA 3TVMD 2BNUB 3G08B 1JPGA 5DO2D 5EBMB 3C5ZA 5E4EC 4WI4A 1YPZB 1GAFL 4WTZG 5BV7C 3LKSB 1KFAL 4S1SH 3CDGB 3CX2A 3FN3A 1BECA 2H1PL 5GRZA 4P2QE 4Y4HA 2DBJA 3S4SG 3TA3D 5FDYA 2X1WL 4JFZH 4MCZB 1MQKH 3RZCD 1A64A 1IZJA 4JRXA 1MIEL 5DFVD 5DZNA 4GXUN 3P4OA 2PO6C 4XCCH 5BV7B 4BM7A 3BEWB 4GSDL 1N8ZB 4BZ1H 3LQZB 4M5ZL 1IT9L 2EH7H 1MHPH 1CF8L 1A2YA 2DWDA 5K33A 3DO7A 1I9JH 2W9EL 4B53A 4Z7UF 4JDZA 5DC4B 2CK0H 4ZO8A 1ACYH 3K8KA 1W72A 2YUXA 5DUML 3SE4A 3I75A 2I9LB 5BXFB 4K94C 1MAMH 4N9GB 4LPCA 4Y19A 4YBLB 5DK2A 4I2XA 4Y5VC 1I7TA 3WDIA 2ATPA 3SDXA 2AGJL 1RIUH 2R0WH 5E56A 4HIJB 3MJ8B 4AEIH 2EXWD 1U93A 3DSFL 3LDBB 4NQEA 3GM0A 2DTML 1WWAX 1XGRB 3P9LA 5EC1A 4DAGL 3QUYD 1RZ7H 3QXUA 4TVPH 5D1XB 4JZOB 2O5ZL 5AYQA 4IEFB 4ISVA 4L5FH 4J1UA 1DQLL 5DHVA 4UOW1 3T4AB 2R0ZH 3UBXI 4NC1C 1OF2A 4Q6YA 2VABB 3RX8A 3SGEH 3V8CA 4ORGB 1UWXK 2MTPA 3IDGA 3VD3A 4FG6C 4EN3B 3A6CH 3PWNA 4F37F 4NKIH 4I5BB 3HMWL 5I1CH 5INDB 4DN3L 4PY7B 5D2LF 4C54A 3IKKA 1RPQA 2NXZC 4NQSB 2CIKA 3HZYA 1IQWL 5C9JA 3C2AL 3SO5A 2YUVA 3EYOA 3RIAF 1T0PB 4YE4H 4JRXE 5BMFL 4KDTA 4H5SB 3IDNA 3ZDYE 2BVOB 4DQOL 1A6VL 3SKNA 1TVBB 2XN9E 5CZKA 4DAGH 5EULV 1MCEA 4AH2A 2X4RB 3FO2B 5C0AE 3ULUE 3UAJD 3RGVA 4POZD 2WBJB 2C3VA 2CUHA 2PO6D 4MMXC 4ERSH 3ARVA 5FHBH 2XA3A 2EDLA 5KZCD 5LKNA 4WWKD 1N0XH 4NKIL 4HUNB 1EBPA 3ARWA 1BZ7A 2FEDD 3L1OL 4Y19E 5SWZB 5ICXB 4PJGA 5FYKE 5MENB 4N8VG 3V5DB 3SCMC 1MUJA 4OZIE 5DEGA 4MXVF 1WZ1H 4PJIA 1MFBH 1PJ9A 4PJHB 4OI7A 5HBBA 2BC4A 2QHRL 3OKEA 5DMGC 5LGJA 3WS6C 2R2EA 2CO6B 3ES6B 1MY7A 2LAGB 4ZYKB 2PTVA 1BBJA 4KK9D 4KGLA 3INUH 5C2BH 1JVKA 3F7YA 2V5RA 1G7LB 2ADJA 3ZE2F 1DQQA 3P0YH 5EIIB 2IQ9H 2IFGA 3MLYH 4NO0D 5D1QD 4G8EA 3CFCH 2ZUXA 5KAQF 3AREA 1HQ4B 5HYIA 2A6JA 2AP2A 4N90E 3HZVA 4Z7OF 5I73B 3AVEA 1H8SA 2Y9RT 3BE1H 2G75A 3VFOB 2UYLA 5T5NF 3UZEA 4PJFF 1A6AB 1FP5A 3DGGA 3ZDYF 3H7BB 5E1AA 1WISA 5FO7A 1RZKH 4F8QA 2R0ZL 3TH2T 4MJIE 3VXRB 3QCTH 4XBGA 5E8EB 2J7LA 2PXYB 3MJ9H 4Y16D 4X0KB 3VG0L 5DVOA 5IVZA 3KWWA 4Z0XA 3LKSA 1FNLA 2A1WH 3W0WA 4RIRB 5HPMB 5HI3C 5DYOB 3JV4A 3MLZL 5C09E 1UCBH 4W6XB 3UBXB 1ACZA 4D0CA 2XPGB 3GK8H 1A3QA 2OJZL 4K8RH 4KTEL 1JI2A 4NN7B 1KG0A 4LU5L 2Z35B 3EYVA 4PR5B 3CFJA 2Z4QA 5IFAH 5DMKB 1ZA6A 3D3VB 1U91B 1MFAH 3GMRA 4U1MA 2OQJB 3DNKA 1NFDA 2O61B 5KJRL 4FQCH 2FL5B 3GSOB 1A2YB 2DWDB 1U8KB 4XPBH 4NWUH 2DM2A 2BNQA 4JDZB 1S7SB 3VGAC 4PJFB 1G7PA 5E2WL 3ARBA 4KRNA 1EXUB 4AL8L 4IRJA 4LAQH 5HGGS 5L8KB 5IJKC 1ZANH 2QJDA 1FDLH 15C8H 3QULA 4MA8H 2AK1L 4OUUA 2DQCH 1ULVA 3IFPB 5FXCH 4YDVA 1IAII 3PGDB 1F00I 1A7OH 3PWJA 2NY5H 1V3KA 1BZ9A 3UEZA 4G6JH 1GGYA 1GHFH 2X89D 4S11A 5IHZB 3CFEB 4LDLB 1RZFL 3MLSL 3EO9H 1JIBA 4LCWE 2GITA 4UDTA 1INQA 1CFNB 2IPUK 4PJ8B 3MRBB 3GMLB 4JJ5A 3ZL4H 2B5IC 3REWA 1WBXA 3FZUD 4QHNA 2ZCHL 1WWWX 4KHXH 1FFRA 4P4RB 3GBML 3WFHA 4QF1B 4XP5L 1DVFB 2X10A 5SV3A 5E9DB 4MLSA 3O2DA 1YJDH 1JZ6A 4UTAL 2A9ML 2EYTB 3ULUH 1KCKA 2RFXA 3MOAL 3H9ZA 3QCUH 3W0WE 4FQXD 1YQ2A 1U8QB 5C08D 5IQ7H 4LKCB 1UM5L 2FX7H 4JFDD 4PV8B 3EYOB 3RA7H 2VLLB 1FORL 3FOLA 4ZPTB 3B2VH 4ZS7H 1BOGA 4NQDD 5EA0L 3CZFA 5EWIH 1IGCH 2F15A 1P84J 1A9BA 3WLBB 5KOMC 3ULVL 2P24A 2P8MA 4BQBA 2P5EB 5IHUH 4L9LB 4NOBA 3X11B 1NBZA 4IM8A 1X5YA 3ZMRA 2VZOA 1GGBL 2D4DA 3MLZH 2HFGH 1A6UH 1SM3H 3RBSA 1YPZA 3RDTD 3V4PH 1UXSB 2QSVA 2EKSA 3QI9D 5DJ8A 5LVEA 1WC7B 1TVDA 4DCQA 1AI1H 4E5XA 4LLDB 1MJUL 1CT8A 2V2TB 4FZEL 1MRCL 1MFAL 4Y1AB 4K9EH 4QRUA 4MCZA 5FGCB 5E8DL 3HE7B 1CGXA 1ORSB 5E2VL 3QDMB 3QUYA 3QIBD 1FFNA 4PRHE 2O5ZH 5DC9B 2QQNL 1YEHH 1DBAH 4HIEA 3NMEA 4P4KD 3WEXA 1XIWC 4KJPD 2V17H 2Z8RA 3L3GA 1OY3B 4GMTL 4LLVB 3T0EB 2EIEA 3LN4A 3FZUC 1IEAB 1YNTA 4WCYL 4ENED 1IC5H 5H37H 2E6QA 4XMLL 1C08B 4OFKA 2YSSA 2C4XA 4WWID 5GIRB 4ZUSB 5CP3H 4N9GA 4EOWH 2UZXB 5K59E 1G84A 1YPZF 4WY7H 2ATPB 5IB1A 4Q0XH 5DHYB 1A9EA 4LSTH 1AGCB 3WIFA 2YA1A 2FO4A 2HT3D 3D39A 3VWKC 2HTKD 3NFSL 4M3KB 3TBYA 1JRHL 5E8DH 3GMQA 1LO2H 5BV7H 4QTHB 5E2TL 3PP3K 4YEEA 3STZA 5CGYD 4ODVL 2Y7QB 1K9TA 3D0VA 2AJXL 3FT2B 5CP7A 5CIPA 4KRPD 2P5WB 1VFAA 2XXCB 4Y5XB 4ORGA 2LE9A 5KSAA 4PRPA 3U36A 3QNXB 1K4CA 1T0NB 3BPLB 5H37G 1OP5K 3L1OH 1KJ3L 4OIIH 2FATH 3BIBX 4LLAA 3I50H 4ZMAT 4MD0A 5KVFL 4XPHL 5SX5H 4NQSA 4GBXA 3L5IA 3OKKA 3OKLB 3MRDB 1P4IL 3LSOB 3HAEB 3VXTB 2FL5A 5DWUL 3IDIB 5LXGL 3S35H 3SKNB 2JTDA 5HHMD 4I8DA 3L3IB 4HULB 4F2MB 2EE3A 3RWEA 4H88H 2J4WH 5IWLA 1O5DT 5TDPA 5FB8A 3RVVC 3WFDL 4AENB 4YR6A 4DQOH 4NZUL 4FFWD 4Z7VA 5A43C 5HD8C 4TUOA 2R4SL 3T0XA 1AHWB 3VMNA 1D5ZB 3N1MC 3RL2B 1OTSC 1A6WL 2MCG1 4PJ8A 3TN0C 1CXLA 4HF5L 1CGUA 3RZCC 4P2OC 3WNKA 5EIVA 5EBLA 3HRZA 5CILL 2R23B 2ENSA 3RY6A 3BKCL 1GH7A 4M1GH 2EYTA 4U0RC 3F7YB 3GBMH 5HYEA 5CBAA 1F3JA 4RRPA 2E7BA 3QHFH 5I71B 3UTZA 4NP4L 1X4YA 2QHLA 5J11B 2VZ1A 1NAKL 2BVTA 1XEDA 4PD4J 1BJ1J 4HSQA 2UYLB 4UT6H 3UC0L 5D72L 2D7QA 1ADQL 4EN3C 4I13B 1FORH 5IFHL 4P46B 4KKBC 2GK0B 2EDDA 3VXUA 43CAA 1AXIB 1AJ7L 2J8UB 5T3XH 2XN9B 3TIEA 3P4NA 4JFHD 4APQC 1UXSA 4N9OB 2FECL 1KJ3H 1EHXA 1WC7A 2NMSA 4RIRA 3VE0B 1QVOB 1CDIA 2B0SH 1NAMH 4AQ1B 2DICA 2IH3A 4XPTL 1KB9K 4WI6A 3T1FB 3MJ9L 3GJFA 1AD0A 1F6FB 5KN5B 3OAZH 3PWUB 1IEBA 5DMKA 2MFNA 2DN7A 2OQJA 4OCYL 4XT1C 3OL2A 2QEJA 3EYFA 2FJGB 4HUVB 3FFCD 4MAYD 1QNZH 3IXTB 3BFOA 3JUZA 4KKAD 2ED7A 3CU1A 3O0RL 4M4RA 4PGEB 3VDCA 2DQJH 3I2CL 4IIQC 2HFFA 4IRJB 3QEUA 2R0LL 3OF6A 5ESQB 4J4PC 5EU6D 3MRJA 3TO2B 4WWKA 1T03H 1OTTC 3CXDL 3QUZD 2WWKT 2W60B 2CH8A 4NWUL 2OXHA 1ZK9A 1HIML 1A1OB 3JV0A 3QWOA 2NW2A 4HV8B 3UJTH 5BO1L 4J3TA 3VXQB 5HDQL 4EDXA 1I1FB 1QQDA 4Z7VF 4KUCF 3GSQA 4P9HC 3GMOA 4GBXC 3MFFA 3GMQB 1F2XK 2CMRH 2CUIA 3AREC 4LF3B 3O41A 3V52L 3D0VB 5CP7B 4XXCC 3T0BA 1EDQA 1CFVL 1KEML 1I85A 2HWZL 1S9KC 5T1LA 5BS0B 3DETD 1QSVA 4HKXB 2AJXH 2ARWA 3W11D 4TQEH 3OKKB 1M6OA 2NY2D 3TYFB 5D70H 4H20H 3U7AA 1TJGH 4NRZB 5EU3B 2YD9A 1F5WA 2R1WB 2OTUB 5HHME 4CW1A 3MNWB 3ZKNC 1YY9D 3RTQA 2ATKA 4PJXE 4L4TB 1IQWH 1JL8A 4OF3A 5BRZE 2F8OA 1P4BH 4L9LA 5AZ2L 4DJMA 4JHBA 4Q9QL 1T2QL 3HG1B 1H3TA 1TCRB 3BQUB 4I0PB 1RU9H 4X9FA 2BOCA 3S37H 4GRMB 4H88L 5DEFB 4Y19D 2AVGA 1NUDA 2L0DA 1HHGB 4BSJA 1WTGT 4XP5H 4UBDC 1NCNA 1IL1A 1D5ZA 3PWPE 4ZAKB 5DA4A 4KPHH 1L7TH 2PYFA 4PP1D 1Y18A 4XWGL 4P59H 1K2DA 4M6OH 1AR1D 5GS2H 4XNZB 2FJHB 1RJLB 3GNMH 4G3YL 3B3IB 3KPTA 4WRLA 5HI5D 5DD1H 5M95B 3L3GB 4JPKL 5FHAH 3U4AA 1W2KT 4RMUA 1KBGH 4OZFH 4YXLL 2EDWA 4OCNC 4RFEA 15C8L 3CXDH 4ZAKC 1N59B 4OQ1A 2YSSB 3DX9B 1CFQB 1IEHA 2BZDA 2HT3C 4HCRL 1Z0NA 3QEQB 4J23A 1AGCA 4QCIA 1FNSH 5JNYB 2FEEL 4ZPVB 4OLYH 3WXVH 3JWDH 4OGXH 3L9RB 4GT7A 4XC3H 4OLZL 4QOKB 4JFZL 3SE4C 4G8FA 2HVKB 3GMPA 2UY6A 1W0WA 4HWBA 1D5XA 4Z76B 1NGWA 3BKJL 1IZKA 4ZQKA 4TN9A 1E28B 1MI5D 2CRZA 4XGZA 5D9SB 5I1JL 3VE0A 4XPFH 1NGYA 1J12A 1EZVY 1RUML 1FVCA 4M5ZH 5IKCB 4RMQA 3U9PH 4MXVE 4XCCL 1UACH 2X4TB 3CD4A 2J5LC 4MJ5B 1BVLA 2DL2A 2C7UB 5SWSB 4OCXL 4RX4A 4MS8D 3X3GL 1RK1B 4UB0L 1RFDH 5F7WC 1YECH 4PJ8D 3QIBB 1WSST 2FJGA 3E3QE 1CGWA 2DI8A 3BO8B 5ID0A 4AEIL 3TYGL 3EHBD 4Y16B 2UZIL 3SKJL 1OAZL 2MHAA 3AB0C 4K7FA 5FIEA 3S34H 4Y8DC 3GJEB 4JPWL 4D0DA 1KJVA 1GZQB 5FOBA 2X2YA 1CXKA 4Y4KA 5DI8A 3JTTA 4PBXA 1U8IB 2FX9H 4ZFZB 4OV5A 1BVKA 5HHNB 1XIWB 3NVQA 4GXVH 3PWVB 4FS0A 1CDGA 3VXQA 4G6KL 4Q9RL 5TDOB 5E08L 4KUCD 4WUUE 4U3CA 2FATL 1OOAA 1LHZA 4F7EA 1MIEH 3WIHH 1V8HA 4WUUD 4H8WL 5D8JL 1MNUL 1TFHA 2NY4D 5BZDB 5HYJB 2EIBA 4HWBL 4K94L 2A6DB 4DK6A 2J6EH 5ANMA 3GHEL 3QI9C 3TT3H 5HGBA 2ERJB 4XI5C 4ONGL 2VDMH 3Q6FA 3B5HA 2D7NA 1E4XI 4Z18A 2ENYA 3QWQB 1W72H 5A2FA 2AJSL 1IGYB 4HK3N 3U0PB 5ESVB 1T1XA 2YEZB 2PYEB 4PTUA 1IAOB 2CDEA 1RIHL 4OKDA 4LSTL 1WWCA 4UT7L 3WS6A 3BP6A 2VKXA 3W81A 1F58H 1IRAY 1IAIH 5IUSA 4RGOH 5TE7L 3C6SB 43C9A 3FQRA 3DSFH 4J6RL 4ELMF 3HMXA 2Q3ZA 2BDNH 3CXHK 4NPYA 1UVQB 1HH9B 3I2CH 3IF1B 2NXZB 2J8UA 1DBML 2VKWA 5A40E 4BYHA 4TSCH 1XF4B 1ZLWK 4CRPA 1NBYA 3RNQB 3VFNA 1QOKA 1NCWH 1MFCH 1T1WB 1ZXQA 2ZPKH 3A6OA 5AZEL 4OIIL 3AAZA 5I1EH 3QPXH 2VQUA 1MCOL 2GJ6B 5ETUA 4ZAKA 4O2CB 3DI3B 4RQQA 2KZWA 2PYFB 3D3VD 2R2CA 3KYOA 5JOFA 1B0GB 3ARDD 5EOTB 5KN5A 3CLEL 2R2BA 3EO0B 5KANI 5CJXA 1UWGL 2DQUL 4ONOA 2ICCA 3JWDC 1IAIM 3B3IA 3RL1B 1LO5A 5GRXG 3FN9A 1KOAA 4YFEA 3G04A 4C4KO 3BESR 4U4BA 3OKNA 1T4KB 3P9WB 5GGSB 5C0BE 1NCBL 1PSKL 1QFWM 4AIOA 2VDKL 3MCLL 1DBMH 5B39B 1JWUB 3OX8A 1A02N 4FZ8H 1DN0B 4GRWF 4PS4L 2AKRB 3MV8D 4X80H 3MRCA 4L8BB 3T2OA 4CVUA 4PIRF 4M43H 4PJIF 2NZIA 4X8XA 3RWDB 3QCTL 1DLHB 1I9JL 2W9EH 1TJIH 1B4JH 1BFVL 5DSCA 2H3NB 3WXWH 4WU7B 4OI8A 1OGAD 3NFNB 4M7LL 1JHTA 4OF5A 3KS0H 3PHSA 3MBED 2GSIB 3GSUA 3V79C 4OFYD 3FQNA 1MFBL 3AS0A 3GMPB 1MH5A 1OTSD 3O41B 4N0UA 4Z76A 2PR4H 1CWVA 2VSDA 3NPZB 5F7FA 1QSZA 2YPKA 1C12B 2R1XB 1YMMD 2FD6L 2CKNA 4OQTH 3C60B 5SX5K 4ZUVB 1G9NC 2VXUL 4LVHC 4HUMB 5J1AB 2ITDA 1CDCA 4IOIA 3WUWB 3SDCD 3U2SB 4X6BB 3O6ML 4J8RB 3H2WA 5F44A 1DL7H 3QQ3A 4EI5A 3H9SB 5DVMA 4NUGL 1VADA 1IFHH 3QIBA 1C5CL 3TBTA 1TJIL 4UV7L 1ZANL 1CR9H 5ID0B 3WNLA 5F96L 4Y16A 4F9LC 4ZSOE 2FBJL 3OB0H 2P5WD 4O2EA 1P4IH 1TTUA 1AGFB 3WFEH 3SDDB 1KXVC 1TCRA 2P5WE 1IKFH 1PFCA 1J8KA 2GYSA 1JGDB 5EUOF 4GRMA 1NMBL 3V0WH 3NTCL 3G6JF 1VPOH 1U8IA 2FD6H 2OMNA 3RIFK 5BCAA 4OZ4A 2XZAH 2BRRL 1HYRC 4NRYB 4O4YH 1XIWA 1U0QA 5I8KH 2FZ3B 4AMKH 1X4XA 5CHNA 1A6PA 3RI5F 3BN9D 3QB7C 1G9MC 4TUJB 5D7LE 5B21A 4K71B 1DEEB 2EEDA 1J18A 2XYCA 4L3EA 1I7UA 2CLRB 1JBJA 2FJHA 3QDGD 1QLEL 4I18B 1QFWH 5D1ZC 4FN0A 1T3FB 3QJHA 1J8HE 4XPFL 4RWYL 2XKSA 2H1PH 4KK5C 7FABL 5AG9A 1IGYA 5SX4I 1GGIH 2I9TA 3WL9A 5HHVL 2PYEA 5DMGD 1N3NA 3QAZB 4YPGA 4Z7NE 3VGBA 1FDLL 3OKMA 5CJQL 4MXWH 2HP4A 4DTGL 1NCTA 1FVEB 4MJIB 3VXRE 4HD9A 3E6FB 2DDQL 4Z7UB 4P5KA 3QRGL 4ZFOB 4OFIA 4OZHB 5LBSH 3EO1A 2NY6D 1S3KH 5CEZD 3DVFA 2Z8WC 4XNUL 2DAVA 1IGML 3IXAA 3QXDA 4EI6A 5FM4A 4M1DH 4OB5H 1Q94B 2Q76A 5DEZA 3EOTH 1GRWA 4ZD3L 5CIPH 4OJFL 2WQ8A 2Y07L 1PVHA 3TZVA 1B6UA 3AAZB 4G3YH 4GW4B 5JW4M 5BW7A 1XFPA 3UJIH 1F11B 5A2KH 3W5MA 3BXNA 5E70A 4JRYA 1KNOB 5I19H 2VQ1A 5E4IA 3VG0H 4XCFL 5ALCH 4YH6A 3C9NB 3IT8D 3Q0HA 5E08H 2XQYG 1TZGL 1JYNA 5F96H 1TVHA 5C0IA 5I1HL 4QRQB 4LPXA 1RJYA 2ID5A 5T5FL 3T09A 4DZBB 4HMCA 4O58H 4ZTPL 2BVQA 3QUKB 1JMZA 4IOFD 3VI4F 2E7LA 1HSAB 1T4KA 3EDEA 2C3GA 3HI6H 2P47B 4LMQE 5EU6B 4FXGB 1LQSR 2FGWH 3CH1B 3GSRA 3HC0A 3MBXH 4UNTA 1NQBA 1OAKH 2WUCH 5JLZB 3SGDH 4MNQE 3O9WA 5J6HB 3HR6A 4G43B 4LLMA 4YLQT 3MCKA 1OW0C 3FONA 4ZG1A 1YMHB 1K8DA 3T2NL 2NLJB 4U33A 5TE7H 3OTTA 4W68A 4LAJH 4XPAL 5T1MB 4LLYB 2VAJA 1X7QA 1JPGB 1ZT4B 2R56L 4K7PX 4P99A 2VISA 3SJVA 5TH2A 5FDWB 1UKSA 2V2WB 4F9PA 4GG8B 1BFTA 3ARFB 4Y5YC 2H8PB 1KPVB 3GSNA 4YNYA 4Q6IC 1KJMA 2OZ4A 3GUTA 1KTLB 3OBAA 4N8CH 4R4BA 2M1KA 2DJUA 4GS7C 4AZ8A 3U2SA 4OLXH 1A4KA 2VQTA 3VJ6B 4LCWB 3GO1H 5MERB 5JHDA 4R2GB 3GRWA 1P69B 4NM8H 4R97B 4D9LL 1E4WH 3LS5H 3VD5A 3WXVL 5CP3A 4X99A 4MMZC 1N6QH 4HPOH 2PCPA 4X6FA 4XC1L 3OJDA 2H41A 4X7FC 4M9PA 1NL0L 1WAAF 2HMIC 2VDNL 2AXFA 2H45A 2NY3B 1RUQL 2RCSL 2EYSA 4CKVX 3LRGA 3CNKA 1EBAA 2EEAA 1QFWI 1BLNA 3SDXB 3ROLB 3SY0B 3ZZ1A 4X9BA 1I75A 4OZ4B 5CSZA 1R24B 2AXJA 1JUFA 1T22B 5SX4H 1RUKH 2KH2B 1FCGA 4E42B 4ISVB 4OZFB 1G0YR 3K2UL 4FQ1L 4I18A 2O93L 5I8KL 3DIFA 2D3VA 4RFOH 4KVCL 4HCRH 2WZPD 4PJ9D 3VXMD 1U8HA 3UJJH 2OZ4L 5INDA 3OKNB 1AGEA 4I0PD 4NDMB 2FIRT 3DURB 3VI3E 4BZYA 3RZCB 2BMKB 3L3JB 1ZT7B 1BJ1H 2AKRA 5CEXA 4L8CA 4JFQA 1QRNB 4MDJB 4LIQL 3VG9B 4Z7OE 4H5SA 1L6XA 2FEDC 2Q86A 2ZOKA 3FQWA 5DSCB 5J8OA 2NX5A 3WKML 3WJLC 1CF8H 1D5MA 1QO3B 1E4KA 5C08A 2X41A 4PJGE 5C0NC 1Q9LA 3TH4T 1EIBA 1OB1A 3CGTA 3IGAB 4LKXB 1FSKC 3BWAB 4KKLD 4LVOC 4D94A 3QIWB 3NIDF 3B9KC 4LARH 4B5EA 2ADIB 1C12A 4ZODA 2A0LC 3ORJA 3TVMA 1OLZA 3LQAH 4M8VA 3BXNB 1HKLH 1T5WB 3ESUF 5HYSG 3MLSH 1V7MH 3VGEA 4K07A 4PRAA 1EVUA 1DQML 1FSKB 5GPRA 3RP1A 5JPNB 1RULH 2XZCL 1I9RL 2NY4C 3PNWA 1EVTC 4J4PD 4WI5A 5MEOB 2VLRE 2PKDA 4C56B 5GGSY 2BVQB 4HWEH 1F45A 1S7UA 3C60D 4NKOB 3FFDB 3GEWB 1AR2A 2VH5H 5I18L 1PEWA 5E94B 4YGAB 3HLAA 3SDCB 4MB4A 2D7MA 4LLMB 5ITBH 3FONB 2B4CH 3PWLA 3RWCB 3ARRA 3PXJA 1A6AA 4F15C 4DGIL 3FOMB 1XCTB 4XAWH 3IDXH 2XWTB 2A6KA 5ADPH 4K3EL 5I66B 4LLYA 3H0TA 3HCVB 4AYFA 3FAWA 4XNMA 1DEEA 4G5ZH 4H0GA 1OP3K 3PF2A 5C2UB 5IVZB 3LRSB 1LE9B 3GI9L 5I76B 3TJHD 4FQHA 3DX8A 1P2CA 4HKJA 5I1GL 3KPLA 4B7LA 3V4PL 4YUEH 4X6DB 4HFUH 4M93C 3MOBL 2RB8A 4EIGB 3MV8B 1T04B 3WL9B 3BHBB 2FHCA 2BNQD 4H1LH 5HYSA 4TUKL 4UT9L 5KANG 4YO0A 3OG6B 5AZ2H 4S2SB 3HE6B 4OF0A 2DS4A 4X99B 1UM6L 3AS1A 5BVJA 4ZFOA 2ZUTA 5KSUA 5D1QB 5HHVH 4BZ1L 4B7IA 1G7PB 4CMHC 1J0KA 5JW4Q 4UT7H 2X42A 4PJAA 2X1QA 1QEWB 2I25N 5D7IF 3BZ4A 5JXEC 3M17B 5ADOL 1MFDH 4OCLC 3UO1L 3RVTD 1LO4L 1NANI 3GDBA 1I8MA 1I7ZA 2KZ1B 4XP4H 1RIVH 2C9AA 2R8SL 4X7DC 3TZVB 3QEGH 1UKTA 2HTLC 3U48A 3RFZC 3KJ6H 2Q6WA 3FB6A 1PLGL 4OD1H 1LP9F 25C8L 1JNNH 3LHPL 3BX7C 3LY6A 3G9AB 4UIMA 3KYMA 1U8LA 3SDDC 1NKRA 1N0XL 4JM2F 1NLDH 4O9HH 3EUUA 4H0IA 1G7MA 2VXQH 2VMFA 3KAAA 4KKCD 5FO9A 4LLQA 5CEZH 1YEJL 4PRDA 1LE5A 2WV3A 4K23L 3LKQA 1IKNA 2H9GB 1CLYL 2AJVH 2AW2A 3GSRB 5F97E 1ND0A 1E6JL 3ARYA 5L0QB 3HC3L 3GSXA 4GAYB 2ZOKB 3KR3H 1E4WL 3STBA 1FZMB 3GMNB 4Q74A 3K8MA 2UY7A 5C08B 2P5EA 5F6IC 5T1MA 4JM2A 3C8HA 3FAXA 4PGDB 3QEHA 4U6HA 3RWJA 4PP2A 3OR7A 5CGMA 1O0VA 1Q72L 3VFWA 3KVQA 3QIWA 3QWRA 4MCYB 1J0HA 1UACL 1ZGLA 4KJPC 5DRZB 1HK6A 2JJSC 2I60H 3UZVB 3FO1A 4MS8C 4JG1H 3S5LA 4F7CB 1VKXA 2V2TA 4Y4FA 4HXAL 1NC2D 3T0WA 3EYQD 4RGNE 1CIUA 3ME0A 5DRXA 5IMMB 5KW9H 5F6IB 1A8JH 2PNDA 3QDMA 1RZFH 3WMSA 3AU1B 1S7QB 3EO9L 3GRWL 4RRPG 4FFZH 5IM7B 4LQFH 2CGRH 1EFXB 1SHMA 1A7QH 4Y5YB 4OF7A