1BBHA

Atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 angstroms resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
131
structure length
131
Chain Sequence
AGLSPEEQIETRQAGYEFMGWNMGKIKANLEGEYNAAQVEAAANVIAAIANSGMGALYGPGTDKNVGDVKTRVKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 A resolution.
pubmed doi rcsb
source organism Allochromatium vinosum
molecule tags Electron transport(heme protein)
total genus 53
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1bbhA00
5B3IA 3HNJA 2YL0A 1JAFA 5JT4A 1CPQA 1E83A 2XLHA 4D4XA 3L1MA 4N6HA 4EIYA 3ZTZA 1GQAA 4JEAA 1YZAA 5AGFA 1RCPA 2XL8A 4IB4A 1CGNA 3C63A 3ZQVA 1APCA 2YL1A 1CPRA 4WGZA 1EKYA 2J8WA 3M15A 5JLIA 3FOPA 3M79A 4JKVA 3NMKA 5JVEA 2YL7A 5JUAA 3ZQYA 3M4CA 2YLIA 2XL6A 2YKZA 3NMJA 4JE9A 3HNIA 4U9EA 2XLDA 1YZCA 2XLEA 1QPUA 1M6TA 4D4NA 3QVYA 1QQ3A 2XM0A 2YLDA 5JP7A 5JS5A 2XLVA 3U8PA 3VRCA 3C62A 4U9DA 4CDAA 4JEBA 3QVZA 2XM4A 4N4WA 4L6RA 1CGOA 3NMIA 1E85A 4NC3A 256BA 2YLGA 3TOMA 2YL3A 4CIPA 4CDVA 1YYJA 5JRAA 4IAQA 4CDYA 4WGYA 1NBBA 3IQ5A 3HNKA 1E84A 3DE8A 3TOLA 3M4BA 1BBHA 3HNLA 4CX9A 1YYXA 4ULVA 2CCYA 2J9BA 2QLAA 1E86A 2XLWA 2XLOA 3FOOA 2XLMA 4CJOA 1S05A 3ZWIA 4IARA 1LM3B 3QW0A 3ZTMA 3IQ6A 1MQVA 2BC5A 5JSLA 4ER9A 1A7VA 3DE9A 3QW1A 4CJGA
chains in the Genus database with same CATH superfamily
4FESA 2J0WA 1LS1A 2DI3A 4AL1A 1ORSC 4R32A 5KYUB 1JAFA 3K7DA 3MBGA 4ZLCA 2FAPB 1KNYA 4JW1A 2Q7RA 3VAYA 1QVXA 4CS9C 1NZEA 1C03A 4W8KA 4YT8A 5BQIA 3H2UA 3L1MA 2UUHA 4N6HA 4W8PA 3BRJA 4G7ZF 2IM8A 4LLEA 3ZTZA 1TWGA 2NSGA 2NUPB 2A6HF 3EH2A 2YVKA 1BR1A 5AGFA 3UMHA 1OCZC 1RCPA 1Z5ZA 2EIJC 2ETSA 2HV7A 1YAUO 2KC3A 3DI5A 1NU9C 3GWLA 2H8AA 2A0UA 1V55C 3GEHA 3K33A 1CPRA 1OW7A 3DMDA 2X51A 3PHF2 1G4US 3QTHA 4MVUA 2OJED 5L0CA 3SP1A 2WZFA 1VYKA 2RSEB 3HKKA 1VLTA 1TKNA 4MVQA 5A6BA 1SR2A 2PBEA 1JPNA 2YL7A 2IXMA 3JTLO 4KBLA 1R5ID 4NQFA 3FXHA 4MTGA 1PCXA 3JT1A 4N6CA 1JR8A 4IGGA 5A6AA 2EPLX 1UFBA 3IQCA 1A0BA 3NMJA 1H7IA 2OQMA 4CBEA 3LJBA 3HJCA 3U2MA 1I4YA 4MTFA 4P6IC 1Z7Qc 4YL3A 4ANJA 2HZ8A 1T6IA 3EGDA 1D1BA 4NTFA 2CGEA 3K6BA 4NCQA 3RQEA 1YZCA 2J7PA 1VTMP 5A6KA 3DKAA 5CI9A 3S0XA 4D4NA 4X0RA 1GS9A 1QQ3A 2G62A 5D91A 2HUJA 3DM5A 2YLDA 4BPMA 2EILC 5JP7A 5KYWB 3GANA 3W4YA 4JURI 2KW3C 3VRCA 3JSEO 1LE2A 3IQTA 1JMWA 1ZYRF 3ECSA 3OWTA 1MMAA 4JEBA 4KC9A 2P61A 4J30B 3QVZA 2VH3A 5DS5A 5TJ5E 3FDQA 2XM4A 4N4WA 4E17A 4XPXA 2HFIA 1YA7O 1OCCC 2NUTB 2OEVA 3B9QA 3VF0A 5T1DB 3UGPA 2A69F 1N1CA 2Y69C 2J9WA 1AUEA 1LVKA 1TWAA 4EWCA 2IXNA 256BA 2ZPAA 3W2VA 3EG9A 2FFHA 4U5BE 2HMQA 1G8XA 1IW7F 2CDQA 1SZIA 1NFNA 3S9OA 1PD1A 1FTSA 4PK4A 5KYXA 2P7VA 5JRAA 3JRTA 2A6EF 4PACA 4O6NA 4CDYA 4QI2A 4CS7A 1FR0A 1M56C 3C8GB 4YT4A 4EUKB 3AGUA 5BQGA 3SXZA 2WZLA 1A41A 3ABKC 1D0YA 2M4EA 5CI8A 3GM1A 2J7PD 3L34A 3DD7A 1C17M 4P9FA 2W4BA 2MHRA 3ZDLA 4CX9A 2GAQA 5L0HA 4EBBA 1D0XA 3T6JA 1E86A 3N24A 4LACB 4MW3A 3KMIA 4AE4B 2V3CC 2XLMA 4CJOA 1MMNA 1M2OA 2WL8A 2KYHA 4IARA 3F47A 4XEFA 4NY3A 3WG7C 2KK1A 2CNWD 2MYSA 1Q0FA 2Q9CA 1Q0DA 1D1CA 1MQVA 2IBFA 2VCBA 4MW8A 1A7VA 2ZXPA 1BZ4A 1M57C 1OQCA 1ZHXA 4I3MA 2PF4E 5EK0A 3SEOA 4YWQA 3U9MA 3S84A 4IAOA 5B3IA 4E0HA 2R7UA 2XLHA 3H65A 3I5QA 3S28A 2EPNA 1HMDA 1LIHA 2PNOA 3RQFA 3TD7A 4D4XA 5L0DA 3EFOB 2ASRA 3OEOA 4J32B 3W2WA 1H9TA 3CQZA 1GGQA 4HFFB 3T6BA 4E0IA 4FAPB 4FWVA 1F1MA 2D5RB 2NUPA 2PX3A 3AG3C 4MVSA 1WN0A 4JEAA 4YJWA 4M63A 3W8HA 3GM2A 1OXKA 2OKUA 4PFOA 4LDRA 1FFHA 2RD9A 4OIQF 5E33A 1CGNA 1B68A 4C3EA 3ZQVA 2L81A 2HMZA 2B0JA 2XL4A 3PMRA 2Q00A 2EIKC 4IWBA 3NKDA 4LERA 2MWQA 4Z9IA 4BJ6A 4MS2A 2WVNA 4U5GA 3LUTB 5DS6A 1EKYA 2J8WA 2VC9A 1MNEA 2W45A 3AOUA 1O3UA 3M15A 3LS1A 4MQ9F 4E18A 5DS4A 5JLIA 4OIPF 1LI7A 3M79A 2JX0A 5E2QA 1OKKA 1ZU5A 2A0BA 5JUAA 1C02A 1K40A 3GEIA 4IRUA 2GDCA 3ZQYA 1YVIA 1XZPA 3B0VC 3M4CA 2F22A 3TULA 2YKZA 3T6GB 2XRHA 1OCOC 3OA1A 2R7XA 1LKXA 5KYYB 3EGXA 3G4XA 2YHSA 2R03A 2G3VA 2XS8A 4JCHA 3AG4C 3FVYA 4YT2A 3I4UA 3DAGA 4HEAJ 4XEKA 4MTOA 2LK4A 3LEVA 2XLDA 4XTKA 3LNMB 4JCZA 1V4AA 3H2VA 3CSKA 3TK0A 4DVYP 3U3BA 2BL2A 1Y6DA 3LEOA 1U0BB 2XXAB 1LPEA 3ASNC 4PJJA 1FAPB 3EQLF 4IJJA 1HW1A 4NTBA 5KYWA 1U89A 2XLVA 2UUIA 5COFA 3U8PA 3W8IA 2IOQA 3O39A 4CDAA 1ORYA 1S7ZA 3JSZA 4A2NB 1EA8A 2AWYA 4JZAA 2V26A 4Q4ZF 1M2VB 4YT5A 1AVOB 1Y4CA 3M1CB 2NUTA 4CS8C 2CYDA 2L6GA 3A11A 3BEHA 4RDAA 4OINF 4C7OB 3EGXB 4J7YA 5L0JA 1FMWA 1E85A 2ZXWC 5L0IA 4O7GA 1HMOA 5L0GA 2QUPA 2LIGA 2Z15A 2ZXRA 4HFKB 2C04A 3C18A 4OD5A 4CIPA 4CDVA 3RVYA 2A1DD 2Q9BA 3KPHA 3DJUB 2Q3TA 4IAQA 4DXWA 4WGYA 1NBBA 4BEMJ 3IQ5A 5FCLA 3C8GA 4P9TA 1ZW2A 4DRHB 2J0XA 4MVRA 5A69A 1JOGA 3NKEA 3RKOF 4A4AA 1MNDA 3DXJF 2KNHA 3G50A 3N0TA 3LAYA 3RYLA 2LFFA 4G7OF 3EH1A 4WABA 4AX2A 1ZHWA 1YYXA 1ZHTA 1ZHZA 4K1OA 4ULVA 3SZRA 2CCYA 2YRFA 4AE4A 2GWWA 5D92A 1RKEA 3ZIBA 3LESA 3G4ZA 1OR3A 1W2WA 2H7OA 3AG2C 4U5FE 1ZVZA 3X2QC 4DVZA 5A6BD 2R7VA 3KH2A 4UDVA 4JJFA 5L0FA 5BUOA 3US6A 4I44A 5JSLA 3ZG1A 4ER9A 3DE9A 1O5HA 1ST6A 2JD3A 5DQZA 4OD4A 4RBNA 3QMKA 4EKWA 1OW8A 4C3DA 1Z3IX 4JRZA 3HNJA 3NRHA 3T4RA 1KTMA 2Y3GA 5JT4A 1E83A 1CGME 1MMGA 2J45A 3MX3A 4DBRA 1YARO 1IZMA 3E9VA 1LI5A 2LFDA 3EFOA 4JTAB 4QDLA 2R7RA 4YL0A 2C03A 3UMKA 5EGYA 5B3SC 1PD0A 5F5HA 1XWJA 2E87A 3L0IA 2AU5A 1ZW3A 1J8MF 1RKEB 3C8GD 5EHHA 2TMVP 1J8YF 2OG2A 2QTVA 3R2PA 3RIPA 4BJ6C 5DVWA 2AWCA 3C63A 5A6JA 4I1OB 4K0DA 2YL1A 2EPKX 2L7AA 1TFOB 1ZZPA 1Z6AA 4O6MA 4WGZA 4DJ9A 3AJMA 1U6HA 3O55A 3U0CA 5BQHA 4Q5SF 1SYQA 3FOPA 1NFOA 4WJ0A 2L6FA 2DYSC 2EIMC 2LP4A 3Q6NA 3GM3A 3L8IA 2P6VA 4MVOA 1YLMA 3DWWA 1BDJB 2WZGA 4FX5A 4LDKA 3DZAA 4U5EE 4B6IA 2Q4FA 2PFDA 2YLIA 4YN0B 4HE8D 1NSGB 3EHMA 4JE9A 1RKCA 3K1IA 3SXYA 3U3FA 4BJ5A 5KYYA 3S90A 3UGOA 5E3AA 4OIOF 3CAXA 4E7ZA 5F28E 3KL4A 1DOWA 4ZLDA 3GODA 1LE4A 4G0HA 3RW0A 1GM5A 2XLEA 2Y3DA 1YDIA 3JYYA 5T3TA 2KQ9A 2R7QA 2R7WA 2XXAA 3ASOC 2P0NA 3AG1C 2B0HA 2AVKA 3Q7GA 3U9JA 3WAQA 1ORJA 5L3QA 3DAFA 3C62A 3TJ5A 1A7EA 4U5CE 4DRJB 2ZXOA 2R7SA 1NU7D 2L9JA 1M2VA 2PX0A 2GFHA 3JYHA 2W9YA 2Y3BA 3FHDA 4L6RA 3V7OA 4F4BA 1T9KA 3Q7LA 4C7OA 1D1AA 1FFTC 1E2XA 3B0PA 3QZCA 4H4KC 3RQGA 1WWPA 1HW2A 3V5YA 3ZSUA 4NC3A 3U8VA 1HY5A 1JRAA 1K05A 3KYIA 4H54A 2VASA 2WB7A 2YEVA 3C7JA 3EZHA 4MVMA 3UNGC 4DBQA 1L3PA 2Y39A 2YL3A 3POVA 3J06A 3EHNA 3N2ZB 3U2LA 2PP4A 4CSAA 3PCVA 2HS5A 1T6QA 3E70C 5COMA 4Z9HA 1V74B 1YYJA 2HKVA 2L6HA 1YA9A 4O6YA 3MFNA 4YK5A 2CW0F 3SXMA 2KJGA 2XSEA 4XWJA 3RF3A 3NYMA 1JPJA 1WATA 1WGWA 1ZU4A 4U5DE 2DGJA 1OW6A 1T5OA 2DB4A 1RXQA 4JJGA 3FMSA 2H7BA 3LNRA 3SXKA 4BEJA 3CEXA 2J9VA 2R7OA 3M4BA 1TR2A 1Z23A 3ABLC 1UG7A 2J9BA 3A9CA 2XLOA 1TFKB 4EBJA 2OJQA 2R7TA 5B1AC 2QY9A 2HSBA 3FOOA 3GORA 1S05A 3ABMC 4QI0A 3RVZA 2W4MA 3SNHA 3V5XA 4CIHA 1LM3B 3O6XA 3QW0A 1TWCA 1FNTc 1OKKD 1VMAA 3IQ6A 2NG1A 2NSFA 2ZD9A 4XLPF 5HV9A 3RFYA 2BC5A 3NG1A 3NYLA 1A7DA 2I8BA 5E3CA 4J7TA 1PV3A 2EPMX 3L8JA 3QW1A 3MLGA 3GWNA 4JIOA 3WHNA 4GYTA 1V54C 5AC4A 4CJGA 3ATPA 1TQGA 2YL0A 1Q0MA 1CPQA 1EI7A 1FMVA 4U5HA 1G5ZA 1VOMA 4RD9A 2WVQA 4XQ1A 3V5ZA 2OCCC 1O87A 4CS9A 4I1MA 4PJNA 5DLJA 2WVOA 1BR4A 4LLCA 4PR9A 2YWAA 4AL0A 4EIYA 1GQAA 3UMIA 3K1HA 1L7CA 1YZAA 4XEVA 2KGOA 4XPYA 2XL8A 4BJ1A 4DRIB 4IB4A 2QNLA 3MYFA 1EQ1A 1HE9A 4PJLA 5B1BC 3T9OA 1APCA 1Q0GA 1I4ZA 4BG0A 4JVSA 4E7SA 1Z63A 5HSWA 2H7VC 4KNVA 3AQBA 1DOVA 3GEEA 3FAPB 3LLKA 1VLSA 2M64A 1G4WR 4JKVA 3NMKA 3F46A 2G3KA 3DJNB 2OEXA 2CNWA 5JVEA 1SF8A 3HLZA 3FAJA 4AK9A 3CZ6A 1NG1A 1NLXA 1QZXA 1D0ZA 2VCAA 3K1IC 4BJ5C 4JC7A 3TQOA 2XL6A 5T3WA 1YJGA 2X0CA 4DOZA 4EHPA 4OIRF 5F5FA 2XS1A 3S29A 3HNIA 4CS8A 3K66A 1QKRA 3MYIA 4U9EA 4LDQA 2OOCA 3EGDB 2LD6A 3IEEA 1OR2A 2BE5F 4GQHA 5FZTA 5COGA 4JTCB 5L3VA 1QPUA 2EINC 1QLEC 1M6TA 2EPOA 4YL1A 3ZVRA 2HSQA 2NPUA 3QVYA 3ZC4A 4KI2A 2XM0A 4G78A 2HV6A 4PFPA 4MNDA 1H9GA 3TJ6A 5JS5A 3EZIA 3HTKC 1RJ9A 3ITFA 1K04A 3LLIA 1Q0KA 2HJ3A 1QSPA 3Q6MA 4U9DA 5IY5C 3EJNA 3X1OA 4GEHA 3JZ0A 5K0IA 4MVZA 2YQYA 1CGOA 2DYRC 1KU2A 2ICWG 1MMDA 1I5NA 3NMIA 2Q9AA 1H6GA 2IXOA 4ULWA 2R9RB 1TWHA 2LSEA 4ONSA 3JCUQ 2IXPA 1SMYF 2D4UA 2R25A 4NTAA 2YLGA 3WODF 5DQTA 4EBKA 3DM9B 1HE1A 3TOMA 1VK5A 2O9XA 3EG9B 4CSAC 2QE9A 4C3BA 2J9UA 1VB5A 3O10A 3B71A 2IYLD 1R4TA 3C8ZA 5KYXB 3R7CA 4Z9JA 1WTYA 2P1AA 1WOLA 3I5PA 2R02A 2I15A 5KYUA 2R05A 1RJ9B 3HNKA 1E84A 2LQGA 3IPMO 2OU6A 3DE8A 3IHUA 3LS0A 2GA0A 1VYIA 1OCRC 5KYNA 3TOLA 2HJMA 5AC5A 4BJTA 3PDMP 1BBHA 2A68F 3HNLA 4Q7CA 2YZSA 1RMVA 2J46A 1T6UA 2QLAA 3EPVA 2XLWA 3AQCA 3JRMO 4N06A 2VCCA 4O79A 3UR3C 3KKBA 3VM6A 2KSFA 2LCHA 1WASA 4XLNF 3B29A 3SYNA 3ZWIA 1XZQA 4KNWA 1BR2A 3ZTMA 4JTDB 2VB6A 3NYJA 3S27A 1ZHYA 1AEPA 3KYJA 3RH3A 2AP3A 1LS4A 4XPWA 4K7BA 1T01A 2FGYA 2JPUA 4PJMA 3U5SA 3AGTA 5CIVA 4G7HF 3VYWA 1OXBA 3B0UX 3NDBB 5GPGB 2Y3HA
chains in the Genus database with same CATH topology
5B3IA 3HNJA 2YL0A 1JAFA 5JT4A 1CPQA 1E83A 2XLHA 4D4XA 3L1MA 4N6HA 4EIYA 3ZTZA 1GQAA 4JEAA 1YZAA 5AGFA 1RCPA 2XL8A 4IB4A 1CGNA 3C63A 3ZQVA 1APCA 2YL1A 1CPRA 4WGZA 1EKYA 2J8WA 3M15A 5JLIA 3FOPA 3M79A 4JKVA 3NMKA 5JVEA 2YL7A 5JUAA 3ZQYA 3M4CA 2YLIA 2XL6A 2YKZA 3NMJA 4JE9A 3HNIA 4U9EA 2XLDA 1YZCA 2XLEA 1QPUA 1M6TA 4D4NA 3QVYA 1QQ3A 2XM0A 2YLDA 5JP7A 5JS5A 2XLVA 3U8PA 3VRCA 3C62A 4U9DA 4CDAA 4JEBA 3QVZA 2XM4A 4N4WA 4L6RA 1CGOA 3NMIA 1E85A 4NC3A 256BA 2YLGA 3TOMA 2YL3A 4CIPA 4CDVA 1YYJA 5JRAA 4IAQA 4CDYA 4WGYA 1NBBA 3IQ5A 3HNKA 1E84A 3DE8A 3TOLA 3M4BA 1BBHA 3HNLA 4CX9A 1YYXA 4ULVA 2CCYA 2J9BA 2QLAA 1E86A 2XLWA 2XLOA 3FOOA 2XLMA 4CJOA 1S05A 3ZWIA 4IARA 1LM3B 3QW0A 3ZTMA 3IQ6A 1MQVA 2BC5A 5JSLA 4ER9A 1A7VA 3DE9A 3QW1A 4CJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3I A;  3HNJ A;  2YL0 A;  1JAF A;  5JT4 A;  1CPQ A;  1E83 A;  2XLH A;  4D4X A;  3L1M A;  4N6H A;  4EIY A;  3ZTZ A;  1GQA A;  4JEA A;  1YZA A;  5AGF A;  1RCP A;  2XL8 A;  4IB4 A;  1CGN A;  3C63 A;  3ZQV A;  1APC A;  2YL1 A;  1CPR A;  4WGZ A;  1EKY A;  2J8W A;  3M15 A;  5JLI A;  3FOP A;  3M79 A;  4JKV A;  3NMK A;  5JVE A;  2YL7 A;  5JUA A;  3ZQY A;  3M4C A;  2YLI A;  2XL6 A;  2YKZ A;  3NMJ A;  4JE9 A;  3HNI A;  4U9E A;  2XLD A;  1YZC A;  2XLE A;  1QPU A;  1M6T A;  4D4N A;  3QVY A;  1QQ3 A;  2XM0 A;  2YLD A;  5JP7 A;  5JS5 A;  2XLV A;  3U8P A;  3VRC A;  3C62 A;  4U9D A;  4CDA A;  4JEB A;  3QVZ A;  2XM4 A;  4N4W A;  4L6R A;  1CGO A;  3NMI A;  1E85 A;  4NC3 A;  256B A;  2YLG A;  3TOM A;  2YL3 A;  4CIP A;  4CDV A;  1YYJ A;  5JRA A;  4IAQ A;  4CDY A;  4WGY A;  1NBB A;  3IQ5 A;  3HNK A;  1E84 A;  3DE8 A;  3TOL A;  3M4B A;  1BBH A;  3HNL A;  4CX9 A;  1YYX A;  4ULV A;  2CCY A;  2J9B A;  2QLA A;  1E86 A;  2XLW A;  2XLO A;  3FOO A;  2XLM A;  4CJO A;  1S05 A;  3ZWI A;  4IAR A;  1LM3 B;  3QW0 A;  3ZTM A;  3IQ6 A;  1MQV A;  2BC5 A;  5JSL A;  4ER9 A;  1A7V A;  3DE9 A;  3QW1 A;  4CJG A; 
#chains in the Genus database with same CATH topology
 4FES A;  2J0W A;  1LS1 A;  2DI3 A;  4AL1 A;  1ORS C;  4R32 A;  5KYU B;  1JAF A;  3K7D A;  3MBG A;  4ZLC A;  2FAP B;  1KNY A;  4JW1 A;  2Q7R A;  3VAY A;  1QVX A;  4CS9 C;  1NZE A;  1C03 A;  4W8K A;  4YT8 A;  5BQI A;  3H2U A;  3L1M A;  2UUH A;  4N6H A;  4W8P A;  3BRJ A;  4G7Z F;  2IM8 A;  4LLE A;  3ZTZ A;  1TWG A;  2NSG A;  2NUP B;  2A6H F;  3EH2 A;  2YVK A;  1BR1 A;  5AGF A;  3UMH A;  1OCZ C;  1RCP A;  1Z5Z A;  2EIJ C;  2ETS A;  2HV7 A;  1YAU O;  2KC3 A;  3DI5 A;  1NU9 C;  3GWL A;  2H8A A;  2A0U A;  1V55 C;  3GEH A;  3K33 A;  1CPR A;  1OW7 A;  3DMD A;  2X51 A;  3PHF 2;  1G4U S;  3QTH A;  4MVU A;  2OJE D;  5L0C A;  3SP1 A;  2WZF A;  1VYK A;  2RSE B;  3HKK A;  1VLT A;  1TKN A;  4MVQ A;  5A6B A;  1SR2 A;  2PBE A;  1JPN A;  2YL7 A;  2IXM A;  3JTL O;  4KBL A;  1R5I D;  4NQF A;  3FXH A;  4MTG A;  1PCX A;  3JT1 A;  4N6C A;  1JR8 A;  4IGG A;  5A6A A;  2EPL X;  1UFB A;  3IQC A;  1A0B A;  3NMJ A;  1H7I A;  2OQM A;  4CBE A;  3LJB A;  3HJC A;  3U2M A;  1I4Y A;  4MTF A;  4P6I C;  1Z7Q c;  4YL3 A;  4ANJ A;  2HZ8 A;  1T6I A;  3EGD A;  1D1B A;  4NTF A;  2CGE A;  3K6B A;  4NCQ A;  3RQE A;  1YZC A;  2J7P A;  1VTM P;  5A6K A;  3DKA A;  5CI9 A;  3S0X A;  4D4N A;  4X0R A;  1GS9 A;  1QQ3 A;  2G62 A;  5D91 A;  2HUJ A;  3DM5 A;  2YLD A;  4BPM A;  2EIL C;  5JP7 A;  5KYW B;  3GAN A;  3W4Y A;  4JUR I;  2KW3 C;  3VRC A;  3JSE O;  1LE2 A;  3IQT A;  1JMW A;  1ZYR F;  3ECS A;  3OWT A;  1MMA A;  4JEB A;  4KC9 A;  2P61 A;  4J30 B;  3QVZ A;  2VH3 A;  5DS5 A;  5TJ5 E;  3FDQ A;  2XM4 A;  4N4W A;  4E17 A;  4XPX A;  2HFI A;  1YA7 O;  1OCC C;  2NUT B;  2OEV A;  3B9Q A;  3VF0 A;  5T1D B;  3UGP A;  2A69 F;  1N1C A;  2Y69 C;  2J9W A;  1AUE A;  1LVK A;  1TWA A;  4EWC A;  2IXN A;  256B A;  2ZPA A;  3W2V A;  3EG9 A;  2FFH A;  4U5B E;  2HMQ A;  1G8X A;  1IW7 F;  2CDQ A;  1SZI A;  1NFN A;  3S9O A;  1PD1 A;  1FTS A;  4PK4 A;  5KYX A;  2P7V A;  5JRA A;  3JRT A;  2A6E F;  4PAC A;  4O6N A;  4CDY A;  4QI2 A;  4CS7 A;  1FR0 A;  1M56 C;  3C8G B;  4YT4 A;  4EUK B;  3AGU A;  5BQG A;  3SXZ A;  2WZL A;  1A41 A;  3ABK C;  1D0Y A;  2M4E A;  5CI8 A;  3GM1 A;  2J7P D;  3L34 A;  3DD7 A;  1C17 M;  4P9F A;  2W4B A;  2MHR A;  3ZDL A;  4CX9 A;  2GAQ A;  5L0H A;  4EBB A;  1D0X A;  3T6J A;  1E86 A;  3N24 A;  4LAC B;  4MW3 A;  3KMI A;  4AE4 B;  2V3C C;  2XLM A;  4CJO A;  1MMN A;  1M2O A;  2WL8 A;  2KYH A;  4IAR A;  3F47 A;  4XEF A;  4NY3 A;  3WG7 C;  2KK1 A;  2CNW D;  2MYS A;  1Q0F A;  2Q9C A;  1Q0D A;  1D1C A;  1MQV A;  2IBF A;  2VCB A;  4MW8 A;  1A7V A;  2ZXP A;  1BZ4 A;  1M57 C;  1OQC A;  1ZHX A;  4I3M A;  2PF4 E;  5EK0 A;  3SEO A;  4YWQ A;  3U9M A;  3S84 A;  4IAO A;  5B3I A;  4E0H A;  2R7U A;  2XLH A;  3H65 A;  3I5Q A;  3S28 A;  2EPN A;  1HMD A;  1LIH A;  2PNO A;  3RQF A;  3TD7 A;  4D4X A;  5L0D A;  3EFO B;  2ASR A;  3OEO A;  4J32 B;  3W2W A;  1H9T A;  3CQZ A;  1GGQ A;  4HFF B;  3T6B A;  4E0I A;  4FAP B;  4FWV A;  1F1M A;  2D5R B;  2NUP A;  2PX3 A;  3AG3 C;  4MVS A;  1WN0 A;  4JEA A;  4YJW A;  4M63 A;  3W8H A;  3GM2 A;  1OXK A;  2OKU A;  4PFO A;  4LDR A;  1FFH A;  2RD9 A;  4OIQ F;  5E33 A;  1CGN A;  1B68 A;  4C3E A;  3ZQV A;  2L81 A;  2HMZ A;  2B0J A;  2XL4 A;  3PMR A;  2Q00 A;  2EIK C;  4IWB A;  3NKD A;  4LER A;  2MWQ A;  4Z9I A;  4BJ6 A;  4MS2 A;  2WVN A;  4U5G A;  3LUT B;  5DS6 A;  1EKY A;  2J8W A;  2VC9 A;  1MNE A;  2W45 A;  3AOU A;  1O3U A;  3M15 A;  3LS1 A;  4MQ9 F;  4E18 A;  5DS4 A;  5JLI A;  4OIP F;  1LI7 A;  3M79 A;  2JX0 A;  5E2Q A;  1OKK A;  1ZU5 A;  2A0B A;  5JUA A;  1C02 A;  1K40 A;  3GEI A;  4IRU A;  2GDC A;  3ZQY A;  1YVI A;  1XZP A;  3B0V C;  3M4C A;  2F22 A;  3TUL A;  2YKZ A;  3T6G B;  2XRH A;  1OCO C;  3OA1 A;  2R7X A;  1LKX A;  5KYY B;  3EGX A;  3G4X A;  2YHS A;  2R03 A;  2G3V A;  2XS8 A;  4JCH A;  3AG4 C;  3FVY A;  4YT2 A;  3I4U A;  3DAG A;  4HEA J;  4XEK A;  4MTO A;  2LK4 A;  3LEV A;  2XLD A;  4XTK A;  3LNM B;  4JCZ A;  1V4A A;  3H2V A;  3CSK A;  3TK0 A;  4DVY P;  3U3B A;  2BL2 A;  1Y6D A;  3LEO A;  1U0B B;  2XXA B;  1LPE A;  3ASN C;  4PJJ A;  1FAP B;  3EQL F;  4IJJ A;  1HW1 A;  4NTB A;  5KYW A;  1U89 A;  2XLV A;  2UUI A;  5COF A;  3U8P A;  3W8I A;  2IOQ A;  3O39 A;  4CDA A;  1ORY A;  1S7Z A;  3JSZ A;  4A2N B;  1EA8 A;  2AWY A;  4JZA A;  2V26 A;  4Q4Z F;  1M2V B;  4YT5 A;  1AVO B;  1Y4C A;  3M1C B;  2NUT A;  4CS8 C;  2CYD A;  2L6G A;  3A11 A;  3BEH A;  4RDA A;  4OIN F;  4C7O B;  3EGX B;  4J7Y A;  5L0J A;  1FMW A;  1E85 A;  2ZXW C;  5L0I A;  4O7G A;  1HMO A;  5L0G A;  2QUP A;  2LIG A;  2Z15 A;  2ZXR A;  4HFK B;  2C04 A;  3C18 A;  4OD5 A;  4CIP A;  4CDV A;  3RVY A;  2A1D D;  2Q9B A;  3KPH A;  3DJU B;  2Q3T A;  4IAQ A;  4DXW A;  4WGY A;  1NBB A;  4BEM J;  3IQ5 A;  5FCL A;  3C8G A;  4P9T A;  1ZW2 A;  4DRH B;  2J0X A;  4MVR A;  5A69 A;  1JOG A;  3NKE A;  3RKO F;  4A4A A;  1MND A;  3DXJ F;  2KNH A;  3G50 A;  3N0T A;  3LAY A;  3RYL A;  2LFF A;  4G7O F;  3EH1 A;  4WAB A;  4AX2 A;  1ZHW A;  1YYX A;  1ZHT A;  1ZHZ A;  4K1O A;  4ULV A;  3SZR A;  2CCY A;  2YRF A;  4AE4 A;  2GWW A;  5D92 A;  1RKE A;  3ZIB A;  3LES A;  3G4Z A;  1OR3 A;  1W2W A;  2H7O A;  3AG2 C;  4U5F E;  1ZVZ A;  3X2Q C;  4DVZ A;  5A6B D;  2R7V A;  3KH2 A;  4UDV A;  4JJF A;  5L0F A;  5BUO A;  3US6 A;  4I44 A;  5JSL A;  3ZG1 A;  4ER9 A;  3DE9 A;  1O5H A;  1ST6 A;  2JD3 A;  5DQZ A;  4OD4 A;  4RBN A;  3QMK A;  4EKW A;  1OW8 A;  4C3D A;  1Z3I X;  4JRZ A;  3HNJ A;  3NRH A;  3T4R A;  1KTM A;  2Y3G A;  5JT4 A;  1E83 A;  1CGM E;  1MMG A;  2J45 A;  3MX3 A;  4DBR A;  1YAR O;  1IZM A;  3E9V A;  1LI5 A;  2LFD A;  3EFO A;  4JTA B;  4QDL A;  2R7R A;  4YL0 A;  2C03 A;  3UMK A;  5EGY A;  5B3S C;  1PD0 A;  5F5H A;  1XWJ A;  2E87 A;  3L0I A;  2AU5 A;  1ZW3 A;  1J8M F;  1RKE B;  3C8G D;  5EHH A;  2TMV P;  1J8Y F;  2OG2 A;  2QTV A;  3R2P A;  3RIP A;  4BJ6 C;  5DVW A;  2AWC A;  3C63 A;  5A6J A;  4I1O B;  4K0D A;  2YL1 A;  2EPK X;  2L7A A;  1TFO B;  1ZZP A;  1Z6A A;  4O6M A;  4WGZ A;  4DJ9 A;  3AJM A;  1U6H A;  3O55 A;  3U0C A;  5BQH A;  4Q5S F;  1SYQ A;  3FOP A;  1NFO A;  4WJ0 A;  2L6F A;  2DYS C;  2EIM C;  2LP4 A;  3Q6N A;  3GM3 A;  3L8I A;  2P6V A;  4MVO A;  1YLM A;  3DWW A;  1BDJ B;  2WZG A;  4FX5 A;  4LDK A;  3DZA A;  4U5E E;  4B6I A;  2Q4F A;  2PFD A;  2YLI A;  4YN0 B;  4HE8 D;  1NSG B;  3EHM A;  4JE9 A;  1RKC A;  3K1I A;  3SXY A;  3U3F A;  4BJ5 A;  5KYY A;  3S90 A;  3UGO A;  5E3A A;  4OIO F;  3CAX A;  4E7Z A;  5F28 E;  3KL4 A;  1DOW A;  4ZLD A;  3GOD A;  1LE4 A;  4G0H A;  3RW0 A;  1GM5 A;  2XLE A;  2Y3D A;  1YDI A;  3JYY A;  5T3T A;  2KQ9 A;  2R7Q A;  2R7W A;  2XXA A;  3ASO C;  2P0N A;  3AG1 C;  2B0H A;  2AVK A;  3Q7G A;  3U9J A;  3WAQ A;  1ORJ A;  5L3Q A;  3DAF A;  3C62 A;  3TJ5 A;  1A7E A;  4U5C E;  4DRJ B;  2ZXO A;  2R7S A;  1NU7 D;  2L9J A;  1M2V A;  2PX0 A;  2GFH A;  3JYH A;  2W9Y A;  2Y3B A;  3FHD A;  4L6R A;  3V7O A;  4F4B A;  1T9K A;  3Q7L A;  4C7O A;  1D1A A;  1FFT C;  1E2X A;  3B0P A;  3QZC A;  4H4K C;  3RQG A;  1WWP A;  1HW2 A;  3V5Y A;  3ZSU A;  4NC3 A;  3U8V A;  1HY5 A;  1JRA A;  1K05 A;  3KYI A;  4H54 A;  2VAS A;  2WB7 A;  2YEV A;  3C7J A;  3EZH A;  4MVM A;  3UNG C;  4DBQ A;  1L3P A;  2Y39 A;  2YL3 A;  3POV A;  3J06 A;  3EHN A;  3N2Z B;  3U2L A;  2PP4 A;  4CSA A;  3PCV A;  2HS5 A;  1T6Q A;  3E70 C;  5COM A;  4Z9H A;  1V74 B;  1YYJ A;  2HKV A;  2L6H A;  1YA9 A;  4O6Y A;  3MFN A;  4YK5 A;  2CW0 F;  3SXM A;  2KJG A;  2XSE A;  4XWJ A;  3RF3 A;  3NYM A;  1JPJ A;  1WAT A;  1WGW A;  1ZU4 A;  4U5D E;  2DGJ A;  1OW6 A;  1T5O A;  2DB4 A;  1RXQ A;  4JJG A;  3FMS A;  2H7B A;  3LNR A;  3SXK A;  4BEJ A;  3CEX A;  2J9V A;  2R7O A;  3M4B A;  1TR2 A;  1Z23 A;  3ABL C;  1UG7 A;  2J9B A;  3A9C A;  2XLO A;  1TFK B;  4EBJ A;  2OJQ A;  2R7T A;  5B1A C;  2QY9 A;  2HSB A;  3FOO A;  3GOR A;  1S05 A;  3ABM C;  4QI0 A;  3RVZ A;  2W4M A;  3SNH A;  3V5X A;  4CIH A;  1LM3 B;  3O6X A;  3QW0 A;  1TWC A;  1FNT c;  1OKK D;  1VMA A;  3IQ6 A;  2NG1 A;  2NSF A;  2ZD9 A;  4XLP F;  5HV9 A;  3RFY A;  2BC5 A;  3NG1 A;  3NYL A;  1A7D A;  2I8B A;  5E3C A;  4J7T A;  1PV3 A;  2EPM X;  3L8J A;  3QW1 A;  3MLG A;  3GWN A;  4JIO A;  3WHN A;  4GYT A;  1V54 C;  5AC4 A;  4CJG A;  3ATP A;  1TQG A;  2YL0 A;  1Q0M A;  1CPQ A;  1EI7 A;  1FMV A;  4U5H A;  1G5Z A;  1VOM A;  4RD9 A;  2WVQ A;  4XQ1 A;  3V5Z A;  2OCC C;  1O87 A;  4CS9 A;  4I1M A;  4PJN A;  5DLJ A;  2WVO A;  1BR4 A;  4LLC A;  4PR9 A;  2YWA A;  4AL0 A;  4EIY A;  1GQA A;  3UMI A;  3K1H A;  1L7C A;  1YZA A;  4XEV A;  2KGO A;  4XPY A;  2XL8 A;  4BJ1 A;  4DRI B;  4IB4 A;  2QNL A;  3MYF A;  1EQ1 A;  1HE9 A;  4PJL A;  5B1B C;  3T9O A;  1APC A;  1Q0G A;  1I4Z A;  4BG0 A;  4JVS A;  4E7S A;  1Z63 A;  5HSW A;  2H7V C;  4KNV A;  3AQB A;  1DOV A;  3GEE A;  3FAP B;  3LLK A;  1VLS A;  2M64 A;  1G4W R;  4JKV A;  3NMK A;  3F46 A;  2G3K A;  3DJN B;  2OEX A;  2CNW A;  5JVE A;  1SF8 A;  3HLZ A;  3FAJ A;  4AK9 A;  3CZ6 A;  1NG1 A;  1NLX A;  1QZX A;  1D0Z A;  2VCA A;  3K1I C;  4BJ5 C;  4JC7 A;  3TQO A;  2XL6 A;  5T3W A;  1YJG A;  2X0C A;  4DOZ A;  4EHP A;  4OIR F;  5F5F A;  2XS1 A;  3S29 A;  3HNI A;  4CS8 A;  3K66 A;  1QKR A;  3MYI A;  4U9E A;  4LDQ A;  2OOC A;  3EGD B;  2LD6 A;  3IEE A;  1OR2 A;  2BE5 F;  4GQH A;  5FZT A;  5COG A;  4JTC B;  5L3V A;  1QPU A;  2EIN C;  1QLE C;  1M6T A;  2EPO A;  4YL1 A;  3ZVR A;  2HSQ A;  2NPU A;  3QVY A;  3ZC4 A;  4KI2 A;  2XM0 A;  4G78 A;  2HV6 A;  4PFP A;  4MND A;  1H9G A;  3TJ6 A;  5JS5 A;  3EZI A;  3HTK C;  1RJ9 A;  3ITF A;  1K04 A;  3LLI A;  1Q0K A;  2HJ3 A;  1QSP A;  3Q6M A;  4U9D A;  5IY5 C;  3EJN A;  3X1O A;  4GEH A;  3JZ0 A;  5K0I A;  4MVZ A;  2YQY A;  1CGO A;  2DYR C;  1KU2 A;  2ICW G;  1MMD A;  1I5N A;  3NMI A;  2Q9A A;  1H6G A;  2IXO A;  4ULW A;  2R9R B;  1TWH A;  2LSE A;  4ONS A;  3JCU Q;  2IXP A;  1SMY F;  2D4U A;  2R25 A;  4NTA A;  2YLG A;  3WOD F;  5DQT A;  4EBK A;  3DM9 B;  1HE1 A;  3TOM A;  1VK5 A;  2O9X A;  3EG9 B;  4CSA C;  2QE9 A;  4C3B A;  2J9U A;  1VB5 A;  3O10 A;  3B71 A;  2IYL D;  1R4T A;  3C8Z A;  5KYX B;  3R7C A;  4Z9J A;  1WTY A;  2P1A A;  1WOL A;  3I5P A;  2R02 A;  2I15 A;  5KYU A;  2R05 A;  1RJ9 B;  3HNK A;  1E84 A;  2LQG A;  3IPM O;  2OU6 A;  3DE8 A;  3IHU A;  3LS0 A;  2GA0 A;  1VYI A;  1OCR C;  5KYN A;  3TOL A;  2HJM A;  5AC5 A;  4BJT A;  3PDM P;  1BBH A;  2A68 F;  3HNL A;  4Q7C A;  2YZS A;  1RMV A;  2J46 A;  1T6U A;  2QLA A;  3EPV A;  2XLW A;  3AQC A;  3JRM O;  4N06 A;  2VCC A;  4O79 A;  3UR3 C;  3KKB A;  3VM6 A;  2KSF A;  2LCH A;  1WAS A;  4XLN F;  3B29 A;  3SYN A;  3ZWI A;  1XZQ A;  4KNW A;  1BR2 A;  3ZTM A;  4JTD B;  2VB6 A;  3NYJ A;  3S27 A;  1ZHY A;  1AEP A;  3KYJ A;  3RH3 A;  2AP3 A;  1LS4 A;  4XPW A;  4K7B A;  1T01 A;  2FGY A;  2JPU A;  4PJM A;  3U5S A;  3AGT A;  5CIV A;  4G7H F;  3VYW A;  1OXB A;  3B0U X;  3NDB B;  5GPG B;  2Y3H A; 
#chains in the Genus database with same CATH homology
 5B3I A;  3HNJ A;  2YL0 A;  1JAF A;  5JT4 A;  1CPQ A;  1E83 A;  2XLH A;  4D4X A;  3L1M A;  4N6H A;  4EIY A;  3ZTZ A;  1GQA A;  4JEA A;  1YZA A;  5AGF A;  1RCP A;  2XL8 A;  4IB4 A;  1CGN A;  3C63 A;  3ZQV A;  1APC A;  2YL1 A;  1CPR A;  4WGZ A;  1EKY A;  2J8W A;  3M15 A;  5JLI A;  3FOP A;  3M79 A;  4JKV A;  3NMK A;  5JVE A;  2YL7 A;  5JUA A;  3ZQY A;  3M4C A;  2YLI A;  2XL6 A;  2YKZ A;  3NMJ A;  4JE9 A;  3HNI A;  4U9E A;  2XLD A;  1YZC A;  2XLE A;  1QPU A;  1M6T A;  4D4N A;  3QVY A;  1QQ3 A;  2XM0 A;  2YLD A;  5JP7 A;  5JS5 A;  2XLV A;  3U8P A;  3VRC A;  3C62 A;  4U9D A;  4CDA A;  4JEB A;  3QVZ A;  2XM4 A;  4N4W A;  4L6R A;  1CGO A;  3NMI A;  1E85 A;  4NC3 A;  256B A;  2YLG A;  3TOM A;  2YL3 A;  4CIP A;  4CDV A;  1YYJ A;  5JRA A;  4IAQ A;  4CDY A;  4WGY A;  1NBB A;  3IQ5 A;  3HNK A;  1E84 A;  3DE8 A;  3TOL A;  3M4B A;  1BBH A;  3HNL A;  4CX9 A;  1YYX A;  4ULV A;  2CCY A;  2J9B A;  2QLA A;  1E86 A;  2XLW A;  2XLO A;  3FOO A;  2XLM A;  4CJO A;  1S05 A;  3ZWI A;  4IAR A;  1LM3 B;  3QW0 A;  3ZTM A;  3IQ6 A;  1MQV A;  2BC5 A;  5JSL A;  4ER9 A;  1A7V A;  3DE9 A;  3QW1 A;  4CJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...