1BBDL

Three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPSSLTVTTGEKVTMTCKSSQSLLNSRTQKNYLTWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLSISGVQAEDLAVYYCQNNYNYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the Fab fragment of a neutralizing antibody to human rhinovirus serotype 2.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 8F5 FAB (LIGHT CHAIN)
total genus 51
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1992-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bbdL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bbdL01
1QLFA 2G5BA 3MNZA 5IB2A 4GW1B 4XP1H 2Y36L 4R3SB 3MR9A 1PSKL 5MEQA 4N0CD 3U9PL 1OGAE 3QIBB 4GQ9L 5ESQA 3CFDB 1UWEL 1YEJL 1DBBL 4HUKB 3KXFA 2ZKHH 4QRTB 1CQYA 1ZV5A 1U3YA 4HJJL 4KI5E 3T4AB 4C56B 4QHNB 4OGAC 3PQYB 5F71A 4E41A 4Z5RB 3JWNC 2P5EB 3HZYB 3FB7A 3QHFL 2F9BT 1TZIB 4MAYC 4RMRA 1YY9C 3EYQD 3MXWH 1YEFH 1NAMA 3KYOA 5CHNA 5DQ9B 4ETQA 5TQ0H 1SY6A 4KTYA 4X7DC 3DXAB 2G75B 1OSPH 1X44A 1HEZB 5L2JB 1QHPA 5D2NB 3CU1A 4LHQB 5I1AB 4IIQA 3VXSA 1VENA 2DI8A 3SE8H 5C0AB 3TZVC 2ADIB 3BMVA 1N3NA 4LEOA 2D31A 3ECBB 3SJVA 4KHXH 4F9LC 3TN0C 3QDJD 4XX1G 4OTXL 1DUZB 4PJFE 3GKWH 5A2JH 5ENWB 1IGYA 3SGEH 4Z0XA 3LKPB 2LVCA 5IBUG 3AY4C 1QRND 3FAWA 3QPQC 4FFWD 5FYJH 2X1WL 4LSVL 4Y19D 2OR9H 4EXPX 5C0BA 3N1MC 2AK4B 1W8NA 4G6KH 2QSVA 1X4YA 3O8XB 3WHXB 1MAJA 5GGVY 1T03H 1CG9B 2F19H 1MCSA 2EECA 4GUPB 1NBYA 2B5IC 5DUPL 3JWDH 5JHDB 1B0WA 3ARUA 1KJ2B 4Q97A 1TIUA 4QHUA 4Y4HD 5DUBA 1IAIL 4BQ9A 5F7DA 3T2QA 2FLBT 1QFOA 3MV8E 3CUPB 3LN4A 1D5XA 5JLZB 3MNVA 4P5KA 2IPTL 1HSBA 3QUKA 1JPTL 3ILPA 4FMFA 4PS4L 5C86A 4LVNC 1LO2H 3ARFB 4HS8H 5BQ7A 1YQVL 1EGJL 1TVBB 1U3HA 3QZWA 1P1ZB 1FHGA 1BBJB 1FORH 3RWHB 5E8NB 5D5MB 5E8EA 1T66D 3L7EB 4FTVD 2WLZA 3MLRL 3QG6B 4ZFZA 3ALWA 4OV6F 1Q72L 3TJHC 2ICWJ 1T04B 4NN5C 1U8NB 1E6OL 3IDGB 4PJXF 4UQ2A 4HIIB 4PJCE 4WWKA 4JHWL 1FNEB 3MV11 1N6QL 1WCQA 1J8HA 4P9HH 4PJHE 1MJJA 2ZNXA 2VXUL 5HGAB 3U7AA 3HR5A 5CD3A 2NY7L 5FGCE 3VH8G 5MHSE 1RPQA 4JFDE 2R1XB 2XKNB 4WIQA 1FGNH 1IKNC 3GNMH 3LIZH 1GVIA 5HGDA 3TBYB 4HQQL 1JF1A 1I8MB 1DQJA 5J1SC 5IMLB 5FM5O 4NKOA 5D72H 5I71C 4LSUL 2L4OA 3HNVL 5T3ZE 1G9NH 4OCSL 4AQ1B 1ORQA 1IEBA 1RZ8B 2FATL 3F7QA 4OI9A 3MMEA 4RMQA 3O6FD 5FGCB 2Q7YA 4N0FB 4Q9QH 1FFRA 4FQXD 4J1UB 4EI5A 3KAAA 3MRMA 2GSIB 2YRLA 5IVZA 3ETBF 4PTTB 3VG0L 3QPQD 4FFWC 4ZD3L 3S4SA 4N0UE 3DV6A 1ZHKA 3G5VB 1RZFL 2HYMA 2QR0B 1BWWA 3DX9B 4ZS6C 4OQTA 5FGBA 3TNMB 2DYPA 5F97E 4J23A 4BA8A 5CJXC 5HDQH 1DE4B 4HXBH 2H26A 4KTEL 3RWEB 1Y6KR 4QF1A 4JFEA 3GI8H 5HYJB 4R6UA 1JZ3A 5D1ZB 4KMTH 5I15H 5GPRA 4KDTA 1T7ZA 4GKOA 3ZYZA 1QNZL 5GRJL 2CR6A 5CMAA 2Y1VA 4HDIA 1AGEA 2AABL 3MV8A 3GSNB 4NQCA 4QRUA 1P4LB 2J88H 4LF3A 5J13C 3OKKA 1I9RH 1NCAL 4CBPA 3VE0A 4LNRB 1MI5B 4G5ZH 4TPRL 4CL7A 5DUMH 4WGWB 3BPLB 1BQLH 4Y4FD 1HHJB 1YC8A 2DYPD 3GSNL 1I3GL 4JG0L 2I25N 1T89C 1CR9H 1WZLA 4GG8A 1AY1H 4F9LA 1E6JL 4DEPB 5I18H 5IV2B 3FB8B 1KCUL 1WZ1H 3QJFB 4PJIE 4D0CB 4JRYB 5IFHH 3IDXH 2R8SL 4BH8B 5IESL 3CZJA 3UJJH 4Y5VA 1TTGA 1LO5B 1CGTA 5I76B 4W6WB 4OCLC 4U4BA 2LABA 2GI7A 1QRKA 2EIEA 5AZ2L 4FQJL 4DGYL 3EFFA 3LHPH 4QNPF 4LSSL 3LV3A 3MRHA 1KCVL 2DLIA 5DHVA 5ICXA 2XTJB 4F37F 1SEBA 2OX5A 2PW2A 2AQ3A 2DQDH 3ZE1F 1KB5L 3QZWG 2X4OB 3I50L 4M5YL 4NN5B 1KC5H 4E41E 4EOWH 2P49B 3BAEL 5GQBA 3BE1L 1A02N 3HZKA 2R0LH 4MNQE 3VW3L 2VYRE 3P0VH 1NC2D 5IHBA 3U7WL 5ILTL 4LKXB 1OARH 4X6CF 3QG7L 3MYJB 4NJAH 5HI3D 3MJ6A 3QXAB 4BFIB 4OD1L 5E99H 2H41A 4F58H 1EHLH 1UJ3B 2G75A 4JM4L 1EO7A 2E9JA 5IMMA 5D8JH 1MCWM 3VXSB 4NIKB 2XA8L 4PJDA 5L6YL 3JWOC 1HSAA 2A6KA 1T2QL 5EPMB 3VXRB 1KSRA 1M1SA 3VJ6B 3QDMB 4UNTA 5F7YC 3OHXA 3U7YH 1MOEA 4YHYC 4GMSH 4NKMA 3V6OE 2GUOB 4FXGA 1U3HB 1N7ML 3F58H 4TTDD 3H9ZA 5KS9E 5KSAA 3C08H 2H45A 3LEYH 1SYSB 1U93B 1Q9WB 1K85A 2Q1EA 5ID0B 2DQFB 2A6IA 3AB0B 4N9GA 4HXAL 1NBYB 3P9LB 1BFVH 2CK0L 4J2XA 5JW3H 4Y4KD 3EJJX 4IIQC 1C5BH 1NC2B 3JV6B 2I5YL 1OVZA 2Z92A 4GSDH 4XP6L 4JFOA 4YDLC 4NWUH 1MJJB 1RK1A 2X1QA 2EYTA 1UKSA 3LPWA 5E5RB 1JTTA 5E9DA 4DW2H 4KGJA 2PXYB 3F5WA 4R9HA 3AS2A 2MKLC 3RWHA 1TCRA 3KLHC 4M6NH 1VGKA 4PGBA 3CLFL 1NC4A 1MPAL 2X4SA 1EJOL 5F21B 1XF4A 3IT8D 3ZO0A 4DOHB 3EDJA 1FDLH 4MA1B 4QHLB 3T2NL 2NY6B 4ZOAA 2FZ3B 4R7NB 1FN4A 1LDSA 5DQDL 2J8OA 3L3IA 1U8OB 3QBTB 3LEVL 1NBVH 3WFCL 4ONFL 3S5LB 3VGFA 5C0GB 4G8IB 3P9WB 2HRPH 1I1RA 4NOBA 1QFWL 1CVRA 5IG7B 1ZSDA 4FZ8L 4BYHA 3DPBA 4TSAL 1MCQA 5EZIH 1NC2A 3Q0HA 4N90D 4WHTA 5C2BL 3DV4B 1K2DB 1CDBA 2P45B 2EIZA 1Q94A 5MP6H 3NZHH 2BNQD 4QRPA 3P4OB 1JF1B 5J4MA 3EFDH 2W9EL 1U8PB 1HQ4A 2ADGB 3H9SD 1AHWB 3RBSA 4KFZC 4OJFH 1MIEL 5DZNA 3ZTJG 1VEPA 4ZUTB 1ULVA 2E9WA 3TA3A 4O51B 2JELH 1KB5A 2DQUH 3WUWB 4L9LA 3HPLA 3RUGA 2EEAA 4ODBD 1P69B 1Q0XL 4QRUB 3OKMB 4R96A 1DEDA 4X6DB 3KHQA 2DKMA 2AJYL 5D1QC 5C9JA 4TRPH 3KNBA 1IILE 4I13B 1OQOA 3BPOC 2DMKA 4X9BA 3IU4L 1CXEA 3V6ZB 4B50A 4V1DD 4XVTH 1JGVL 5T3XL 3K1DA 3MRRB 4H8WC 1PZ5B 1A14H 5DK3A 2H26B 5ISZA 1KJ3H 4NWTL 4KROC 1UB6A 1URLA 2NY2C 3PP3K 4RMSA 2JIXB 3D9AL 3NA9H 5F1NA 3P9MA 3MGTB 4PJXB 1KLUB 4OM0H 2IH1B 3GSRA 3G6AA 5CJQL 2VERN 3WEXB 1K8IB 3TYFA 1U92B 4LHUB 3T0EC 3DO7A 4ALAH 2HJLB 4Y1AA 1H8NA 4LSPL 1KPVB 5BV7L 5AAMA 1F4XL 3X12A 3QNZB 3ZSTA 4XNXH 4TUJB 4JFFD 3C8KA 2VDNH 4OIIH 4XNQB 2P42B 4AQOA 2VAJA 3NGBB 4HIXL 4XBGA 2ZCLL 5D7IF 3CSBA 4K9EH 2FSEA 4LCYB 1AJ7H 3DVNB 2YKLL 4ZPTA 1SEBB 4BZ2H 4MD5B 2ZUVA 3QQ4B 2UZXB 2OJZL 1EFXD 1ZWIA 4HKZB 4GKZA 3MRRA 3V52L 4ZNEE 3O4LB 5DMJB 1AD9A 4P4RA 1WWCA 1QD0A 3EKCA 1DBJH 4PUBL 3EGSB 4JDZB 1LVEA 3D25B 3P9MB 3LQAH 3QIBC 4AM0A 1D6EB 5KOMC 4U1NB 3QUXB 1VB9A 4YPGB 3KPOA 5FXCH 1UJTA 4OLUL 4OFDA 3ARBB 3FFDA 4L8BB 5DTFB 2HKHH 4KY1H 4G3YH 4P46B 3R1GH 4HS3B 4ZUUB 1IAMA 2BNRB 1DQMH 1YN6A 1X5XA 3O3AA 5IVOA 3VFUA 3VFOA 2VXQH 3MV7B 3B2VH 1MCHA 4MX7A 4PJ7A 4D8PA 3LN5A 1C16A 4PRHB 4NJ9H 2NY3B 2WIMA 4U1IB 2R2BA 3EO1B 4K7PY 1OT2A 5GGSB 3RI5F 1ODAA 1NCBH 3VFVB 4J3VA 1H3UA 3OWEA 1YNKH 2GQHA 4LPVA 4NCDA 4FQQA 4CMHC 3MR9B 4NZUL 2QADB 4X7TB 5KVFH 1Q9WA 3DTXB 5JPMA 3CFKB 1VFAA 1SY6L 2YWZA 1KXVC 1V8HA 2BSTA 2JCCE 4N8VG 2FX8L 2F5BH 4F8TA 4WUUD 1U8QB 3GMNB 5D7SH 4R4BB 5A2LH 1TPXB 1CIDA 3W0WA 5JPNB 1G7JA 1N0LA 5EUOE 5I8OH 3LQZB 3D18B 3CVIL 2ATKA 2WBJC 3TIEA 1JTOA 1ACYL 2K7QA 1BFOB 2B20A 3CFJA 3MNWB 1EEUA 1G6RA 5SWSB 2BVOA 4OD2B 3I6GB 3MNZB 3WS6C 4HH9A 4BQCA 3C60D 4ZFGH 4PJAE 5EZJA 1F4YH 2IQ9L 4NM8H 5TE7H 5D7JC 3RVVC 2CMRL 4JZNA 1X6LA 1CGSH 5K9JL 3CFDA 4XCFH 1P9MC 1KPUB 4OCWL 4QO1A 4XWOD 3VD3A 3HI6H 3P40A 2FIRT 4NDMA 4NZRL 2X70A 1M71A 2BVPA 5CLWA 4LLWA 3DSFL 1WITA 3OX8B 2EYTB 3KPRE 4F2MB 5TPWL 5JXEC 3GSVA 5E8PA 1JZ2A 1Y6MR 1NBZB 2HH0L 3GBML 4NHCL 4UIKH 4UBDC 2IAMA 1NUFA 4FP8H 4G7VL 4X7CC 3FRUA 4PG2A 4U0RC 4NO2A 1IGFH 5E2UH 1WBZB 5I16B 5FUOH 4LU5L 4LQFL 1QEWA 3SY0B 2GTZA 1GSMA 4RGNB 3VXNB 4KI5F 1YEFL 1U8LA 2C1PA 4OZFA 5TQ0L 1A6WH 5FO8B 1WFUA 2VJXA 1F8TL 4M7KL 2C9AA 4KU1A 4PP2B 1KCRH 3ZYOA 4KHXL 2BOBA 4XBPB 2FEEL 3NFPB 25C8L 2XTJC 3X3FL 4OV5A 1G7QB 2RB8A 1EH9A 4OUOA 1MY5A 4LFHG 1EHNA 1WBXB 3C87A 5FYKD 4Y16B 2EDTA 5ICYB 5KVEH 1V7NH 5FK9B 1ED3A 3KLHD 4KZEH 4Y5XB 5GS0L 2VLKD 3GIZH 3ARFA 3BPOB 4R4ND 1NANI 1TTFA 3O6LL 3LQAC 3X12B 4L4TD 1L7IH 1X5JA 3O6FC 5DRXA 4XNMA 2GK0A 2PR4L 5FFLA 2BVTA 5CS7A 3WNOA 3O6FB 4PY7A 4DTGH 1D9KA 1XGTB 2EE9A 3V7AE 3V6BR 1JMXA 2JIXA 2IPTH 4LLDA 1F2XK 4Z78B 1Z5LA 2DTSA 1QG3A 1F11A 2OQJA 2NNAA 3GSUB 2WIIA 3H3KA 3PQYA 2AXFA 5CZVH 1T2XA 5D96C 3ZDYF 1A7QL 1DEEB 1LK2B 2OSLA 4HHAB 4OKDA 3FFCB 4NN6C 3S3SA 5HY9A 3DVFA 3QXDA 4U1JA 3EYUH 1MSPA 4M43H 2HG5A 2ZZUT 3V2AR 5FKPB 3QHZL 1AD0B 4GW1A 4X8JA 2VO5A 4ZPTB 1S5HA 5ESQB 2YPKA 4JR9H 2VQTA 1JN6B 2EC8A 3RGVD 3O3DA 5JOPD 1QA9A 3BIBX 1DQLL 2D7TH 3R06B 1R5WA 3VH8A 4LF3B 2VUOA 5JDSA 3ZLQC 4HF5H 1FGNL 3GNML 3QI9D 4WFFE 4EDXA 5EO0A 4GRWH 2JB5L 1Y18B 1RZJH 2EDBA 1JUFB 3STZB 3D87B 3QEGH 1RUKL 4Q2ZB 1FO0H 2BY2A 5C6TH 4ISVB 3ZE1E 5ADOL 5DR5H 4JFPA 5JXAL 3EIFA 5DJDA 4G6AC 2YEZA 5HI4D 1AGCB 1VFUA 1UCBL 4MB5A 4OF5A 2WINA 3CDGA 3S34H 2J8HA 2ADIA 5HY9B 4X7SH 5SWQB 1PZUB 4JFQA 4GAJH 5IF0B 1FYTD 3VFOB 2J8UE 5T5FL 3WJLA 1WIPA 4EDWH 3GSXB 3MRPA 4U2YA 2VTFA 1CGUA 1JPGA 3D18A 5EA0H 4CMHB 5GRXG 1OCWH 3M17A 4NO0B 3L3JA 4Z7WB 1UM4H 3OAZK 2XTLA 1YNTB 4MNGE 4KJQC 4P2QD 1E4XH 5JW5A 4YGVA 1UWXK 3BJLA 4Y5YB 1WISA 3ULVC 3OAUH 3HLAA 1QSED 1NUNB 2R0KH 3MV7E 2XQBL 2VISA 4ZMAT 1RD6A 2B8OT 4GKSB 4MNQB 5EOCJ 1QNZH 3UMTA 1MFCH 1ZA6B 2AABH 5IB3B 1U41A 3C5ZC 1B0GA 2GJJA 2XZAH 3FZUC 3ZDYE 1JE6A 4HD9A 2H2SD 2WBJB 5J12B 4EZMA 2DB8A 3CXHJ 2H2PD 3FN9A 3QNXA 3N1FC 2FJGB 2O5XH 4TUOB 3K4ZA 4WI7A 4XPFL 5CBAA 1P1ZA 3FQWB 4ODSL 2H32H 3TO4D 5F6IC 5D6CB 4FFVC 4QLRA 5C08A 1ACZA 5IMLA 4FQIL 3CDCA 3BO8A 4P2YA 4ZFZB 3U4AA 3QDJE 4JFYB 4IRSA 2PW2B 1NAMH 4PGEA 5EPMA 1N5YL 4GG6E 3KPTA 3OG4B 3SGEI 1FPTL 1IAKB 2BVUA 4FG6D 5HYSA 1G9ML 3I02A 4JB9H 4LLMB 3WMSA 3A6CL 4MD4A 3T1FA 4FQJH 1FGVL 3QXWA 1KGCD 2A6IB 4PTTA 4UTBL 2Z35A 3QXAA 4P57B 5CUSH 3RPIB 4CN1A 1M7IA 5DDHB 1HDMB 5CCKL 4YZFF 2X89D 3GIVA 3SDYL 1GJIA 1NANH 3DXAE 1I4FA 3P73B 3P0YH 3I50H 1C5DB 2H32B 4NQCE 5C09B 5IEKA 1D5IL 4AEIH 4P9HC 4K8RL 5IFAL 1K4DB 1AXSB 1PQZB 2AXHA 3OR6B 1MCRA 4LCWD 5DD0L 2VN4A 3OZ9H 1RZJC 4XHJC 3GJFB 2VDMH 4LVOC 3DSNA 4QYOA 2L7UA 4NO5B 1S7SA 3N9GL 3ZHKA 1T4KB 3JSSA 3NTCL 3TCLA 2IADB 1RJYA 1EUTA 1RY7B 3KR3H 1EGJA 1ZLSH 1JRHH 3RWIA 3HG1A 4EBQH 4EI6B 3INUH 1U8OA 4HBCL 1UZ8A 1QYGH 2V7HA 4LLYA 1FAKT 4KQ4L 5T1KB 1T7WA 3IFPB 4MSWB 5LG1A 2VWEE 5EFIB 2A2QT 3MRLB 4PD4J 3QDGD 1LO4L 1FNAA 1PY4A 1RUPL 4GO6B 3UYPA 1N4XL 1ONQA 4YNYA 3V5HA 1QHOA 1KGCE 4AYFA 4Q9RH 4Y4FA 4JFEE 3CK0H 1ADQH 1BQHG 4TTDC 5EOCH 5GSVB 5C92A 1U8HB 2BMKA 1IGTA 1TQCB 4S2SB 1DANT 3ZHLA 4GG6B 4B41A 1OTTD 3CCHB 4GH7B 3GZKA 2EIZB 3TA3B 4PLOB 4HMCA 3KPRB 1C08B 4XCCH 2IWGA 3V4VH 4G8EB 2CK0H 3WD5L 3E2HC 6FABL 4YHZL 1KEML 4NWUL 2F53A 1PG7W 4AMKL 5E6IA 3L3IB 3WNMA 1TVDA 4KKNA 1CTNA 2EKJA 4KRPB 8CGTA 4N8CH 2ZPKL 1R5WB 4RMTA 1NDMA 4WFEE 1WWAX 5KBNC 4F7CB 4RAVA 3PDGA 4M1GL 3W2DH 4QTIL 2E7CA 1BECA 1NLBL 4XCYA 4JCMA 5HI3C 3ARDA 4OZHA 3DRTA 1E27A 4DEPC 4L4VB 5EU6A 2HG5B 4Z7QF 2QLVB 1KJ2L 3MCKA 1X5ZA 4TUKH 5EU5A 1YYLL 5IGXH 5DYOA 3L1OH 2W9LA 3RNKA 4OCNC 5F96L 3V4UH 1QFWH 3HPLB 5ANMB 1UG9A 2VSDA 3C8KB 3RDTD 3LKNB 3TYGH 4C4KT 3DROA 2R2EB 5AUMB 2EO9A 5I75B 3ZKNC 5FCSH 3QA3A 2HAZA 6CGTA 2COQA 4I0PC 5FKAA 1GGTA 4M93C 4FQCL 3N85H 1ZWIB 4OLWL 3MBEA 3VGEA 5ADPH 4KVNH 3H0TA 4DZ8A 5JW5B 4ONGL 1D5ZA 1IQDB 2OBGA 2PN5A 5EU6D 4QOKA 3GRWH 1TVHA 1UB6B 3CFBA 5ID0A 2ESVB 4K71B 4X9IA 1T0PB 4LP4A 4MJIB 5JZ7C 4MJ4A 1ZT4A 2UWEB 1FZMB 1UADC 5HDBE 1YN7B 1AE6H 5DWUH 3OHXB 3VD4A 1TETL 3H3PH 1DLFH 1XGRA 2JE8A 2QL1A 4YC2C 2FGWL 1RHHB 2F5AL 4TSBH 4NRXA 3L9RA 5IB5A 3GSQA 5IHLB 2ESVE 3FZUD 4XP9L 1N8ZB 1CT8B 5I1LA 3RY5A 4JAMB 4O02H 1WEJL 4GRWE 4PGEB 4QOKD 4LIQL 4MJ2A 5JW4R 2DLHA 3BN3B 3CFCL 3QDJB 3BD4A 4JQVC 2MJWA 1KIPA 4Y2OA 2CRYA 5DHVH 2HKFH 4QTHB 5GGUB 4AIZB 5IW3A 2DJ4A 2VZVA 2WUBH 4RX4A 2IGFL 1CXLA 5I6XC 3VRLF 4G6FD 4OZIA 4P0DA 2OL3L 3JTSB 3O4LE 3HC4L 2ZCLH 5D1QD 2NLJB 4YUEH 4JKPL 4UB0H 3LY6A 4KK6D 5KSBF 1RUAH 5B39G 1OSZB 3Q1SH 4JFFE 3CUPA 4BZ2L 1VFOA 4JFXA 3QRGL 3TVMB 5D2NE 4V1DB 1RIUL 2BX5A 2W07A 2P8PA 4YH6A 2YUVA 1BJMA 1P2CB 2QKIB 2ZUQB 3L7FB 1FFOA 3PDDA 3VXUE 5IVXE 5IB5B 1PYWB 2BNRE 2MQ0A 5E1AA 3ARVA 3L7EA 5HYSB 4O5LH 4PJFB 4PUBH 5D71H 2EH8L 1BJ8A 4RX4D 1KT2A 3QULB 2Y07L 4NT6B 3WUWG 4U0RB 5EC1A 4HPYH 3STLB 4LGPB 4V1DE 1MHEA 1OAXL 1SM3H 3FOMB 4JZNB 1HZHL 1KFAL 2Z31B 3GMQA 3O9WB 4UUJB 5AYUH 5H37G 1F00I 1GRWA 1JPSH 4A6YL 4L9DA 4Z95H 2FO4A 1NH6A 2VXQL 3PHSA 4E42A 3QUZB 4J3SA 1VFBA 3EYVA 4EN3D 1GGIH 4PV8A 3MRDA 5KSBA 4K2UL 5F7EH 2ICEA 3G6JF 3E6HA 5D7JD 3BPCA 1PQZA 5ALBL 4F57L 3WUWA 4NJ9L 4JRXD 2IAMD 4XMPL 1LEGA 3QUMB 1CE1H 1CLYL 1INEL 3OF6A 3SDDD 3TYFB 4QXUH 4KK9C 1S3KL 1UA6H 4PJEE 1EAJA 3HC0A 3L5JA 5SX5K 2DMBA 4AK1A 1NCCL 1J86A 4OD3H 4H0HB 4WHYH 1VSCA 1NL0H 4QRSB 4C58B 1D3CA 3RA7H 3WFHB 5I74C 1JZ6A 3BP5B 4M7JL 4LBEB 5EZOH 3DV6B 3ZMRA 1K8DA 3MRMB 3CVIH 1KLGB 2ADJB 2VLME 1NJ9B 3W39A 3ZKQD 4KH2A 2X1PA 3EO0A 12E8H 1PEZA 3QFJA 1KCSH 4FS0A 4CAGA 1CF8H 1NGWB 1I1FA 1F4YL 4PJGF 1UQSA 2NY2B 3DNKA 4KK8C 3QNZA 5F1IA 2NZ9D 3G5ZA 3LKSA 3BEVB 1CTOA 1AR1D 2ZCHL 1AQDA 3U1SH 4YHYB 1B90A 2OXGA 3UYRL 3HCVA 4UAOB 3MLWH 3HB3C 3MO1B 1UENA 1VFMA 3CGTA 4HWBA 4UU9A 5CMAB 1G7HA 4M6OH 2IF7A 2R2HB 1VDGA 5DJAB 3WJLC 4ZUWB 3SGKA 3IS1X 1T21B 5DEFA 1JHKL 1QOKA 3SKJH 2XFXB 1TJIH 2AW2A 4U6TA 5FDWB 3QH3A 1X5GA 4DWHA 5GGSA 3QFJD 4NQVB 4MXVE 4H20H 4AIOA 3LKRB 1VACA 1KNOB 1YEIL 4LCUB 3WS6A 1C1EL 2JB6A 1DFBH 4G43B 1MHPH 1KLGA 1DBBH 4JG1L 2VLRB 2ARJA 5IHZA 4F80A 5LWYL 4M9OA 3QIWB 1EVUA 5DVOA 1BIIA 5FCUL 3F6IA 4JHZA 2EDQA 4Z78A 1OTSD 2G60L 4WCYL 5HYEA 3BEWA 4X80H 3NIFF 5DS8B 1VHPA 1CLCA 4LSTH 1OB1A 1Y6NR 4J6RH 4UIMB 1LEIB 1WBYB 4YK4B 1RULH 1HINL 2A74A 1LWRA 3F62A 3PJSA 1LEKA 3TJEL 1MFBL 3ELAT 3NOIA 4YK4C 3PGDB 4HIHB 1VA9A 4OSUL 5HVGB 3DUUB 4RAHA 1TCMA 4R97B 1A1NA 3CMOL 4R0LB 1XF2B 1WCBB 5DSCB 1JPST 1C5CL 1UXWB 4KK8D 3OJDB 1XGTA 4PRPD 5DA4A 4YHOL 5GRUH 2KL6A 1WAAA 3SKUD 3D2UD 4ZS6D 4YHLL 4M5ZH 1HXYB 5F7KC 4LFHD 1UEYA 4P23D 1MRFH 3NCJH 2P5WE 1S7QB 43CAA 2QEJA 5DVLA 3GSVB 1ZTXL 4ONOA 2ATKB 4K94C 3WIHH 2CDFB 2MCPH 1HOCA 4L8DB 2BOCA 4JPIA 2VDLH 1B2WH 5FKPA 4U1KB 4OZFG 3VWKB 1AGCA 3SDXA 3HRZB 2QQKL 3UPRA 4Z7VF 5GJTH 4Z7QE 2WP3O 2NY4C 3NFNA 1D5BB 2IMMA 2RAMA 4OFKA 1U8IA 1LO2L 2V6HA 4AH2B 1D9KD 1MAKA 2E9IA 1ZVHA 4PB0L 2D7PA 5GS1A 4GLRI 2OK0L 2P5EE 2RGSA 3TPUA 2DTML 1T5XA 4P49A 2GJZB 4LCWA 3FQRB 1QR4A 4I4WA 3EYUL 3MLRH 1BQHA 4M43L 5EU4B 2JF1A 5BMFH 3QJHB 3QO1A 5C0BD 2JCCA 1QSEB 4LGSB 3UAJC 3DJ9A 5GGVL 2I07A 1ZA6A 3QNXB 5DD5H 4IOIB 4FQXC 4NRZB 1T22A 1ZVSB 2R0ZH 1WBZA 5I16A 3PL6C 4Z7VE 4U3CA 1LE5B 4IDJL 2C1OB 3HAEB 5DT1L 5B38A 5T1LA 3SDXF 4D9QD 2JB5H 2EE3A 1KIRA 1S9VA 4QEGA 1A0QH 4ZTPH 2DQTL 3ROOA 3NPSC 4IOFD 3MRFB 2NTFB 4POZD 1IC7H 4LSUH 3UX9B 1S5IH 1EVTC 1BOGB 4G8GD 1HWHB 2GTWB 4YHML 3S34L 2VL4A 4R8WH 1FYTB 3NN8A 1OAQL 1RJZB 1PDKA 1CZ8L 1QVOB 2Z93A 3RHWK 4KVCL 5IMOA 3MLUL 2OI9C 2QQLH 3L3KB 1JPFA 2VE6A 3I2CH 2O26U 3G08B 1H8OA 1XGUB 3AREA 4QY8B 3PWUB 1I9JH 1UM4L 4K9EC 5T3XE 4PRPE 1F13A 1QUNA 1IEHA 4ZNEA 1HDMA 4HXBL 3REVA 4YHKH 3ZKXC 3BMWA 2WWKT 4XC1H 4QRPB 1IC4L 5I74B 2NY3D 5DLMH 4JN1L 2RCSL 5DXWA 3S88L 3ULSB 3VI3F 2M2DA 4WI5A 1PLGL 5F93C 2FIKB 4U3XA 5HGGS 5FA3B 2AV1B 2NY4D 5MEND 1IAKA 2NTFA 3IU3B 1NSNH 1QFHA 1P84J 2D3VA 1KTLA 1Z9SA 3OGCB 4GAYA 3BXNA 3MACL 3IVKB 1AC6A 3O2DH 1HHIB 4JM2A 5C7XH 3I9GL 2X4RA 5CEYB 3QR2A 1KB9J 2ARJQ 5E95B 2NW2B 2O5YL 2OP4H 4JO3L 3ULUC 4DKFH 4YFEA 1AGFA 4P2RB 3UP1A 3S97C 3C5ZD 3KLDA 3U36A 2CR3A 2IH1A 2V7NB 4YDIH 2EXWC 4Q0XH 5D2LA 4PGDB 1O7SA 1XGPA 4PREA 1FNGA 5C0FB 4KRLB 3TN0D 3BPLC 3DETD 1CD0A 2V9TA 4IMLA 5DFWH 4IM8A 2EICA 2WV3A 1YUHB 2CKBA 1CXKA 3B5TA 5T33H 2YA1A 3MRBB 2DIBA 4DGVH 3DO3A 1U91B 3KPPB 3ET9F 4PJFF 2FLRT 2BHZA 4JJ5B 1U8KA 3GSWA 2GIYA 2VLJE 4K3JH 3QUYB 3H42H 1EO5A 4NFCA 1S9KC 3BIKB 2KUTA 4O58H 2N56A 5DJZB 3T77B 3TVMC 1XIWB 3QIBA 3T4AA 3QIUB 3KPSB 1QSFA 4LVEA 4PRBB 1OF2A 1ZGLP 1KN2H 4QRPE 3F7YA 1H3PH 1PJ9A 2WINB 3BUYA 2AEWA 2V17L 3EJZC 1QSVA 1K8IA 3QG7H 5AWNL 1L4IA 1JRHL 2D4DA 3INUL 1RMFL 4OD1H 1YEKH 1Q9LB 1XR9A 2IFFH 4ELKA 3HE6C 3UDWC 1W72H 3QUXA 4AEFA 2YUXA 4XRCA 3GMOB 4N1HB 3W5NA 4PJEF 2MPAL 1FC2D 5D5ME 3ARGC 2J6EA 3GKZA 1I8LA 4HAGA 3PGCA 3TBWB 5LCVL 2R1YB 5L0QC 3AS0A 1ADQL 5CLTA 5I0ZA 5ELIA 4H0GA 4H25B 5I1CL 1B6DA 4Y5YC 5J11C 4YC2B 4BSWA 2AI0L 1HHJA 3ARTA 3L3OB 3BKJL 3O4OB 3ZTNH 3JBG7 1JIBA 1NEUA 4XCCL 1A8JH 5CEZL 3V4VL 1OAZL 2FX7L 4YDKH 2KDGA 4YE4L 3HZKB 2NYYC 1EIBA 4PJ7E 2Y72A 4LLVA 2PUQT 3NCYS 1NUDA 2JTDA 1CU4L 4WI8A 5DJCA 3FRPG 2J4WH 1HSBB 5F7FA 4WUKL 4BSVB 3VXME 4ODVL 4P3DB 3SOBH 3WIHA 3S36H 4MCZB 5CKAA 3OBAA 3SGJA 1HIMH 3L9RB 5LJYH 4X5XA 3P11L 5FUZL 1XCQA 1YEEH 4PY8J 1KIQA 4O9HH 2EDFA 1BVKB 2FB4L 5E2VL 2IADA 1A5FH 3OKYA 2BDNL 3VFTA 4Z7WE 1E4WH 1JYNA 5C0AD 1YYLH 1WWWX 5IGXL 1HHKB 3HNSH 5F96H 5KSUA 3O4LD 1R3IL 3TZVD 1BD2D 5JPMB 3MRLA 5GHWH 3N0PB 3UAJD 4Y8DC 2HRLA 3MJ9A 3CVHH 3LB6C 3LN4B 3FRUB 4WY7H 4S2SA 3ULUL 2Z31C 4NQDE 3EDDA 1R24A 4ZAKC 1UWEH 4OGZA 3SCMD 2IH3A 4Y2DD 1DN2A 3HAEH 3X11B 2VXVH 5KVDL 1IZJA 3ISWA 4XT1C 3BGFC 2F19L 5GJSH 2JLLA 4PRHD 1H5BA 4RGOH 1A7RL 2ZSVB 4RFNC 2AJVL 3TO4C 4OI7A 2FJHB 4HWEL 4JFDD 1BBDH 3VWJC 3KPLB 2WWKO 3U0TB 2WM0A 1CBVL 3PWPA 1HYSC 1HHKA 3L3HB 1WAAF 4JM2D 1WTLA 1NFDF 1TJGL 1XGUA 4LRIC 5AYQA 1J0KA 2FO4B 4TSBL 5FEBA 2UYLB 3CAFA 5IQ7H 1BWMA 4ZTOH 3O9WA 2ICEB 1QBLL 3DIFA 1T80A 4O02L 4UINL 3O2VH 4F3FB 4F7TA 3NIGF 1FVDA 2YD6A 3OGOE 4WEUD 1G9EA 1IM9B 5J6HA 3ARSA 5IB4B 2HKFL 2V5YA 1AR1C 4ZXBC 4P2QB 1JYXA 4OLXL 5C09E 1A7NH 5GS3A 4G6FB 3W9EB 3B83A 2R4RH 3TIDA 5JQHC 5F7HA 3D0LA 4XNXL 3UPAA 5FO7B 4F7MB 1OWWA 5DRXB 4OAWA 4MNHA 2ZUTA 1GOGA 1WZMA 1Q9OA 3OKKB 1RUAL 5J13B 3B4NA 1A4KB 1DQQB 4K23H 3L3HA 2FNBA 4ODHH 5CZKA 1G7PB 1TPXC 1G7LA 4UDUA 4L8SA 4L8CA 2FATH 4BH8A 3L6FB 2VLLB 4UQ3B 4L3EA 5L2KE 3IRZA 1LO5A 3MUY1 2CKNA 4FQPA 1V5JA 4QXTA 4D9RD 1WFTA 5ACLA 3RZCA 3T08A 1CI5A 4JN2B 1OM3L 1QQDA 5EUOF 3MJ9H 1HQRB 2CJUL 4L29A 2BRRL 1EV2E 4XVUD 4LNRA 1V3KA 4JHWH 4NN7C 5E03A 5SX4I 2EXYC 5DJ8B 3OAZH 4RBPK 5EOQL 1ZANH 4UT7H 3KG5A 3V6FA 1N8ZA 5E08L 3U4EA 4S1SH 5I15L 4WFHD 2YPKB 3FQUA 3K1KC 4D94A 2ED8A 4LRNH 3LKRA 4JFHE 4OFIA 1S3KH 4JPVH 1UA6L 3SGDI 5BS0A 1Q9KB 2R69L 1P4IH 2D03H 2BCKB 2P8LB 1AGDB 3K46A 3QFJB 4MXWL 1DN0A 3UC0H 2XV6B 4PR5A 1JZ4A 3QDHA 4XWGL 2EDWA 1RZKL 2OLDA 2HFEB 5E94B 1BVZA 4WI4A 3WUZA 4FABL 4LKCA 4BK4A 3F7PC 2W65A 3C6LB 1HXMB 3O9WD 4V1DA 3C5SB 5BZWB 4DOHE 4FZEH 4JAMA 5I17B 3BKYH 3MO1A 4G8GB 2I9TB 1N59B 1WICA 4PJCB 1YEGH 3BP7B 3BKCH 2G5BB 4N5ED 1L9MA 4PJ5D 3ABZA 2K9UA 3JWDC 1I75A 3U4BH 5JDSB 3HN3A 3IJYB 5E6YA 1RURH 4LMQE 3FQUB 3TH3T 1CDGA 4NM8L 3A67H 4IRJC 4KMTL 2AJSL 1WTGT 4R3SA 2CQVA 1EPFA 1JNLH 3BD3A 3KYMA 1MEXL 4JFFA 5IHZB 4WI2A 1RU9L 4E9LA 1BD2A 2DQDL 3QCUH 5CP3A 2PTTA 2DQFA 1KN4H 1F4HA 5D2LF 1SHMA 3L95B 4BSVA 1B4JL 2ZOLA 4JQIH 3D2UB 3WNPA 4NRYA 2G9HA 3C9NB 1HI6B 4G5ZL 4TPRH 4LLQB 3DTXA 4O2FA 1WVZA 3ARGD 2UWEE 1LD9B 1CFVL 1OARL 4HLZG 1I3GH 5DD3H 3KS0J 1JPGB 4G7VH 4R4NC 1C1EH 1NAMB 4JFYA 2MQ3A 3SKNA 5FA4B 3QIWD 1N64L 4ETYA 4AL8L 3BP7A 4QGYA 3PWVB 1KCUH 1WZ1L 3OAYH 5I8EA 3AY4A 1V7ML 3MV9D 1YPZB 5IESH 3QFDA 2ZG3A 5L6YH 5I73B 3WJJA 4NKIH 1BBJA 4QHLA 4P2OB 1F97A 3FO1B 5A3ID 1BQHB 4JHBA 4NN6B 4I0KA 5BW7C 1F3JB 1NMAH 3RRQA 5C1MB 1UM6L 4MA8L 4WFGD 3RGVB 3WCYA 2ZCKH 4JLRA 1T83C 1A1OA 4K3GA 4L4TA 1F58H 3EHBD 3M8OH 2Z8WC 4PD4K 3PXHA 2G9HB 1T5WA 1A6ZB 3QEQB 1K2DA 1IGJA 3AU1A 3MRKB 1V05A 2YA0A 3KLAB 3OKLA 4IOIA 1EBAA 3ME0A 4KMQA 5E2TL 5C09A 1K6QL 3DGGB 1T4KA 3B9KD 1T1ZB 4HMDA 3FQXB 4NJAL 2NY5H 3BESR 5KVGL 3RWIB 3FO2B 5ALCH 4P5TB 4DW2L 4Z77A 4L3CB 3SKOB 3TPUB 4OIBA 5KAQF 5KSVB 3HE6A 3UDWA 2PTUA 4C83B 3RL2A 1NGWA 1A22B 1P6AB 4JLRB 3EOYG 1PZ5A 2H2SC 4L3ED 2RIKA 3T09A 1YEDA 3MUHL 3BSZL 2DLFL 4TVPE 3PWJB 5ECJE 3DX9A 1NBVL 2Y5TB 3RVVD 2KH2B 4DGIH 1DUYA 2KQMA 1BEYL 1NCDH 3RZCD 2AV7B 1S78C 1D5MB 2Q76A 4DZBA 4QYOB 4XNQA 1FLTX 3V4PH 5ID1B 4PLNC 3BH9A 3NCBB 5EZIL 4GRLB 1H9VA 2RJMA 4AT6B 3LSOB 4WEBH 4OT1L 3WNNA 4URTB 5MP6L 1ED3B 1J1OL 1MJUH 2PETA 5CJBA 1CLOL 4GAYB 3IFNH 1JI1A 2R0ZL 1J8HD 5AEAA 2NX5A 5GRYA 1E28A 5EWIH 4HG4K 5EFIA 5FA3A 2JELL 2DWEA 3B9AA 1U9KA 1PKQB 2VDQL 2X09A 1BAFH 3PP4H 3KJ6L 5TGBB 4DK6A 2FD6L 4WV1A 3BD5A 4M6NL 4ELMF 1E27B 2FECI 3IDNA 2KQNA 3O6KL 2XZCL 1A0QL 3QIWC 2DQTH 4YPGA 5GGQL 1VPOH 3AUVA 1D9KB 3E3QC 4QXGH 1WV7T 3I6KB 4Z7OE 3IETB 3VMPA 4R4FH 5DJ0B 1S5IL 3LPFA 3TN0A 1AP2B 2MKWA 3PL6D 5KS9B 4YDLB 1J7VR 4K7PH 2ZUQC 1OAQH 4OCXH 4PFEA 3VGBA 2PCPB 1A6TA 5JIHA 3TWCH 5HYJA 3MCKB 3U6RB 1IGIH 4XCNA 2C4XA 4HUWA 4HS3A 1T0MB 5T5FH 4G8GA 1MI5A 5C09D 4S10A 3WO4B 4NC0B 4DZ8B 5CD5C 4MJ5B 3QI9A 1GGCH 4RAVB 3DVGB 4P9MH 4XAKE 3S7GA 1JV5B 3C6SB 3ZTJH 3MUGA 2Y6SC 2E9BA 1JGLL 5DJZA 1TQBC 3BPNB 3DXAA 3K8KA 3T0XA 4B7LA 2YUZA 3HFML 2IANB 4PREB 4EDXB 5EO9B 2FJFA 5K9QI 3CFKA 1QO3A 4GXVL 3LRHA 4JZJC 5HJ3A 3PV6B 5HYSG 4YEFA 3MSPA 3VWJB 3RX8A 4JKMA 2BVOB 1YN7A 2JIXD 1FVEA 4X4YA 5T3XH 1IT9H 5T1DH 3QQNA 4RGNE 2D7QA 3C5ZB 1A14L 1IGYB 4M1DL 4HMEA 4U1IA 1M7XA 1Z0NA 5EC2B 3G6JB 4HFWB 4YAQA 1QA9B 4OFPA 4OLUH 3GUTB 2R2CA 4C57C 4NZJA 1EMTH 3BIKA 1XGYH 1P7QA 3M07A 5TF1L 4OF8A 1G6RL 3PHOA 2E27H 2DJSA 4KKBD 5DD6A 1CG9A 3AXLB 1S7WA 4DN3H 1R3KA 5JO5B 4HX1A 1FGVH 3JVGA 1MRCL 4C55A 4TSCH 1BZQK 4L4VD 2IANA 5TFSH 3BHBB 3HR5B 2W91A 1AO7E 1EFXA 5CD3B 3PWUA 2VC2H 5C6WH 3ILPB 3P9LA 4JO2H 1JGEA 3SDYH 3VD7A 4PJIB 2AP2A 5FYKU 1R5VB 4ODUB 5GS1C 4JFXB 1NDGB 5IB1B 3LRSB 1BLNB 1JGDB 3ZYJA 3U0WH 5IJKA 1ZS8A 2X4QA 1AKJB 3SHSA 2A6KB 4MVBD 5D9SA 5IBLD 1PAMA 5T1MB 4UBDD 3ROLB 1B6UA 1SYVA 5EC1B 5C08B 2XKUA 1C12B 5HVWA 2MOVA 5ITBL 5FYKE 4Y5YA 4HPOL 2FGZA 1HILA 3UTTB 1FFPB 4YDJB 2VITB 3C60B 3F7VA 5IKCA 3MGOB 1HHHB 1S7RA 3CXHK 3RGHA 3PNWA 4U1GC 3IJHA 5DRZA 4U33A 1A3RH 2CMRH 1WBXA 3ARFC 4XPBH 4ZQKB 1LO4H 1GPOH 1YNLH 3Q6FB 4RFEB 4ZUVA 1MQKL 5I1CH 2A9NL 3FQTA 2XG5A 3NABL 1VFBB 4KRMB 5DVKA 3KWWB 2ENYA 1A64A 2RBLA 3VDAA 1UT9A 1ORQB 4JM2F 5GSRB 3ZT5A 2F8VA 5C6PB 5I1HH 1I4FB 3P73A 2YRZA 1LNUB 4XXCA 5IEKB 1O7VA 3RWFB 4FFZH 3BDYH 3D85B 4NT6A 4MXQD 4OZGF 4FP8L 3IKKA 2JJVA 3QUYA 3AS1A 3T0WA 1E4XI 4GQ9H 4U7SA 4HWBL 4LIQE 3VWJD 4RAUA 2HLAA 2QADC 2FX9L 2YD9A 3QIUA 4W4NA 4PGDA 5EZLB 3S37X 1H3XA 1OGTA 1M7IB 3PWJA 4X9GA 2NYYD 4ZQKA 3PQYE 3GK8H 5F1IB 4JRYA 2F58H 2A6JA 3BOVA 3SDDC 5I1EH 3U0PA 3S3PA 4XCFL 1F3DH 2BDNH 2Z31D 3IETA 1E4WL 1AXSA 4YXKH 1ZAGA 1Q9LA 1XR9B 4IRJB 1NPUA 3QEUA 1U92A 3DO7B 2P46B 2X9YA 1U58A 4KPHL 5HYJD 25C8H 5FGRA 5GHWL 3DARA 3O2DA 5D1QB 4J3OC 1HKLH 2XTJD 2PYFA 4WHDA 1OP9A 4PPTA 5T1LD 3CVHL 5C9JB 3QH3B 1LP9B 2C3WA 2A0LC 3RWCA 4KZEL 3X3GL 1QLFB 5IB2B 1UWGL 1T7YA 2Y7QA 2JJUA 1H3TA 1GOHA 4LSVH 2BNQA 2EYSB 3DVGA 5ADPL 5JIPA 5E6IB 1R5IB 3F6LA 1G0YR 4YX2L 4FQXB 2AK4E 1SJVA 1ONQB 1SMAA 5ACMA 3SBWC 4XXDA 2VDPL 3GO1L 5ERWB 4BQ6A 4NNXB 4ELKB 1LILA 3G6AB 3BKML 4G7YL 3WLWD 4OZGA 4NOFA 4K3EH 1A7BA 5D70L 4TULL 2OZ4A 2BFVH 5J6HB 5EO9A 4HBQA 4ZUSB 1I1CA 3GSXA 3MRPB 1DANU 5INDB 4LPUA 5DJYA 5ESVA 3TBVA 5C0CA 5DS8A 4WU5B 2W0KA 4JDTH 4CVXA 1XFPA 4PJDE 4HIJA 1NGYA 5C8JA 1I3RA 2J7LA 3D0LB 3RAJH 1DDHA 4DAGH 4ZTOL 1JYVA 3L5XL 4NO0D 3SQOH 1UXWA 1LMKA 5EO0B 1EDQA 1T6WA 3D39A 3MZGB 4XP9H 3LRGA 1EERB 1VACB 3C6SA 2R0WH 4IOSD 4JY5H 1FZJA 2Q6WA 1CK0L 3PF2A 4X83A 3CFCH 2W38A 3QUMH 2WBJA 3WSQL 1E6OH 4UQ3A 2DLTA 4Y1AD 1R3HA 2XN9E 4X5LA 1IBGL 3B43A 1D6EA 2BY1A 4L4VA 4RGMC 1JI2A 2X6MA 2Y5EA 3GMLB 2FWOB 4NQED 4RQQA 1YPZF 3R8QA 3C5ZA 3KPQA 1IGML 1ZMYA 3LIZL 4F33B 2PXYA 2DBLH 1NGZA 3O3AB 4HWZB 5EBMA 2IALB 4MX7B 1LO0L 4KTDH 3HNVH 1GAFH 3VFTB 4OF7A 1UXSA 5J8OA 2EDLA 4RRPA 5D7IE 1Q1JH 4D9QE 3UPRB 2OTPA 2QSCL 3KGRA 4RA0C 4WU7A 4N9GB 3S3JA 2M1KA 3OKEB 5BVJA 1IQDA 2HJKB 4NQUA 2X9XA 4PR5B 3X13A 1IGCL 2CO7B 2WZPD 3HG1D 2XY1A 1T20A 1OAUL 5EOQH 3GBNH 1HE7A 2DQGH 4NC1C 4HKJA 1CL7I 2HLFD 4WDIB 3OAUL 2LAAA 2M26A 4WGVB 3CLEH 1CD1A 2MNUA 5HYJE 3P0GB 1XGRB 2B4CC 4U0QB 3R4DA 2EDYA 2DI7A 4IBLT 1NGZB 3BDBA 2R69H 5A3IC 5T1MA 1H8SA 5GSRA 3EZJB 1RZ7H 4OD2A 4L9LB 1RUKH 1FO0L 4XWGH 1EO8L 5ACZA 5AZEL 1UZ8B 5I1LB 1PG7L 2XN9B 3TV3H 2CGRH 3OKMA 3VFMA 5C0EA 4BKLA 1A7OH 5HYIA 1RJYB 1EBPA 4ENEC 4H8WH 2Y25A 1N2RB 1PYWA 3MMEB 2HFGL 3FFCE 5F88A 1BQLL 2GSGB 3DI2B 4PV9B 3IJHB 4P3CL 1X5AA 4FFYL 3VXNA 3NIDE 4R90H 4DKEL 1KPUA 4H1LG 4L1HA 1N5YH 3VG0H 3DX7A 1KB9K 4HJ0C 1J1PH 1A6PA 3MLSL 4PRAB 2C1OA 3HAEA 3U4BL 4MNQD 1K5NA 5ICZB 3SCMA 1CS6A 2NY5C 1VCAA 4G8EA 4QNPE 4XVJL 3EYVB 3GI8L 5CUSL 4JZOA 4KJPD 4P3WA 3CCHA 3BZDA 1ZEAL 4MCYA 2B2XL 5HHMD 1YMHA 1F2QA 3M1BB 2XZAL 3ULSA 1RI8A 1ETZA 2VR9A 5D1QA 2UUDK 1T1ZA 2XRAH 5BO1L 4F7CA 1NCAH 5CIPA 1QFUL 5HGHA 5DD0H 4MD5A 4ZSOB 3C8DA 5E7BA 1MHEB 4TVSa 2B39A 2UV3A 5F7WC 3PGFL 1DBKL 4PLJD 1MNUL 1XH3B 3NTCH 1ZE3C 1J12A 3R0MA 1B88A 4M7LH 4D9LL 3RVUD 1BOYA 1EXUA 5HHXL 1R5IA 2Q8BH 1E6JH 1H15A 1IKFH 2BHYA 5EORH 4X6DF 4NSKA 4JVWA 4UT9H 1X4XA 4Z6AT 4NKIL 3BT2H 4HDIB 4DZBB 1U58B 4HUVB 5CD5D 4X80L 1FG9C 5D1XB 3EYFB 1MCBA 4JJ5A 4LAQH 3G5ZB 1F42A 4NUJA 3JUZA 1AGEB 5CCKH 3BXNB 3TJEH 3IVKA 5EBWA 3MRBA 5I8KH 1JNHB 4Y2DA 1MUJB 1MREH 1I8KB 3ZT6A 2YZ1A 1FE8H 3CMOH 1D5IH 3RL2B 2B4CL 3VFWB 3O3DB 1S78D 1CFTB 5E2TH 1L9NA 5IM7A 1GGUA 1H0DB 3BUYB 3WD5H 3ARDC 2VMFA 5JW3L 1YEDB 3C6LA 3W9DA 1P7HL 5T3XD 3CSPA 4RMVA 5HHPB 5J06A 3VG9B 3CFIC 4ZPVB 3HR6A 3VFUB 4XP5L 3W2DL 3MOAH 4XCNB 1U6AH 4FTVA 1GIGH 2F74B 4YPJA 4Z7UF 1DQTA 3IFLH 1IFHL 1BFOA 2AXJA 1DBAL 3F8UB 1AFVL 3SPVB 3VJ6A 4KAQH 3QEQD 5GJTL 1TZGL 3PV7A 3HB3D 5LBSH 1UVQA 1JRHI 1CT8A 4FMKA 1QFWM 4QOKB 2DM4A 3F58L 1I7ZA 3V4UL 5TDPB 4CVZA 1WLHA 4X0KB 5IQ9A 1VFAB 3V7MA 3D2UA 2HRPL 2K7PA 5HI5C 1FIGH 4JPWH 1MCJA 3VH8B 3UCRA 2VH5L 5IBUB 2IBZX 4Y5XC 3SO3C 1NGPH 4XP1L 3EHBC 4HCRH 4HXAH 3QP3A 3DMMA 3MUGB 1JK8B 5DC4B 5J56B 3BZ4B 2AGJH 4PJHB 4N68A 3SKNB 3BGAA 3VXRA 4C56A 4TVPL 4NHUA 4W68A 1BQSA 2E8YA 4X6EB 5FYJD 4OJFL 2ED9A 1BVLA 4MJID 1LO3L 5F3BA 2DQJH 3S35X 2UZIL 1NEZB 5D7JA 1F5WA 3K81A 5EC2A 1MCWW 5MI0C 1VGKB 2APVA 4PGBB 5KANI 1AE6L 1MPAH 2EZ0C 2WW8A 4NC2B 2X70B 1XF2A 4UUJA 4Y0GA 3TBTA 4ZO6A 4YDVB 3KPSD 4GKSA 4M7LT 3M45A 5K33A 1S7WB 1KG0A 5T3ZH 2AEQH 4PV9A 3JWOL 5B8CC 2VLKA 4GBXC 5ENWA 1RSFA 5C0JB 4DUVA 4NQEE 1DQDL 2NZIA 4X99A 3RGVC 2DQHL 3I2CL 1B0GB 1NKRA 4G6JH 1HOCB 4D2NA 1ZHNB 3X11A 4KVNL 2F53D 1FVEB 3C09B 1H3WM 5IJVA 5J9PB 3U2SB 1EEZA 1HNGA 1SBSH 5E9DB 1F4XH 4LCIL 1AHWA 7FABH 2H8PB 1H5BB 1IC4H 4CUCA 5DLML 3F12A 4MJIE 4E0RA 1A2YB 1GL4B 4HIXH 4P5TC 4HIEA 4QCIA 4K9EL 5FYJE 3CC5A 2EKSB 3WIFB 1XF3A 4NPYB 4H5SB 5E5UB 3S5LA 3BN9C 5IBTH 4AZ8A 4MD4B 3GFUA 5IOPA 3H3PL 5L88H 2BOBB 2CIKA 1CDUA 4XX1E 3O2DL 1EGJH 1FFQA 1IT9L 3RWGA 4M4PA 3IU4H 1A6AA 4OZHF 5EUKB 4WW2F 1K4CB 4KXZI 5A2KH 1MRDL 2ORBH 1JP5A 4I8DA 1AQKL 5IG7A 2LTQC 1T04A 3EBAA 3C60A 2Z93B 3NCCB 2YD8A 1FO0B 1D6VL 2X41A 3IDJB 4PTUA 2E3VA 3EOAB 4G80A 2R4SH 5DK0A 2ILLA 1T7VA 1TQBB 3VFPB 3QEQE 5CJQH 3C6LC 3P2TA 1UYWL 4A6YH 3PWLA 5DMGD 4M6MH 1DQML 3QZWB 2JJSA 1MRCH 2IAND 5BV7H 2AJ3B 4X6CA 3UO1H 1KB5B 5ALBH 4F57H 1A2YA 2OCFD 3RVTC 4XMPH 4K55A 3G6DH 5EIQA 4GW5A 1JWMB 5L8JB 4LLDB 5F7NC 3Q48A 4JKPH 2WBKA 4Y2DB 3QRGH 1U8MB 3SO3B 1RIUH 5M95B 1CFNB 4QRQA 4I2XB 1HHHA 1S7RB 3I6KA 1JV5A 4N0FA 5DGRA 3VDCA 1I7TA 3T0VA 5K93A 1J9CT 3KDMB 3FONB 3LKSB 4OGAD 3AREB 3MV9E 4Q9QL 2PO6D 4YEEA 1FAIL 4GG6A 3MBEC 5DJDB 3HA0A 4YFLF 5AG8A 3TBSA 5KTEH 2F5BL 4MDJA 2BC4A 4P2QA 5GSVA 3D25A 4AM0B 3LQAL 1SM3L 5EH1A 5EIIA 2APBA 4N0RA 2V2XA 4Y16D 3HE7B 4I77L 2FIKA 2Z4QB 5HVFB 4PJBA 2PTVA 3HUJE 4PJGE 3H3BC 4XGZA 4XBEH 4PJAB 5TE7L 4NQEA 5B39A 3SEPA 2ZCHH 1MCNA 2GSIA 5GGTL 3MUZ1 1W8OA 5GRJH 1CE1L 3PE9A 3BJ91 1HHGB 1JBJA 2ARWA 1WWBX 2NY6C 2VISB 4PRPB 1QSFD 4KUZL 1QFPA 2A38A 2AI0H 4D3CL 5JMRA 5JIIA 1YNKL 4ZOBA 5GGRA 2DYPB 4I0CC 3SE4C 1XGQB 3ZE0E 1G0DA 3FTGB 4JZJB 1OT1A 1JHTB 1Z9MA 1F4AA 1OAYH 2A1WL 1KPRB 3TO4B 3LCYA 1YUHA 2YS4A 4B0MM 4QXWA 4ODVH 1DL7L 4MHHI 3SOBL 3HZVA 5HGBB 4TQEL 1UVQB 4GQPH 5KG9A 4BZ1L 4XZUB 1CXHA 3OR7A 3DHJA 2AQ1A 4K07A 3OB0K 4LU5H 4KJYB 1NQBA 4KJQD 35C8H 5HD8D 1D5BA 1T5XB 4UTAH 5I1EL 5DEGA 3HE7D 5AUMA 5JO5A 5I1GL 3QG6A 3B6SA 3KPSA 2HTKD 1S7QA 43CAB 2X4OA 3VFVA 2R29L 1L0XA 1Z3GL 3VXPA 2HFEA 4HK3N 3MLWL 3HNTH 4N5EC 1RIHL 4DFIA 3FQWA 4M5YH 3S96A 1KC5L 4Z7OF 5B38B 3T3ME 4P5MB 4QRRB 4JGMA 2KBGA 2IQAA 3CMGA 4RQQB 3UZVB 5IVXF 2J5LB 3UTZA 5DMKB 5KVEL 2OTWA 4YHLH 3IXTA 5FB8B 4H20L 3ULUH 2JJTC 1FBIL 3T0EB 2ITDB 5E5MA 2W9DH 2O5ZL 2QQQA 3TNNB 1QR1B 4K7FA 2P5WB 2I60H 5JR1H 5A2IH 3ULVF 2H8PA 32C2A 4ACPA 4D9RE 1L7IL 3G9VA 4PGZA 4V2CB 1I8IA 2FYYB 3BKMH 3L7FA 4I0PA 1Z9OA 3DWTA 1FL3B 5FF6B 2XA8H 4FQHA 3WXVL 3IDGA 4WWKB 3L3KA 2AAVA 2XNAA 4MWFB 1BBDL 2Q3AA 3AREC 4NM4H 3SKMA 5CP7B 3ZL4H 5IVZB 1FYHB 2PYEB 1RULL 3TZVA 3L95A 4ZS7L 1NFIB 3JTSA 2UZYB 5I0DA 3OKNB 1FNSL 4GRWF 4LLUB 4PRDA 4PB0H 3VGDA 4OSUH 4X4ME 2IG2L 4HJGB 2KZWA 3C08L 4FQLH 4LDLB 2X4UA 3LEYL 3B9EA 3GBLA 4GRMB 3ARBC 5CSGA 5BMFL 2ERJB 4UINH 1G7QA 3EOAA 3HE7C 2Z92B 2XOTA 1CK0H 1KENL 5GGSY 1FH5L 2NXYB 2AV1A 3QUML 5MEOB 3T0EA 5JHLH 5D93B 5GGVH 3D39E 3CC5B 3H9SB 4OLXH 2VLRE 3I3EA 2I9LA 4RAUB 32C2B 5F9DC 4KC3B 4TNWK 3V0AC 4OFYD 5BVPL 3VRIB 1ZTXH 3O9WC 5KSAB 4GFTB 3UYOD 3W82A 3D3VD 5JMOC 1KYOJ 3LZFH 3G08A 5F89A 3KHOA 4P23C 3FT2A 2BNQB 4U2ZA 4Y1AE 1SEQL 3U0PB 3SDAA 5DRNA 4BELD 3U46B 3OG6B 1AGFB 4NKDB 5DK0B 4I2XE 1F11B 5D7LD 4OFVA 5DQDH 2N1KA 4KUCD 1KULA 2F54A 3IDUA 3EO0B 3LPGA 4PBVC 2AXFB 3VDBA 1UACL 5HVHC 5DJYB 4MDIA 1NCWL 4Q6YA 3MJ9L 1I8LC 3J7HA 4LSQH 4APQA 1N0XH 4Y16C 1OAUH 1FRGH 2B0SL 2R2EA 2UUDH 2Y06L 2OL3B 2NX5B 2NQCA 4XNZC 3EYOB 2EC9T 4YHPB 1F6LL 1PEWA 5CIPB 4QRSA 2DWEB 1MIEH 3BFOA 4P23A 4Z7VB 1ZANL 4UT7L 2AK1L 2E6JA 3E6FB 3JV5A 3LVEA 3G04A 4M4RA 3IYLW 2R0KL 1ZHLA 3B5GA 4G8IA 1DBML 1MFCL 1GGYA 1T3FA 5EU6B 4JPVL 2M8XA 1S7TA 3FB6A 3CVHA 4JRYE 1KCLA 2E6QA 5T1KD 3FQNA 4XMKH 1IC7L 1Q94B 4XPTL 1K9TA 2AV7A 5IR1B 2O5XL 2HFGH 1DLHB 3QDGE 4X6FB 2OP4L 4GRLA 3VXTB 4UV4L 1KJ3L 1PKOA 4NFDA 3L3DB 1EAPB 4DKEH 2BVQA 4X7SL 2EDOA 3GMOA 3MREA 4AENA 4HC1H 4Z76B 4IS6A 4CVWA 4FZEL 1I1AC 3LS5L 5GZOD 3IAGC 4OM0L 2OZ4L 2EH7L 4RGNC 3PGCB 1UXSB 1UFUA 1E28B 2A74B 3BW9A 4GJTB 3ES6B 1KOAA 2X7LB 3O41B 4JB9L 1XAUA 4HIHA 4HLJA 4XPHH 1PG7X 3DBXB 4XNYL 2VXSH 5JHDE 4MQXC 1E4XL 4OCRH 1SYSA 1ZEAH 1S7TB 4U7MA 4LPWA 3C60C 1IM3A 3QIWA 4HT1H 5HHNB 2HT3C 1VKXB 2CUMA 4JEGB 3MGTA 1G9MC 1X3DA 3BEWB 3FO0H 4ISVA 3VXQA 2OJZH 2AKRA 4JQIL 1EEYA 5DRWA 3QDMA 1QBAA 2FJFB 1KN2L 5I19H 1KPVA 1XMWA 3PWNB 5SWZA 3ZE2E 3T2PA 2P24B 3LS4H 2O5YH 3NCFB 2AJUL 3O11B 4NO0A 3T04D 2VDML 1FNHA 3NIFE 4LDOB 4M7LL 4U49A 3WLWC 5FYJU 2FEEI 2FHBA 2W65B 3IDYB 5I1AA 3OKEA 1YEKL 4DK3A 4HULB 4EUPG 4ZFOL 3QI9C 5TDPA 4CVZB 1JZ8A 2I24N 3KXFD 4XMLH 4O2EA 3RTQD 3V5DA 1GC1L 3KPRD 4MS8C 1ND0B 1GH7A 5ABDE 3IGAB 3RL1B 3SE9H 5HXMA 2HN7B 5KAQG 1A9BA 1BHGA 1QO3B 2P8PB 2Q3ZA 2D7MA 4P57A 4JVUA 5GRVL 3QIBD 4CGTA 3ARFD 4K3JL 4RMWA 3DV4A 1QFWI 1B4RA 5DQJB 3BKJH 3DX8B 2JK5A 3H42L 4FHBD 3V8OA 1FE8L 4U1KA 5HYFA 2PTTB 1EFXB 2C26A 3MRJB 4K7FB 5L8KB 4YGAB 2FX7H 3WDIA 4Y4HB 4MA3B 3VFMB 4O2CB 4ZUTA 2BY3A 3UBXI 3MCG1 3CZFB 1U8QA 4RCAA 4LL9A 4P2RE 4XHJD 1RUMH 5BRZE 3A6BH 1N6UA 2V17H 4HKBA 1J05B 3ORJA 3M1BA 4J3WA 4YHZH 3RKDC 1NMCC 5HBBA 1RZGB 3O6ML 1F4WH 3GHBH 3LMJH 1T1WA 1ZT7B 3TF7C 1C12A 3MGOA 5FUZH 3B8YA 5TDOB 4HBCH 3OKNA 1EZVY 4N8VB 2CDGA 2F8XC 3E6HB 1BOGA 1WIUA 3PIQA 1K5NB 3QIUC 5ICZA 1NLBH 2ADJA 1BX2B 1RJZA 3WXWL 3NIGE 1A7PL 1HH9B 3KWWA 3U46A 1WK0A 4LLAA 5DUBB 1G7IA 4CN4A 4PJIA 2D9QB 3UTOA 4OCYH 2BJML 4WTWA 5D7KD 5T5NG 1G1YA 1R3IH 3LRSA 3H9SA 4O4YH 5E8DL 4G9DA 5KZCB 3B9KA 4IJ3C 4X5WA 1ZLWK 3V0VB 1QPXA 1FIGL 4JPWL 3UXFA 2J12B 4X7FC 4K8RC 2ICWB 4DJMA 3MRFA 2NY1D 4ONHB 5HGDB 4ZSOA 3G6JE 4HKBB 4NHCH 4HCRL 1JF5A 1CD9B 1A4KA 2AERT 2V7HB 3GJFH 1QKZH 5FYKH 3TFKC 2AGJL 1YY9D 2FSEB 4LCYA 1A9EB 2CLRA 4OLWH 1KEMH 3O45B 5LAXB 5HPOA 1QBML 1F3JA 2O61A 4Y4FB 4QHMB 3GSOB 1BJ1J 2DQJL 4NSKB 3ARQA 1A7RH 4MVBC 5IBLC 4W6YB 2C4FT 1NBZA 2QHRH 5JHDD 5BRZB 4YNYB 4GT7A 3SGDH 1IGJB 1VPOL 3AU1B 4JDZA 3O8XC 3MXWL 1A5FL 3MTRA 2DDQH 4HZLA 3ZDXF 1DQJB 1HCFX 1IKNA 4APQB 3DECA 4G6MH 4DQOH 4MXVF 4LVHC 1JNHA 3GM0A 4RDQF 5EBLB 4OCXL 1NGXB 4CVUA 5F9JA 3V5KA 4G9FB 2MHAA 3L1OL 5E9DE 4HZAA 5K59F 3WLBB 5KSBE 5TDNB 1DSFL 3QQ4A 3BQUC 3DRQB 3KPNB 4X98B 4Y89A 2H3NB 1YYMH 1X4ZA 1FL6A 4TN9A 4OTXH 3S35L 3T0AA 4GKZB 4KQ3L 5MEQB 5KSVA 3V6FB 3KYKH 3WJJC 3DETC 2AEPL 2F53B 1D7FA 1A7NL 43C9B 1PFCA 1HK6A 4FQCH 3JUYA 3A0OA 2VXVL 3ZDXE 1W72A 5KVDH 2EO1A 2F54E 2A6JB 3D6GA 3RWEA 5FHAL 2VQ1A 1FSKB 3ARBA 4MA1C 2BHUA 4U6XB 2ZUYA 3Q5TA 2HMID 3V6OA 2DIAA 3VXUA 1AXTL 1KJMA 4D0BB 5MENA 1P5UA 4ODHL 1MH5B 4PJCA 1IAIH 3OPZL 5EBGA 1CBVH 4W4OC 5DJ8A 4PGJA 1TETH 3C5SA 1U3JA 5BZWA 3RKPA 5INCB 1XF1A 3QUZC 2BVYA 4HS8L 2ORBL 4X9HA 5JDJA 2HT3D 4O5LL 3LKNA 5HYQB 2EH8H 2DQCL 2PYED 3GSQB 4PRHE 4PJ7B 3O2VL 4WWID 3HZMB 1HXYA 2FR4A 1U8KB 1AGDA 1Q72H 5CEXA 2NXZD 3WKML 1TENA 1N5AB 1U36A 2YPLA 3BZFB 4G42B 4N90E 3RVXD 4BFEA 3GSUA 4P46C 4TTGA 2R4RL 3RZWA 4L8SC 3GB7A 2ESVA 3G6DL 1IEAA 1BPVA 3MRGB 5I76A 5DJ0A 2D0FA 5E8PB 1J10A 4PJDF 3C9NA 4NC1E 4OQTH 3MOBL 5E1HB 1A6VL 2FL5A 2IJ0C 4N0YH 4I3RL 4QGTA 3NACH 1I1AD 4OLZH 1RIVH 1NL0L 1S5HB 4UDTB 3TA3C 4MAUH 4M61A 3PDOB 2B1HH 1ZA3B 4F7EA 2EZ0D 3OTTA 2J5LC 5EZJB 3SJVE 1CFBA 1IAIM 2Q6WB 5F7UA 3MCLL 3OJVC 1NLDL 5DEZA 1OM3H 5ITBH 1ADQA 2NY6D 2VL5B 3DX6B 3H9HA 4HPYL 5I9QC 3OKOA 2RR3A 4YQXH 5TDOA 1RZFH 3VXMD 4WFGE 4JY4A 5AYUL 2DJUA 4RIRB 4JFPB 1KCSL 4JZJA 2ID5A 2XIDA 1SJEA 4GBXB 3ZYIA 1EK3A 3A67L 1R0AH 5E08H 4Y4KB 4PIRF 3VWJA 2X42A 3W11C 3WFBL 1MEXH 3BHBA 4Q6IB 3J8F7 4ZODA 4HIEB 4QCIB 1I8MA 1INEH 3EAKA 3JTTA 4PYHA 4P3DA 3HC0B 4CNIA 3B9KB 3V0VA 5C0EB 2OTWB 3GMRB 1FFOB 4KXZH 1QRNA 2X4TB 1AXIB 3SKJL 3I6LE 4FFZL 1J1XL 4ESKA 1W2KT 3CSGA 5I30H 1MHHA 1KXTB 3RGVA 4S0TD 5I66B 3NBNA 4NBYB 4OM1H 4I0PB 2PYEA 4FQIH 1Z9LA 2ZKHL 3KYNA 1JNNL 1ZLWH 4HWBH 1LQSR 1I9EA 2XNAB 1OY3B 1T0NB 1Z5LB 5FYLL 3MA7B 4LCCA 2VNCA 4JY6B 2MSPA 3W39B 4M03A 5M7QA 2YSSB 2SEBA 3VD9A 1KELL 4OZHE 1DEEA 1I7UB 2WAHA 3LH2L 3UTQB 5F7DB 3SE4A 3BZEB 3Q6FA 3LHPL 1JNLL 1JCKA 1RU9H 1ETZB 3HNTL 3GHEL 4XNMB 2X4NB 5BS0D 4ZO7A 4CKVX 2OMBA 4XP4L 1RZKC 4MLIA 3QUYD 4YZFE 4BQ8A 1CDJA 1JHKH 5CBEB 1B9ZA 1SQ2N 5IW6B 4R96B 3QIUD 3T1FB 3VW3H 1I7RA 1S7XB 1KUMA 3FT2B 1HHGA 2CUHA 4JRWA 4M8VA 4YHOH 5GRUL 5ILTH 2W9DL 5C0ND 5FO9B 3HG1E 4OZIF 4UOW0 3NFSH 1J11A 4XHQA 3CXDL 3GIVB 4AL8H 2NNAB 1DFBL 4JY6A 1ZLSL 4EBQL 2V2WB 5DUPH 5L2KA 1QZ1A 1A1MB 1RUQL 1IM9A 4KMLB 5DZLA 3WBDA 3KPMB 4K94H 2D9CA 4XI5D 3MBXH 5F9JB 3IXAA 4J7RA 5DURB 1T2QH 2P43B 5SWQA 4WI3A 4ODTH 4Q9RL 3MFGB 4I9WD 3QO0B 1CFQA 2C7UB 4RWHA 3HCVB 3TC9A 1E4KA 4NUGL 4DGIL 2MCG1 4FQLL 4RWYH 4RZCB 4MMZC 3HMXA 5F8QC 4ZSOE 4NGHL 4A6YA 4K3DH 3UTSB 1JUFA 3SQOL 1A1NB 4L3AA 4G9FE 2V5MA 4S1DC 3T0ED 2NXZC 1NFDA 2BSRB 3VFWA 3W9DB 5J6GB 1UB5A 5EUOB 5EDXA 3GGWB 1WT5C 3O8XD 4KKLC 4GSDL 5ITFA 4LQ1A 4WWKD 2F15A 2XI9A 1F02I 2ESVD 4YXLH 1YA5A 2MMXA 3WDHA 1BAFL 3AAZA 4Y8AA 1S8DA 5JOEA 1TZIA 5B3JF 2P8MB 4NN7B 4QXTB 2J8UF 3IDMA 5CILL 2AQ2A 3RNQB 4XNUH 5TE4L 4ZYKB 4JN2A 4QXGL 2GITA 3OMZA 2JJWA 5EU5B 5D7LB 4C59B 4YIQB 1FL5A 1A6UH 5ANMA 3GUTA 4KRPD 3KJ4B 4J4PC 5E8OA 1MCEA 2DICA 3O3BA 4CMMB 1MFDH 4KVCH 1OWRM 4P4RB 4JREB 1WZKA 4FZ8H 3REWB 4MNGA 1T2JA 3D48R 2AK4D 4XVSL 5HHPA 4TSAH 4WEBL 3BZ4A 3LD8B 1IRAY 2APWA 3NVQA 4FQQB 4K71C 3ESUF 3N85L 2BCKA 3IFNL 3DYOA 3LEXA 5EU3B 3NZHL 3BIAX 4CU7A 5DD5L 3UTPE 1VGEH 4EIGB 2ZOLB 2P8MA 5CBAB 3CLEL 4M8QA 3U30C 1HI6A 4KWUA 3Q3GB 2FD6H 5C70A 5MEOA 3MFFA 2GYSA 3MV7A 3S88H 2P5ED 2DL2A 2JKXA 3U48A 3LN5B 3WNLA 1JGDA 5K9KA 1MCCA 4TYUA 1Q0XH 5GS1B 1IL1B 5I17A 3TIEB 2VXTL 5B8CB 1NSNL 1L6XA 4EVNA 4XPTH 1U8IB 1XR8A 4MD0A 3T1WA 2AK4A 1K3ZA 4Y2DC 3GMPA 3UZQA 2CUIA 1P4BL 2J8UA 5SWZE 3VXRE 1FYTA 4NO3A 1FFPA 4P3CH 1Y0LB 5D1XC 3FQTB 3QDME 3QWOA 2A83B 3LS5H 1UH4A 5CFHA 3RPIA 3AB0C 5F3HB 2OZ4H 2QQLL 3RIFK 4NP4L 5JXED 1BF2A 1EHAA 4U6HB 4LCCB 2E27L 4U6YA 2VZSA 1BD2B 4L5FL 4F3FA 4KDVA 1I9JL 4OF3A 2XPGA 4NO5A 4P9ML 4LSPH 3RVXC 4HWZA 5EBMB 3DX8A 4OCRL 5T33L 2X4TA 4ZDHB 2D0HA 3H9YA 2OL3H 1NMBH 5IIEB 3PWVA 3W5MA 3WO4C 4PB9H 4WO4A 1BM3H 1HYRC 2X4NA 4L3EE 1P53A 1KBGL 1T1WB 3KYNB 3IU3A 5MEPA 5D7KE 1KF9B 3TESA 4OI8A 3P0VL 1VESA 3MACH 1QFUH 1U8JB 3BYTA 4ELMA 3LS4L 5T1DL 3BPNC 1U8HA 2BMKB 1IE5A 3QDGA 4KI5D 2CXKA 5F3HA 1WGOA 4FQ2H 5F1NB 3UTQA 3U36B 1WF5A 2DRUA 4KJWC 4YBQD 1IAOB 5CSBA 2AEIT 5C0RL 1MI5D 5EORL 1XGPB 4X4ZA 3QPXH 5J1TC 1W72L 4IEFB 3F12B 3LOWA 1AHWC 3S9DB 4JFDB 4NCC1 2X4SB 2N7BA 3R8BB 1FC1A 4KHTH 2EDDA 4LAQL 4JM2B 1G7PA 3SDAC 2A9MH 1I7RB 2QHLA 3I75A 1J0HA 4OKVA 4CW1B 3VFRB 3V8CA 3CVHB 1ZT1A 1A6AB 3MBEB 1Q8MA 4WHYG 4NZUH 1D5ZB 1A9EA 4WW2A 4J8RA 1X5LA 3VCLA 5IFJA 5KVFL 4XCYB 3V0WL 3TH2T 2W60A 1C5BL 1MELA 4HFUH 4XP6H 4WV1B 4XXDB 1VKXA 3Q6GH 4UNUA 3ZSSA 3L3DA 1XH3A 1LEGB 1MF2H 1F4WL 1RQ5A 5CWSA 5AWNH 4WW1A 4YHNB 4ZNCD 1UQSB 1CFQB 1DDHB 4YHIA 4NQDA 2EE6A 2VQUA 4GAFB 3RNKB 1ZK9A 4IMKC 1CF8L 1ZXQA 3BEVA 4XPAL 2ICCA 3THML 1NGYB 1A3LL 2A77H 4HUVA 1FLRL 3T2NH 3T77A 2IANE 2A9NH 1JL8A 4HC1A 5T3ZD 2YOCA 1FL5B 1CGSL 2HTLC 4HUMB 4KAQL 5LBSL 1TZGH 3VFSB 5K9JH 5DHYB 4ZUWA 1FIEA 4MGXA 4O4YL 5E8DH 3MYZA 4ONFH 4H88L 2CLVA 1YMMA 1HKLL 5DHXB 2D2OA 1OPGL 1F3RB 5GS0D 4X7TA 5DMIH 4JFZH 1SJXA 4PRPA 5CJ8A 2NXYD 3RY6A 3VRJA 2W60B 3QWQB 5MHSD 2EXWD 2PXYC 3STZA 3IDNB 4NBXB 2W9EH 4LLQA 1TZHA 2E7LC 3W0WE 4JANB 1MHPL 1CU4H 4X8JB 2LV4A 5D7LA 3S8WA 3VXUB 1DVFD 4JDVB 4J3XA 1FZOB 2DQUL 4PRIB 5I8CA 3CDGB 4EJ1C 4KUCF 2B1AH 5TDNA 3IDYC 5GJSL 3B2UD 5HYQA 4MAYB 1FL6B 1P5VA 1INQA 4R2GD 3U6RA 1TQCC 3OKDB 2F58L 5IHUL 4NKMB 4LSTL 2DDQL 1OHQA 5IT2L 1MJ7L 3REWA 2P1YA 3DUSB 1F8TH 15C8H 1MFBH 5L0QB 2JB6B 4I48B 1TJGH 2HFFA 4JFHD 3Q5YA 3ZKND 4E41B 5T3ZL 3H7BA 2C3VA 3RDTA 4WFHE 3JWOH 1PKQE 2ZUSA 3QSKB 4I3GA 4F2MA 3UTSE 2BRQA 3GJEB 4KK5C 1CXIA 4Q9BA 1E4JA 4JY5L 3KYOB 3OB0H 5CHNB 3S35H 3X3GH 2AEPH 4QRRD 2YC1B 1OSZA 3VFGH 3FHQA 3FRPA 4P46A 1DJSA 3OR7B 4XAWL 5GS0H 1X7QB 5DD1L 5E2WH 2DIJA 2VDNL 4OIIL 4KKAC 7FABL 3GO1H 4BZYA 3GJFK 3DLQR 4R26L 4WO4B 5F6IB 3N06B 4IRZL 5AD0A 2HP4A 1N3NB 1A1OB 3RU8L 5LGJA 3P3YA 3VXPB 3QWOB 4TVPD 4HWEH 1CXFA 2IFGA 4K7PX 2APTA 4KTDL 5D7LE 1U95B 2NR6C 4JDTL 3UTPD 5JNYA 5HHOE 4LASH 3DMMC 4N1EA 2YBRA 4RISL 4JKLA 1XF5A 1DBJL 4IHOB 1G84A 1UGNA 2VITA 3F7VB 5D93C 1YMMD 5CJOL 5C0BB 1KJ2A 4MZ2A 4EI5D 5IQ7L 3RFZC 2XYCA 5FB8A 4ODXA 1TCRB 1D6VH 2R0WL 1U42A 4F7TB 3VA2C 3BVNA 4NRZA 4J12A 3BH9B 3S5LG 5BQ7B 3FB5B 1IC5L 4M48H 1FVCB 1UYWH 4WNQB 2DQGL 2YD7A 2D31B 3ECBA 1FL3A 1SYVB 4EXKA 4R7NA 1NDGA 1EA9C 1TFHA 2H3NA 4QWWD 1DQLH 2D7TL 3AFLA 5DEFB 3WE6B 5ISZE 4OAWB 1UKQA 5IWLA 1SJHB 3T3PE 4TOYH 2GCYA 2P5WD 1JFQH 1HWGB 3BDXA 1WJ3A 1CWVA 4EEEA 4OLVH 2D03L 1X6NA 3ARZA 1KTRL 1A7OL 5C0CD 2X4UB 5H2BA 5JUEH 1OAKL 2VLLA 1T22B 1ZVSA 1I1FB 4U1MB 2FX8H 3ZKSD 3DIFB 5EOTB 4ODXB 1LDPH 1X5FA 5GISH 3DOSA 1YMHB 4JGJA 3NMEA 2EDEA 2OMNA 3GJFA 3T0EE 3L3GB 3SBWA 1FO0A 4OBSA 1M05B 2XT1B 3BKYL 2PKDA 4FNLH 2X1OA 4YQXL 1MFAH 3EYFA 4NQDD 2CJUH 3UBXG 4XPGH 3RUGF 2DMCA 4ZFGL 1OCWL 2CDEA 3TBYA 4GG6F 3GBNL 1J0JA 1YJDH 3D1MC 1GZQB 3VI4E 4X4MA 4OGYL 4NPYA 3UJIL 3RWFA 5F6HJ 1UH3A 4ELME 2YD3A 1MUJA 2ZP0T 3NA4A 5FM5M 3O2WL 2EDNA 5IFJB 1CD8A 3U30B 4Z7WF 3TN0B 3KVQA 1J8HB 4PJXA 5FHBH 3QCUL 2CRZA 4ORGA 4EUPH 3IAQA 3QFJE 1PG7H 4P2RD 3SDCB 1IEAB 1MIMH 5K9OB 5GRWA 1MCDA 4HEME 2XWBA 4ODSH 2FBJH 4OZGB 2I26N 3MODH 4FABH 3PWLB 2GAZB 1RZIB 1OB1B 1X5KA 1LEIA 4RSVA 2H1PH 4LPCA 4ZAKB 5FOJA 3B2UC 1Q0YH 3PUCA 4I18B 1IKFL 2A6DA 2IPKA 4WUUE 5C0AA 2FR4B 5BZDB 4RFNB 1N59A 1H3VA 4X0KA 3TT3L 2L0DA 4EI5B 3QRFM 2Q8AH 5DK2A 3C5JA 4JPKH 1F3DJ 3GB7B 4LCWE 3ES6A 5FOBB 1P84K 5FO9A 2P5EA 3HZYA 5I1GH 5IB3A 1RVFL 3QQ3A 1F6FB 5E94A 5HJ3B 2ZCKL 2BERA 1QSEA 4M6AA 3B3IB 4NHUB 2RHEA 1A1MA 1S9XB 3RI5K 4FQXA 4BM7A 1BVLB 3KJ4C 1KN4L 2OM5A 4NZTH 2XRAL 4N5UA 3FT4B 5I1DB 2BC4B 4LP5A 5J1AB 1FZKB 3SGJC 4GKNA 4KRNA 5D5MF 3ULVL 1T7XA 5DF0A 4DUWA 1FG2B 4HUXA 3FT3A 3K2MC 3LN9A 5DRWB 4DN4L 5FECA 5C8JB 4O2FB 1MNUH 2YRPA 2XWJA 4Y88A 5DD3L 4FXKB 5HHVL 3TEUA 3OJ2C 1UJ3C 5C0CB 4P2CG 2X4QB 3TBVB 4XGZB 5I1KH 1QRNB 3MZTA 1UM5L 4PJIF 1FNLA 4ZAKD 2WUCL 1ES0A 1T03L 1A47A 3MOAL 3I02B 3RY6C 3K0WA 4PBXA 5I2IA 3RJDA 1QYGL 3O81A 2APFA 4KQ4H 3VA6A 3G5YA 3MGAA 3FB8A 5IKCB 5L2KD 4BFGA 4BFIA 1JGUL 3RTQB 1U95A 3NZ8B 5BVJB 3QXTA 1AO7A 4GAGL 1M71B 1JPFB 3O3BB 4PS4H 4NUGH 2B5IB 4Y4KC 2Z9TA 1ND0A 2FWOA 3U2SA 1FORL 1MREL 3HUJA 4GLRH 4MNGB 2CK2A 4K3DL 2CIIB 4XWOC 1HSAB 5D7JB 3CSYA 4WI6A 2IAMB 2HFTA 4XVUC 3GMLA 1YQ2A 1HKFA 3MV7D 3UPCA 1EEZB 1NGQL 1XEDA 4P2QE 1MHHB 4JR9L 2MWCA 4EVNB 1W0WB 4H1LB 1MHCA 2J4WL 3FAXA 2NY5L 5KVGH 4RFOL 3TNNA 4OIAA 1ITBB 3RWDA 1BMGA 2NY7H 4YGVB 3WFEL 5DRZB 2X05A 5ALCL 2OXHA 1HIML 1V3MA 4ZOEA 3HI1B 4KDWA 2ADFH 5H37H 1RZJL 2R9HD 1GIGL 3EUUA 4F15B 5EZLA 4MQSB 4O9HL 3RIAF 2YD4A 1T5WB 4KKCD 4D0DB 5GGQH 5C6TL 2XKNA 5EG6C 4PP2A 5DR5L 4KKLD 5LGKA 1BX2A 1G9NL 4L4TB 5L2KB 4QWWC 1NAKL 5I1IL 4QOKE 5DI8B 5IP4A 4X6CE 3MROA 2CD0A 1KJ2H 3F5WB 3P4LA 4KK9D 2DM7A 1IEBB 5D6CA 3RZCC 4WFFD 2PO6A 3SY0A 4EDWL 1IM9D 2VH5H 5AAWA 3WHE1 4XC3L 3O4OC 4RGND 5GZNC 1NGPL 4X5WB 5GGTA 1OTUC 1I8IB 2FYYA 4U1SA 3RVWC 1SJHA 2B0SH 2Y06H 5F88B 4S11A 3RWCB 1ZKAA 2DM2A 2N4IA 3QUXC 4EKXA 1U93A 1GGBL 2AK1H 1DE4A 5EU7E 2VDOL 3P77B 2IBGA 5MERA 3FOLA 5IEHA 1UWXH 1FNGB 2GSGA 3EJZD 5C0FA 4PJ9B 4RGOL 2PW1B 2VABB 3JV6A 1G7IB 3F7YB 3UBXB 1S7VB 5D1ZD 5DA0B 1T1XA 1SMOA 4AIXA 4O00A 4J4PA 2VLRD 3ZZ1A 2CSPA 4MB4A 1MCPL 2KPNA 2RQ8A 2F54D 4KV5E 3D39D 5D1ZC 4HGKC 3BQUB 3QO0A 3S36X 4MDJB 3PABB 2XWTB 3SCMB 3AVEA 2MHAB 1MRDH 2XWBB 4HV8B 3GSWB 1JF6A 4WU5A 5B21A 4XRCB 4JFDA 4F9PA 3SCMC 1P6FA 2YXFA 4WV1C 1JZ7A 1R3LB 3TWCL 3HTLX 2XZQL 5CAYB 3QNYA 4HSQA 4U7KA 5FAAA 2Z4QA 2R1YA 2VUYA 4YIQA 4BJLA 4U1LB 3HS0A 4OB5H 4QRQB 1RK0B 3LB6D 5E9DD 4GMTH 4G6JL 5BOZG 1QLRB 1W0VA 1U8JA 2VLKE 3TT1H 4UTBH 3UO1L 1XGQA 1OF2B 5AZ2H 5DO2C 4DGYH 3HMXL 5GZND 4G43A 1YC7A 4LLVB 2VC2L 2ZJSH 4UDUB 4L8CB 3GI9L 5DJ6B 4K23L 1J8HE 5IROA 4PG2C 4XH2A 2DQEH 5L88L 4EOWL 3V5KB 4GKNB 3WEXA 1HYSD 4JFQB 1DVFC 2NMSA 3W81A 1FAIH 4UILH 4HG4J 2GW5A 4WENB