1BBHA

Atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 angstroms resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
131
structure length
131
Chain Sequence
AGLSPEEQIETRQAGYEFMGWNMGKIKANLEGEYNAAQVEAAANVIAAIANSGMGALYGPGTDKNVGDVKTRVKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 A resolution.
pubmed doi rcsb
source organism Allochromatium vinosum
molecule tags Electron transport(heme protein)
total genus 53
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1bbhA00
3ZQYA 1QQ3A 2XLDA 3QVZA 1NBBA 4CX9A 2YLIA 4N4WA 3ZQVA 3VRCA 5JS5A 2XM4A 4CJOA 3M79A 3DE9A 5JLIA 1YYXA 4CDAA 2XLVA 3HNJA 1MQVA 4WGYA 4CDYA 2XLMA 2XLHA 1YYJA 5B3IA 2QLAA 2YLDA 256BA 1CPQA 1YZAA 3NMIA 5JRAA 2YL0A 4ULVA 2XL8A 4L6RA 1QPUA 4CDVA 5JVEA 2J9BA 2YL7A 5JSLA 4CJGA 3QW0A 3M4BA 2YKZA 4JE9A 2XLWA 2XM0A 2XLOA 4NC3A 5JP7A 1RCPA 3U8PA 1E84A 3QVYA 4U9EA 3ZTZA 4ER9A 4D4NA 4IAQA 3TOMA 3L1MA 1CGNA 3C63A 4CIPA 4D4XA 1M6TA 3HNIA 1LM3B 3ZWIA 5JUAA 1E85A 2CCYA 3DE8A 3M4CA 4JEBA 4IARA 4U9DA 1A7VA 4JKVA 1GQAA 3ZTMA 1APCA 3NMJA 3IQ6A 1E83A 1EKYA 3FOOA 1CGOA 2BC5A 3IQ5A 4IB4A 4N6HA 2J8WA 3QW1A 5JT4A 1CPRA 2XLEA 3HNLA 2XL6A 5AGFA 1YZCA 3M15A 2YLGA 3HNKA 1E86A 4WGZA 3C62A 4JEAA 1S05A 2YL1A 3TOLA 4EIYA 1BBHA 3FOPA 2YL3A 3NMKA 1JAFA
chains in the Genus database with same CATH superfamily
5DQTA 3LJBA 1C03A 1UFBA 2XLDA 4OIRF 4BJ5A 3SNHA 3RYLA 1BR4A 4N4WA 1YARO 5KYUA 1N1CA 3VRCA 3BRJA 5E33A 3JCUQ 5L0JA 1ZU5A 4N6CA 1QLEC 5JS5A 4AX2A 4CJOA 1H6GA 3M79A 5JLIA 3LLIA 3Q7GA 1L7CA 3SP1A 4CDAA 1TWCA 3U0CA 2D5RB 2HSBA 3ZC4A 4XQ1A 2XXAA 2XLMA 2UUIA 3F46A 1Z3IX 4KNVA 2EINC 3HKKA 3S9OA 2MHRA 1Y6DA 4MW3A 3ASOC 3A11A 2H8AA 3NYLA 1PD1A 4E18A 2HJ3A 2R7XA 1VMAA 3O10A 2RSEB 1JPJA 1MMDA 2XL8A 3K66A 4YT4A 1TWAA 3UR3C 3BEHA 4JW1A 1FMVA 1OCZC 2YEVA 1QKRA 1RJ9A 4CDVA 5BUOA 5JVEA 2C04A 3EGDB 1SMYF 3S84A 3TK0A 3IQTA 3K1IC 5JSLA 3L8IA 3IHUA 3U3BA 3M4BA 2YZSA 4HEAJ 1O87A 2RD9A 1YDIA 1TWGA 4JE9A 5D92A 5B3SC 4ZLDA 2OKUA 3O6XA 4Q7CA 1ZHWA 3K6BA 1A7EA 4NC3A 3U8PA 1E84A 2XRHA 3K7DA 2BE5F 4H54A 4JJGA 4JTAB 2Z15A 3N0TA 3ZTZA 4GQHA 2A0BA 4MVZA 4BJ5C 3N2ZB 2CW0F 3EPVA 4BPMA 4ANJA 3AOUA 2QE9A 4IAQA 1LE2A 2CYDA 5KYYB 3JYHA 4CSAA 1Z7Qc 3GORA 3KMIA 3IQCA 3TOMA 4G0HA 1LPEA 2AU5A 1O3UA 2EPNA 2PX0A 3DD7A 1JOGA 1VYKA 3L1MA 1J8MF 4IWBA 5E3CA 4WABA 3T6JA 3UMIA 5DS6A 3KH2A 1K05A 4O6MA 2LFFA 1ORJA 3VF0A 1MMAA 1D1CA 3L8JA 4Z9IA 1HW1A 2AVKA 3K33A 4IJJA 1NU9C 4AL1A 5TJ5E 2DB4A 2DYSC 2KNHA 3SEOA 1YJGA 3AQBA 5EGYA 4XLNF 1QZXA 2LQGA 2VC9A 3V7OA 2IM8A 2CCYA 4K0DA 2HFIA 3U2LA 1ORSC 4ZLCA 2L9JA 4PJLA 4C7OB 2KK1A 3RVYA 3S90A 5D91A 2C03A 2IYLD 4YL0A 3NMJA 3KPHA 1A7DA 2P1AA 2Y3DA 2OEXA 5KYNA 5CIVA 2B0HA 1CGOA 1OR3A 3O55A 1BZ4A 3GEEA 2P6VA 1KNYA 3DWWA 3TJ6A 1Y4CA 2EPOA 4N6HA 1K04A 3CAXA 4PJJA 4PFPA 1LIHA 1WTYA 2JX0A 3QW1A 2KGOA 2DYRC 2XLEA 4AK9A 3AGUA 1FTSA 3SXMA 3W8HA 1I4YA 1V54C 3F47A 2NUTB 3G4ZA 1YZCA 3M15A 1OCOC 3LS0A 4JVSA 5L0GA 3SZRA 1QVXA 1XZPA 1ZHZA 3NYMA 4CSAC 2EIKC 4MVOA 2B0JA 2L6FA 1ORYA 2L6GA 2Y3BA 4LACB 1HMOA 2VASA 4FWVA 2LCHA 4QDLA 2YL1A 2L81A 1MMGA 4NCQA 3J06A 4E0IA 1BBHA 2HS5A 2R02A 3RQFA 4Q5SF 1V74B 2YL3A 1O5HA 1JAFA 3NMKA 1JPNA 2HKVA 4JCHA 3U3FA 1RKEB 1YA7O 2KYHA 1I4ZA 1QQ3A 4U5FE 3EFOB 3GEHA 5FCLA 2OU6A 5L0HA 3GM2A 3EHMA 2VCCA 4JJFA 2A6EF 3WG7C 4CX9A 5L3QA 2HMZA 3EG9B 3ZQVA 4BG0A 1OW6A 2NUPB 4C3EA 3M1CB 1AEPA 3LUTB 5COGA 1ZW2A 2ZXPA 2WL8A 1T01A 2XM4A 3DI5A 4JURI 5CI9A 3DE9A 3NG1A 3S28A 5KYWA 1JMWA 2R7RA 2Q00A 1YYXA 2AWCA 4MVUA 5DQZA 4PJNA 4RD9A 1OQCA 1Z5ZA 1R4TA 3HNJA 1Q0KA 5T3WA 4MVQA 4WGYA 1HE9A 3AQCA 2Y39A 1Q0DA 3UMHA 5B3IA 3NDBB 3AG1C 3C7JA 2YLDA 3JRMO 4K7BA 3C18A 3R2PA 3ZG1A 4A4AA 5BQIA 2KC3A 1QSPA 2WVOA 1H7IA 4JTDB 2YQYA 2G3KA 3E9VA 3FHDA 2A6HF 2WZFA 4HE8D 4OD4A 4ULVA 3PMRA 2EPKX 4A2NB 5AC4A 2NSGA 4DRHB 1OW8A 2A0UA 3C8GD 3RIPA 3RQGA 3UGPA 3U5SA 3ITFA 2OOCA 5KYUB 2EPLX 2YL7A 1M2VA 2IXNA 2J9WA 1XWJA 3ZVRA 3QW0A 1M2OA 3G50A 5BQGA 3RW0A 2OEVA 2LK4A 4EHPA 2OJED 2KW3C 1T5OA 2PF4E 4U9EA 3IPMO 4O79A 1TR2A 2M4EA 4XPYA 3C8GA 2QNLA 4KC9A 2HUJA 5L0FA 1U0BB 2PP4A 2R7OA 3Q6MA 4D4NA 3QTHA 3MBGA 4J32B 5L0CA 4GEHA 1FFHA 1VB5A 3RH3A 5L0IA 1RMVA 2H7VC 4YJWA 4QI2A 2KSFA 2MYSA 4XTKA 3W8IA 4I3MA 2J9UA 3ASNC 2R9RB 1U6HA 2VB6A 4MVRA 1SYQA 2NG1A 3JSZA 1WASA 4MTOA 4NQFA 1M6TA 2GFHA 2LFDA 2KQ9A 1D0ZA 4BJ1A 2L6HA 2Q4FA 3OA1A 2NPUA 3U9JA 4EKWA 5F28E 1GS9A 1YLMA 2Q9AA 4G7OF 3W2VA 3RQEA 1ST6A 2KJGA 2HJMA 4JEBA 5IY5C 3LEVA 1FFTC 4JTCB 2MWQA 4HFFB 2IBFA 2VCAA 3B0PA 3MX3A 4LERA 4P9FA 4G7ZF 4YT2A 3FAPB 1VOMA 3U8VA 1ZZPA 1MMNA 3FMSA 3FOOA 1WOLA 1SR2A 4J30B 4DVZA 5B1BC 1ZHYA 1M57C 4EWCA 3KYIA 2PFDA 5FZTA 1WN0A 3MFNA 3UGOA 1I5NA 1DOVA 1G4US 3EGDA 4YK5A 3DM5A 3LESA 4PACA 1OCCC 3R7CA 2WVNA 1MNEA 2GDCA 3KYJA 3HNLA 4K1OA 2XL6A 4XEFA 4P9TA 4Z9HA 5EK0A 1A0BA 3X1OA 4CS8A 1GM5A 4N06A 1Q0MA 2HSQA 3HNKA 4O7GA 2E87A 5GPGB 4NTFA 5KYXB 5T3TA 3EZHA 3S27A 4EBKA 4JEAA 4C3DA 4RDAA 3US6A 1OXBA 1EA8A 3WODF 2ZXWC 3QZCA 4MNDA 3DJNB 3C62A 2PBEA 2R7WA 2X0CA 4MTFA 1FMWA 3ZQYA 1UG7A 4CS9A 3DXJF 1HMDA 1XZQA 3QVZA 3T4RA 3I4UA 4ULWA 2AWYA 2ICWG 3SXKA 2FAPB 2ZXRA 1LI5A 1NFOA 4XPWA 4J7YA 3VAYA 2Y69C 5A6JA 3W4YA 2L7AA 2A69F 3CSKA 2DGJA 2GAQA 3CZ6A 1YVIA 4KBLA 3V5XA 4I1OB 2P0NA 2CGEA 3NKDA 3TJ5A 3X2QC 4E7ZA 3S29A 1NSGB 1FNTc 2R05A 2J0XA 2XLHA 4W8KA 5HV9A 3K1HA 4C7OA 3ZSUA 3SYNA 1S7ZA 4B6IA 1HE1A 2J45A 4MTGA 3LS1A 5DLJA 1CPQA 1YZAA 2EIJC 2HZ8A 2GWWA 3NMIA 2AP3A 3B29A 2FFHA 2YL0A 3GEIA 4U5HA 5DS5A 1VTMP 3L34A 3LNRA 1HY5A 4L6RA 4YL3A 4QI0A 3TQOA 4CS8C 1VLSA 1QPUA 1E2XA 3DAFA 1T9KA 3OEOA 4GYTA 2P61A 1F1MA 4PJMA 3NKEA 4XPXA 5E2QA 4C3BA 2H7OA 2TMVP 2R7VA 3WAQA 3EGXA 4JC7A 1VYIA 2NUTA 1NZEA 4IAOA 4AE4A 2HV7A 3H65A 1KU2A 3W2WA 1LI7A 5KYWB 5F5FA 5AC5A 2XLWA 2XM0A 1RKCA 3B0UX 2W9YA 3OWTA 2XLOA 1BR1A 5A6BD 2Q7RA 4CS7A 1PV3A 4I44A 2R7QA 3C8ZA 5T1DB 2ZXOA 4DRIB 1H9TA 2OCCC 2OG2A 4XEKA 3FXHA 2LP4A 4P6IC 4PK4A 3JZ0A 4M63A 2P7VA 3DZAA 3RVZA 4CS9C 3O39A 4U5DE 5EHHA 2PX3A 4U5EE 5E3AA 4OIPF 2IOQA 1WWPA 2HV6A 3EFOA 3EJNA 3JSEO 4R32A 4FESA 3DJUB 2DI3A 1CGNA 3GWLA 4X0RA 4ONSA 4YT5A 3C63A 3EG9A 1TQGA 1OCRC 2NUPA 2Q9CA 5A6BA 3EH2A 3EQLF 5B1AC 4LLCA 4W8PA 4D4XA 1L3PA 1NFNA 2PNOA 5CI8A 2ZD9A 4DJ9A 5JUAA 1OKKD 1Z6AA 3NRHA 1ZHTA 1E85A 2QY9A 1OR2A 3GODA 3EH1A 3GANA 3U2MA 3HJCA 2G62A 3M4CA 2XXAB 1TFKB 3B9QA 4IARA 3AG2C 4U9DA 1A7VA 1ZW3A 3C8GB 5DS4A 1GQAA 2YWAA 4LDQA 1APCA 4Z9JA 3IQ6A 1E83A 3GM1A 4G78A 4MVSA 4U5GA 3EHNA 1C17M 5K0IA 1D0XA 4MS2A 3A9CA 4MQ9F 4FX5A 3G4XA 1OKKA 5COMA 1SF8A 4DOZA 3HTKC 2IXMA 3IQ5A 1W2WA 2VH3A 3UMKA 1WATA 2A1DD 4IB4A 3POVA 1MNDA 2R7TA 1T6QA 2EIMC 1WGWA 1B68A 1CPRA 1RJ9B 3LNMB 4U5CE 5JT4A 1CGME 2G3VA 3V5ZA 4OIOF 1D1BA 4FAPB 3ZDLA 3RFYA 1NLXA 3DM9B 2W4BA 1Z63A 5BQHA 4G7HF 4EUKB 1ZYRF 4YT8A 2GA0A 2ETSA 3PCVA 1RXQA 1S05A 2IXOA 2LSEA 3ABMC 3VM6A 2F22A 1TFOB 3VYWA 3JTLO 1H9GA 1PD0A 2YLGA 1DOWA 3FVYA 2XL4A 4JCZA 4JIOA 2W45A 3I5QA 4XLPF 1R5ID 2R03A 4NY3A 4DBQA 4YWQA 2A68F 4IGGA 1M56C 4MVMA 4XWJA 1NBBA 3AG3C 2YLIA 4UDVA 4BJTA 4RBNA 4LDRA 1V4AA 1BR2A 3SXYA 4JRZA 1Q0FA 2YHSA 1Q0GA 2JD3A 2V26A 4BEJA 3ZIBA 4PR9A 5JRAA 2Q9BA 4F4BA 2OJQA 2J7PD 3DAGA 2XLVA 2XS1A 4Q4ZF 3KL4A 1MQVA 1NG1A 4LDKA 4CDYA 1EQ1A 1D1AA 4MW8A 1YYJA 4OINF 3JYYA 2QLAA 3ATPA 3DKAA 4BJ6A 1NU7D 1BDJB 4IRUA 3QMKA 256BA 2W4MA 2R25A 3PDMP 4E17A 1JR8A 2V3CC 2R7SA 2BL2A 3CEXA 1G4WR 1PCXA 4KNWA 3WHNA 5KYYA 5COFA 4OD5A 3T9OA 2EILC 3GWNA 3ABKC 2X51A 1OXKA 1IZMA 1SZIA 3ECSA 3NYJA 3FDQA 1LE4A 2J7PA 1U89A 3MYIA 1VLTA 3FAJA 2IXPA 2J9BA 1LS4A 3EZIA 4CJGA 1IW7F 1EI7A 1J8YF 2ZPAA 2OQMA 1FR0A 2YKZA 3JT1A 1ZU4A 3B0VC 2LD6A 5KYXA 5JP7A 2JPUA 1RCPA 3DMDA 1A41A 5A6AA 1VK5A 3QVYA 3U9MA 2QTVA 1JRAA 4J7TA 3TULA 1Z23A 4H4KC 4U5BE 2Y3HA 4JZAA 4ER9A 4DVYP 3S0XA 5DVWA 2J0WA 3AJMA 4LLEA 4O6NA 3UNGC 1LVKA 3AGTA 2D4UA 1K40A 1AVOB 4CBEA 2H7BA 3T6BA 2WZGA 1YAUO 4OIQF 1KTMA 1T6UA 2UUHA 3V5YA 3PHF2 1LS1A 3RF3A 4CIPA 2CNWD 3Q6NA 1TKNA 4DBRA 3N24A 3E70C 3GM3A 3L0IA 1FAPB 3HNIA 3EGXB 4NTAA 1LM3B 4AE4B 3ZWIA 2YRFA 2R7UA 4BJ6C 1ZHXA 4DRJB 3JRTA 3HLZA 3IEEA 3DE8A 3LLKA 3T6GB 3MLGA 2NSFA 2WVQA 4YL1A 3I5PA 4EBJA 3LAYA 1OW7A 2EPMX 4JKVA 4E7SA 4CIHA 3ZTMA 2CNWA 1V55C 4PFOA 3MYFA 1EKYA 2WB7A 2WZLA 3AG4C 2YVKA 1G5ZA 1RKEA 2HMQA 2BC5A 3KKBA 4KI2A 1AUEA 1T6IA 2J9VA 3H2UA 5F5HA 1GGQA 4DXWA 2I8BA 4YN0B 2J8WA 5HSWA 2ASRA 1LKXA 4I1MA 2O9XA 1C02A 5A6KA 1D0YA 2XSEA 1HW2A 1M2VB 2J46A 1G8XA 5L3VA 3SXZA 5A69A 2XS8A 5AGFA 2Y3GA 1E86A 3ABLC 4BEMJ 4NTBA 3H2VA 4WGZA 4E0HA 4AL0A 3K1IA 2CDQA 3Q7LA 4WJ0A 4XEVA 3TD7A 4EBBA 3CQZA 4HFKB 1ZVZA 2M64A 4O6YA 2I15A 3TOLA 4EIYA 3RKOF 2QUPA 2Q3TA 2FGYA 3LEOA 2LIGA 5L0DA 3FOPA 1TWHA 3B71A 1YA9A 2VCBA
chains in the Genus database with same CATH topology
3ZQYA 1QQ3A 2XLDA 3QVZA 1NBBA 4CX9A 2YLIA 4N4WA 3ZQVA 3VRCA 5JS5A 2XM4A 4CJOA 3M79A 3DE9A 5JLIA 1YYXA 4CDAA 2XLVA 3HNJA 1MQVA 4WGYA 4CDYA 2XLMA 2XLHA 1YYJA 5B3IA 2QLAA 2YLDA 256BA 1CPQA 1YZAA 3NMIA 5JRAA 2YL0A 4ULVA 2XL8A 4L6RA 1QPUA 4CDVA 5JVEA 2J9BA 2YL7A 5JSLA 4CJGA 3QW0A 3M4BA 2YKZA 4JE9A 2XLWA 2XM0A 2XLOA 4NC3A 5JP7A 1RCPA 3U8PA 1E84A 3QVYA 4U9EA 3ZTZA 4ER9A 4D4NA 4IAQA 3TOMA 3L1MA 1CGNA 3C63A 4CIPA 4D4XA 1M6TA 3HNIA 1LM3B 3ZWIA 5JUAA 1E85A 2CCYA 3DE8A 3M4CA 4JEBA 4IARA 4U9DA 1A7VA 4JKVA 1GQAA 3ZTMA 1APCA 3NMJA 3IQ6A 1E83A 1EKYA 3FOOA 1CGOA 2BC5A 3IQ5A 4IB4A 4N6HA 2J8WA 3QW1A 5JT4A 1CPRA 2XLEA 3HNLA 2XL6A 5AGFA 1YZCA 3M15A 2YLGA 3HNKA 1E86A 4WGZA 3C62A 4JEAA 1S05A 2YL1A 3TOLA 4EIYA 1BBHA 3FOPA 2YL3A 3NMKA 1JAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQY A;  1QQ3 A;  2XLD A;  3QVZ A;  1NBB A;  4CX9 A;  2YLI A;  4N4W A;  3ZQV A;  3VRC A;  5JS5 A;  2XM4 A;  4CJO A;  3M79 A;  3DE9 A;  5JLI A;  1YYX A;  4CDA A;  2XLV A;  3HNJ A;  1MQV A;  4WGY A;  4CDY A;  2XLM A;  2XLH A;  1YYJ A;  5B3I A;  2QLA A;  2YLD A;  256B A;  1CPQ A;  1YZA A;  3NMI A;  5JRA A;  2YL0 A;  4ULV A;  2XL8 A;  4L6R A;  1QPU A;  4CDV A;  5JVE A;  2J9B A;  2YL7 A;  5JSL A;  4CJG A;  3QW0 A;  3M4B A;  2YKZ A;  4JE9 A;  2XLW A;  2XM0 A;  2XLO A;  4NC3 A;  5JP7 A;  1RCP A;  3U8P A;  1E84 A;  3QVY A;  4U9E A;  3ZTZ A;  4ER9 A;  4D4N A;  4IAQ A;  3TOM A;  3L1M A;  1CGN A;  3C63 A;  4CIP A;  4D4X A;  1M6T A;  3HNI A;  1LM3 B;  3ZWI A;  5JUA A;  1E85 A;  2CCY A;  3DE8 A;  3M4C A;  4JEB A;  4IAR A;  4U9D A;  1A7V A;  4JKV A;  1GQA A;  3ZTM A;  1APC A;  3NMJ A;  3IQ6 A;  1E83 A;  1EKY A;  3FOO A;  1CGO A;  2BC5 A;  3IQ5 A;  4IB4 A;  4N6H A;  2J8W A;  3QW1 A;  5JT4 A;  1CPR A;  2XLE A;  3HNL A;  2XL6 A;  5AGF A;  1YZC A;  3M15 A;  2YLG A;  3HNK A;  1E86 A;  4WGZ A;  3C62 A;  4JEA A;  1S05 A;  2YL1 A;  3TOL A;  4EIY A;  1BBH A;  3FOP A;  2YL3 A;  3NMK A;  1JAF A; 
#chains in the Genus database with same CATH topology
 5DQT A;  3LJB A;  1C03 A;  1UFB A;  2XLD A;  4OIR F;  4BJ5 A;  3SNH A;  3RYL A;  1BR4 A;  4N4W A;  1YAR O;  5KYU A;  1N1C A;  3VRC A;  3BRJ A;  5E33 A;  3JCU Q;  5L0J A;  1ZU5 A;  4N6C A;  1QLE C;  5JS5 A;  4AX2 A;  4CJO A;  1H6G A;  3M79 A;  5JLI A;  3LLI A;  3Q7G A;  1L7C A;  3SP1 A;  4CDA A;  1TWC A;  3U0C A;  2D5R B;  2HSB A;  3ZC4 A;  4XQ1 A;  2XXA A;  2XLM A;  2UUI A;  3F46 A;  1Z3I X;  4KNV A;  2EIN C;  3HKK A;  3S9O A;  2MHR A;  1Y6D A;  4MW3 A;  3ASO C;  3A11 A;  2H8A A;  3NYL A;  1PD1 A;  4E18 A;  2HJ3 A;  2R7X A;  1VMA A;  3O10 A;  2RSE B;  1JPJ A;  1MMD A;  2XL8 A;  3K66 A;  4YT4 A;  1TWA A;  3UR3 C;  3BEH A;  4JW1 A;  1FMV A;  1OCZ C;  2YEV A;  1QKR A;  1RJ9 A;  4CDV A;  5BUO A;  5JVE A;  2C04 A;  3EGD B;  1SMY F;  3S84 A;  3TK0 A;  3IQT A;  3K1I C;  5JSL A;  3L8I A;  3IHU A;  3U3B A;  3M4B A;  2YZS A;  4HEA J;  1O87 A;  2RD9 A;  1YDI A;  1TWG A;  4JE9 A;  5D92 A;  5B3S C;  4ZLD A;  2OKU A;  3O6X A;  4Q7C A;  1ZHW A;  3K6B A;  1A7E A;  4NC3 A;  3U8P A;  1E84 A;  2XRH A;  3K7D A;  2BE5 F;  4H54 A;  4JJG A;  4JTA B;  2Z15 A;  3N0T A;  3ZTZ A;  4GQH A;  2A0B A;  4MVZ A;  4BJ5 C;  3N2Z B;  2CW0 F;  3EPV A;  4BPM A;  4ANJ A;  3AOU A;  2QE9 A;  4IAQ A;  1LE2 A;  2CYD A;  5KYY B;  3JYH A;  4CSA A;  1Z7Q c;  3GOR A;  3KMI A;  3IQC A;  3TOM A;  4G0H A;  1LPE A;  2AU5 A;  1O3U A;  2EPN A;  2PX0 A;  3DD7 A;  1JOG A;  1VYK A;  3L1M A;  1J8M F;  4IWB A;  5E3C A;  4WAB A;  3T6J A;  3UMI A;  5DS6 A;  3KH2 A;  1K05 A;  4O6M A;  2LFF A;  1ORJ A;  3VF0 A;  1MMA A;  1D1C A;  3L8J A;  4Z9I A;  1HW1 A;  2AVK A;  3K33 A;  4IJJ A;  1NU9 C;  4AL1 A;  5TJ5 E;  2DB4 A;  2DYS C;  2KNH A;  3SEO A;  1YJG A;  3AQB A;  5EGY A;  4XLN F;  1QZX A;  2LQG A;  2VC9 A;  3V7O A;  2IM8 A;  2CCY A;  4K0D A;  2HFI A;  3U2L A;  1ORS C;  4ZLC A;  2L9J A;  4PJL A;  4C7O B;  2KK1 A;  3RVY A;  3S90 A;  5D91 A;  2C03 A;  2IYL D;  4YL0 A;  3NMJ A;  3KPH A;  1A7D A;  2P1A A;  2Y3D A;  2OEX A;  5KYN A;  5CIV A;  2B0H A;  1CGO A;  1OR3 A;  3O55 A;  1BZ4 A;  3GEE A;  2P6V A;  1KNY A;  3DWW A;  3TJ6 A;  1Y4C A;  2EPO A;  4N6H A;  1K04 A;  3CAX A;  4PJJ A;  4PFP A;  1LIH A;  1WTY A;  2JX0 A;  3QW1 A;  2KGO A;  2DYR C;  2XLE A;  4AK9 A;  3AGU A;  1FTS A;  3SXM A;  3W8H A;  1I4Y A;  1V54 C;  3F47 A;  2NUT B;  3G4Z A;  1YZC A;  3M15 A;  1OCO C;  3LS0 A;  4JVS A;  5L0G A;  3SZR A;  1QVX A;  1XZP A;  1ZHZ A;  3NYM A;  4CSA C;  2EIK C;  4MVO A;  2B0J A;  2L6F A;  1ORY A;  2L6G A;  2Y3B A;  4LAC B;  1HMO A;  2VAS A;  4FWV A;  2LCH A;  4QDL A;  2YL1 A;  2L81 A;  1MMG A;  4NCQ A;  3J06 A;  4E0I A;  1BBH A;  2HS5 A;  2R02 A;  3RQF A;  4Q5S F;  1V74 B;  2YL3 A;  1O5H A;  1JAF A;  3NMK A;  1JPN A;  2HKV A;  4JCH A;  3U3F A;  1RKE B;  1YA7 O;  2KYH A;  1I4Z A;  1QQ3 A;  4U5F E;  3EFO B;  3GEH A;  5FCL A;  2OU6 A;  5L0H A;  3GM2 A;  3EHM A;  2VCC A;  4JJF A;  2A6E F;  3WG7 C;  4CX9 A;  5L3Q A;  2HMZ A;  3EG9 B;  3ZQV A;  4BG0 A;  1OW6 A;  2NUP B;  4C3E A;  3M1C B;  1AEP A;  3LUT B;  5COG A;  1ZW2 A;  2ZXP A;  2WL8 A;  1T01 A;  2XM4 A;  3DI5 A;  4JUR I;  5CI9 A;  3DE9 A;  3NG1 A;  3S28 A;  5KYW A;  1JMW A;  2R7R A;  2Q00 A;  1YYX A;  2AWC A;  4MVU A;  5DQZ A;  4PJN A;  4RD9 A;  1OQC A;  1Z5Z A;  1R4T A;  3HNJ A;  1Q0K A;  5T3W A;  4MVQ A;  4WGY A;  1HE9 A;  3AQC A;  2Y39 A;  1Q0D A;  3UMH A;  5B3I A;  3NDB B;  3AG1 C;  3C7J A;  2YLD A;  3JRM O;  4K7B A;  3C18 A;  3R2P A;  3ZG1 A;  4A4A A;  5BQI A;  2KC3 A;  1QSP A;  2WVO A;  1H7I A;  4JTD B;  2YQY A;  2G3K A;  3E9V A;  3FHD A;  2A6H F;  2WZF A;  4HE8 D;  4OD4 A;  4ULV A;  3PMR A;  2EPK X;  4A2N B;  5AC4 A;  2NSG A;  4DRH B;  1OW8 A;  2A0U A;  3C8G D;  3RIP A;  3RQG A;  3UGP A;  3U5S A;  3ITF A;  2OOC A;  5KYU B;  2EPL X;  2YL7 A;  1M2V A;  2IXN A;  2J9W A;  1XWJ A;  3ZVR A;  3QW0 A;  1M2O A;  3G50 A;  5BQG A;  3RW0 A;  2OEV A;  2LK4 A;  4EHP A;  2OJE D;  2KW3 C;  1T5O A;  2PF4 E;  4U9E A;  3IPM O;  4O79 A;  1TR2 A;  2M4E A;  4XPY A;  3C8G A;  2QNL A;  4KC9 A;  2HUJ A;  5L0F A;  1U0B B;  2PP4 A;  2R7O A;  3Q6M A;  4D4N A;  3QTH A;  3MBG A;  4J32 B;  5L0C A;  4GEH A;  1FFH A;  1VB5 A;  3RH3 A;  5L0I A;  1RMV A;  2H7V C;  4YJW A;  4QI2 A;  2KSF A;  2MYS A;  4XTK A;  3W8I A;  4I3M A;  2J9U A;  3ASN C;  2R9R B;  1U6H A;  2VB6 A;  4MVR A;  1SYQ A;  2NG1 A;  3JSZ A;  1WAS A;  4MTO A;  4NQF A;  1M6T A;  2GFH A;  2LFD A;  2KQ9 A;  1D0Z A;  4BJ1 A;  2L6H A;  2Q4F A;  3OA1 A;  2NPU A;  3U9J A;  4EKW A;  5F28 E;  1GS9 A;  1YLM A;  2Q9A A;  4G7O F;  3W2V A;  3RQE A;  1ST6 A;  2KJG A;  2HJM A;  4JEB A;  5IY5 C;  3LEV A;  1FFT C;  4JTC B;  2MWQ A;  4HFF B;  2IBF A;  2VCA A;  3B0P A;  3MX3 A;  4LER A;  4P9F A;  4G7Z F;  4YT2 A;  3FAP B;  1VOM A;  3U8V A;  1ZZP A;  1MMN A;  3FMS A;  3FOO A;  1WOL A;  1SR2 A;  4J30 B;  4DVZ A;  5B1B C;  1ZHY A;  1M57 C;  4EWC A;  3KYI A;  2PFD A;  5FZT A;  1WN0 A;  3MFN A;  3UGO A;  1I5N A;  1DOV A;  1G4U S;  3EGD A;  4YK5 A;  3DM5 A;  3LES A;  4PAC A;  1OCC C;  3R7C A;  2WVN A;  1MNE A;  2GDC A;  3KYJ A;  3HNL A;  4K1O A;  2XL6 A;  4XEF A;  4P9T A;  4Z9H A;  5EK0 A;  1A0B A;  3X1O A;  4CS8 A;  1GM5 A;  4N06 A;  1Q0M A;  2HSQ A;  3HNK A;  4O7G A;  2E87 A;  5GPG B;  4NTF A;  5KYX B;  5T3T A;  3EZH A;  3S27 A;  4EBK A;  4JEA A;  4C3D A;  4RDA A;  3US6 A;  1OXB A;  1EA8 A;  3WOD F;  2ZXW C;  3QZC A;  4MND A;  3DJN B;  3C62 A;  2PBE A;  2R7W A;  2X0C A;  4MTF A;  1FMW A;  3ZQY A;  1UG7 A;  4CS9 A;  3DXJ F;  1HMD A;  1XZQ A;  3QVZ A;  3T4R A;  3I4U A;  4ULW A;  2AWY A;  2ICW G;  3SXK A;  2FAP B;  2ZXR A;  1LI5 A;  1NFO A;  4XPW A;  4J7Y A;  3VAY A;  2Y69 C;  5A6J A;  3W4Y A;  2L7A A;  2A69 F;  3CSK A;  2DGJ A;  2GAQ A;  3CZ6 A;  1YVI A;  4KBL A;  3V5X A;  4I1O B;  2P0N A;  2CGE A;  3NKD A;  3TJ5 A;  3X2Q C;  4E7Z A;  3S29 A;  1NSG B;  1FNT c;  2R05 A;  2J0X A;  2XLH A;  4W8K A;  5HV9 A;  3K1H A;  4C7O A;  3ZSU A;  3SYN A;  1S7Z A;  4B6I A;  1HE1 A;  2J45 A;  4MTG A;  3LS1 A;  5DLJ A;  1CPQ A;  1YZA A;  2EIJ C;  2HZ8 A;  2GWW A;  3NMI A;  2AP3 A;  3B29 A;  2FFH A;  2YL0 A;  3GEI A;  4U5H A;  5DS5 A;  1VTM P;  3L34 A;  3LNR A;  1HY5 A;  4L6R A;  4YL3 A;  4QI0 A;  3TQO A;  4CS8 C;  1VLS A;  1QPU A;  1E2X A;  3DAF A;  1T9K A;  3OEO A;  4GYT A;  2P61 A;  1F1M A;  4PJM A;  3NKE A;  4XPX A;  5E2Q A;  4C3B A;  2H7O A;  2TMV P;  2R7V A;  3WAQ A;  3EGX A;  4JC7 A;  1VYI A;  2NUT A;  1NZE A;  4IAO A;  4AE4 A;  2HV7 A;  3H65 A;  1KU2 A;  3W2W A;  1LI7 A;  5KYW B;  5F5F A;  5AC5 A;  2XLW A;  2XM0 A;  1RKC A;  3B0U X;  2W9Y A;  3OWT A;  2XLO A;  1BR1 A;  5A6B D;  2Q7R A;  4CS7 A;  1PV3 A;  4I44 A;  2R7Q A;  3C8Z A;  5T1D B;  2ZXO A;  4DRI B;  1H9T A;  2OCC C;  2OG2 A;  4XEK A;  3FXH A;  2LP4 A;  4P6I C;  4PK4 A;  3JZ0 A;  4M63 A;  2P7V A;  3DZA A;  3RVZ A;  4CS9 C;  3O39 A;  4U5D E;  5EHH A;  2PX3 A;  4U5E E;  5E3A A;  4OIP F;  2IOQ A;  1WWP A;  2HV6 A;  3EFO A;  3EJN A;  3JSE O;  4R32 A;  4FES A;  3DJU B;  2DI3 A;  1CGN A;  3GWL A;  4X0R A;  4ONS A;  4YT5 A;  3C63 A;  3EG9 A;  1TQG A;  1OCR C;  2NUP A;  2Q9C A;  5A6B A;  3EH2 A;  3EQL F;  5B1A C;  4LLC A;  4W8P A;  4D4X A;  1L3P A;  1NFN A;  2PNO A;  5CI8 A;  2ZD9 A;  4DJ9 A;  5JUA A;  1OKK D;  1Z6A A;  3NRH A;  1ZHT A;  1E85 A;  2QY9 A;  1OR2 A;  3GOD A;  3EH1 A;  3GAN A;  3U2M A;  3HJC A;  2G62 A;  3M4C A;  2XXA B;  1TFK B;  3B9Q A;  4IAR A;  3AG2 C;  4U9D A;  1A7V A;  1ZW3 A;  3C8G B;  5DS4 A;  1GQA A;  2YWA A;  4LDQ A;  1APC A;  4Z9J A;  3IQ6 A;  1E83 A;  3GM1 A;  4G78 A;  4MVS A;  4U5G A;  3EHN A;  1C17 M;  5K0I A;  1D0X A;  4MS2 A;  3A9C A;  4MQ9 F;  4FX5 A;  3G4X A;  1OKK A;  5COM A;  1SF8 A;  4DOZ A;  3HTK C;  2IXM A;  3IQ5 A;  1W2W A;  2VH3 A;  3UMK A;  1WAT A;  2A1D D;  4IB4 A;  3POV A;  1MND A;  2R7T A;  1T6Q A;  2EIM C;  1WGW A;  1B68 A;  1CPR A;  1RJ9 B;  3LNM B;  4U5C E;  5JT4 A;  1CGM E;  2G3V A;  3V5Z A;  4OIO F;  1D1B A;  4FAP B;  3ZDL A;  3RFY A;  1NLX A;  3DM9 B;  2W4B A;  1Z63 A;  5BQH A;  4G7H F;  4EUK B;  1ZYR F;  4YT8 A;  2GA0 A;  2ETS A;  3PCV A;  1RXQ A;  1S05 A;  2IXO A;  2LSE A;  3ABM C;  3VM6 A;  2F22 A;  1TFO B;  3VYW A;  3JTL O;  1H9G A;  1PD0 A;  2YLG A;  1DOW A;  3FVY A;  2XL4 A;  4JCZ A;  4JIO A;  2W45 A;  3I5Q A;  4XLP F;  1R5I D;  2R03 A;  4NY3 A;  4DBQ A;  4YWQ A;  2A68 F;  4IGG A;  1M56 C;  4MVM A;  4XWJ A;  1NBB A;  3AG3 C;  2YLI A;  4UDV A;  4BJT A;  4RBN A;  4LDR A;  1V4A A;  1BR2 A;  3SXY A;  4JRZ A;  1Q0F A;  2YHS A;  1Q0G A;  2JD3 A;  2V26 A;  4BEJ A;  3ZIB A;  4PR9 A;  5JRA A;  2Q9B A;  4F4B A;  2OJQ A;  2J7P D;  3DAG A;  2XLV A;  2XS1 A;  4Q4Z F;  3KL4 A;  1MQV A;  1NG1 A;  4LDK A;  4CDY A;  1EQ1 A;  1D1A A;  4MW8 A;  1YYJ A;  4OIN F;  3JYY A;  2QLA A;  3ATP A;  3DKA A;  4BJ6 A;  1NU7 D;  1BDJ B;  4IRU A;  3QMK A;  256B A;  2W4M A;  2R25 A;  3PDM P;  4E17 A;  1JR8 A;  2V3C C;  2R7S A;  2BL2 A;  3CEX A;  1G4W R;  1PCX A;  4KNW A;  3WHN A;  5KYY A;  5COF A;  4OD5 A;  3T9O A;  2EIL C;  3GWN A;  3ABK C;  2X51 A;  1OXK A;  1IZM A;  1SZI A;  3ECS A;  3NYJ A;  3FDQ A;  1LE4 A;  2J7P A;  1U89 A;  3MYI A;  1VLT A;  3FAJ A;  2IXP A;  2J9B A;  1LS4 A;  3EZI A;  4CJG A;  1IW7 F;  1EI7 A;  1J8Y F;  2ZPA A;  2OQM A;  1FR0 A;  2YKZ A;  3JT1 A;  1ZU4 A;  3B0V C;  2LD6 A;  5KYX A;  5JP7 A;  2JPU A;  1RCP A;  3DMD A;  1A41 A;  5A6A A;  1VK5 A;  3QVY A;  3U9M A;  2QTV A;  1JRA A;  4J7T A;  3TUL A;  1Z23 A;  4H4K C;  4U5B E;  2Y3H A;  4JZA A;  4ER9 A;  4DVY P;  3S0X A;  5DVW A;  2J0W A;  3AJM A;  4LLE A;  4O6N A;  3UNG C;  1LVK A;  3AGT A;  2D4U A;  1K40 A;  1AVO B;  4CBE A;  2H7B A;  3T6B A;  2WZG A;  1YAU O;  4OIQ F;  1KTM A;  1T6U A;  2UUH A;  3V5Y A;  3PHF 2;  1LS1 A;  3RF3 A;  4CIP A;  2CNW D;  3Q6N A;  1TKN A;  4DBR A;  3N24 A;  3E70 C;  3GM3 A;  3L0I A;  1FAP B;  3HNI A;  3EGX B;  4NTA A;  1LM3 B;  4AE4 B;  3ZWI A;  2YRF A;  2R7U A;  4BJ6 C;  1ZHX A;  4DRJ B;  3JRT A;  3HLZ A;  3IEE A;  3DE8 A;  3LLK A;  3T6G B;  3MLG A;  2NSF A;  2WVQ A;  4YL1 A;  3I5P A;  4EBJ A;  3LAY A;  1OW7 A;  2EPM X;  4JKV A;  4E7S A;  4CIH A;  3ZTM A;  2CNW A;  1V55 C;  4PFO A;  3MYF A;  1EKY A;  2WB7 A;  2WZL A;  3AG4 C;  2YVK A;  1G5Z A;  1RKE A;  2HMQ A;  2BC5 A;  3KKB A;  4KI2 A;  1AUE A;  1T6I A;  2J9V A;  3H2U A;  5F5H A;  1GGQ A;  4DXW A;  2I8B A;  4YN0 B;  2J8W A;  5HSW A;  2ASR A;  1LKX A;  4I1M A;  2O9X A;  1C02 A;  5A6K A;  1D0Y A;  2XSE A;  1HW2 A;  1M2V B;  2J46 A;  1G8X A;  5L3V A;  3SXZ A;  5A69 A;  2XS8 A;  5AGF A;  2Y3G A;  1E86 A;  3ABL C;  4BEM J;  4NTB A;  3H2V A;  4WGZ A;  4E0H A;  4AL0 A;  3K1I A;  2CDQ A;  3Q7L A;  4WJ0 A;  4XEV A;  3TD7 A;  4EBB A;  3CQZ A;  4HFK B;  1ZVZ A;  2M64 A;  4O6Y A;  2I15 A;  3TOL A;  4EIY A;  3RKO F;  2QUP A;  2Q3T A;  2FGY A;  3LEO A;  2LIG A;  5L0D A;  3FOP A;  1TWH A;  3B71 A;  1YA9 A;  2VCB A; 
#chains in the Genus database with same CATH homology
 3ZQY A;  1QQ3 A;  2XLD A;  3QVZ A;  1NBB A;  4CX9 A;  2YLI A;  4N4W A;  3ZQV A;  3VRC A;  5JS5 A;  2XM4 A;  4CJO A;  3M79 A;  3DE9 A;  5JLI A;  1YYX A;  4CDA A;  2XLV A;  3HNJ A;  1MQV A;  4WGY A;  4CDY A;  2XLM A;  2XLH A;  1YYJ A;  5B3I A;  2QLA A;  2YLD A;  256B A;  1CPQ A;  1YZA A;  3NMI A;  5JRA A;  2YL0 A;  4ULV A;  2XL8 A;  4L6R A;  1QPU A;  4CDV A;  5JVE A;  2J9B A;  2YL7 A;  5JSL A;  4CJG A;  3QW0 A;  3M4B A;  2YKZ A;  4JE9 A;  2XLW A;  2XM0 A;  2XLO A;  4NC3 A;  5JP7 A;  1RCP A;  3U8P A;  1E84 A;  3QVY A;  4U9E A;  3ZTZ A;  4ER9 A;  4D4N A;  4IAQ A;  3TOM A;  3L1M A;  1CGN A;  3C63 A;  4CIP A;  4D4X A;  1M6T A;  3HNI A;  1LM3 B;  3ZWI A;  5JUA A;  1E85 A;  2CCY A;  3DE8 A;  3M4C A;  4JEB A;  4IAR A;  4U9D A;  1A7V A;  4JKV A;  1GQA A;  3ZTM A;  1APC A;  3NMJ A;  3IQ6 A;  1E83 A;  1EKY A;  3FOO A;  1CGO A;  2BC5 A;  3IQ5 A;  4IB4 A;  4N6H A;  2J8W A;  3QW1 A;  5JT4 A;  1CPR A;  2XLE A;  3HNL A;  2XL6 A;  5AGF A;  1YZC A;  3M15 A;  2YLG A;  3HNK A;  1E86 A;  4WGZ A;  3C62 A;  4JEA A;  1S05 A;  2YL1 A;  3TOL A;  4EIY A;  1BBH A;  3FOP A;  2YL3 A;  3NMK A;  1JAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...