1BBPA

Molecular structure of the bilin binding protein (bbp) from pieris brassicae after refinement at 2.0 angstroms resolution.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
173
Chain Sequence
b'NVYHDGACPEVKPVDNFDWSNYHGKWWEVAKYPNSVEKYGKCGWAEYTPEGKSVKVSNYHVIHGKEYFIEGTAYPVGDSKIGKIYHKLTYGGVTKENVFNVLSTDNKNYIIGYYCKYDEDKKGHQDFVWVLSRSKVLTGEAKTAVENYLIGSPVVDSQKLVYSDFSEAACKVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BILIN BINDING PROTEIN
publication title Molecular structure of the bilin binding protein (BBP) from Pieris brassicae after refinement at 2.0 A resolution.
pubmed doi rcsb
source organism Pieris brassicae
molecule tags Bilin binding
total genus 38
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1990-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1bbpA00
1HMTA 4NLIA 4LKTA 1X8PA 3BU1A 4YCHA 3P6FA 1DC9A 4ALOA 1OEEA 4ZHGA 5L8OA 1B56A 1EPAA 4XMHA 3ZUOA 4UU2A 2FS7A 5EDBA 3STMX 4OS3A 4ZH9A 1X8QA 2Q4NA 2W2FA 1KOIA 3FEKA 4A8ZA 5HZ5A 1NP1A 5BVTA 3KZAA 3ELZA 4ZHDA 4AZNA 5F1EA 1ZRYA 3BS2A 4LZVA 4UU3A 5AQ6A 2JU3A 4YFPA 1DZJA 5FAZA 1BSQA 3MBTA 1T8VA 2W2BA 4GH7A 3B2IA 4MVIA 4HFOA 2FR3A 4ODDA 3U03A 3FA7A 4D6AA 3HWFA 4YKOA 4I3CA 4QAEA 1KT4A 1BEBA 3B2LA 3QKGA 1SY3A 3FR4A 1QFVA 1HN2A 4DQ3A 4QYPA 1G5WA 1SXWA 2FLJA 1PEEA 4A1HA 2HYSA 3FR2A 2A2UA 4DQ4A 1UREA 3P6DA 3BU9A 3B2HA 5FFHA 1JYDA 4M7MA 4OS8A 4GE1A 4A1YA 5JR8A 4ORWA 2AL0X 3ZUIA 4PSQA 1GX8A 3Q6LA 4I9SA 4GRJA 2K62A 2O62A 3WJEA 1OBUA 3CQNA 2YG2A 5LJHA 5DPQA 1JJXA 4YCEA 2MM3A 5K06A 3K3LA 3NPOA 1OEKA 4N7DA 1LIFA 5EDCA 5HBSA 1GT5A 2MO5A 4HPCA 3UEUA 4LZUA 4ORRA 3WJBA 2L68A 4GKCA 4Y0RA 2OVDA 4BVMA 1L6MA 3P6CA 1AQBA 1A3YA 4IBAA 1DZPA 2WEXA 3IFBA 4IB6A 3VG6A 3APVA 4ZHFA 5EPQA 2Q39A 4AZQA 3KFGA 2CBSA 1KGLA 3BSZE 1EIIA 4NNSA 3O2YA 5EEDA 4NYQA 1E5PA 5F58A 1YIVA 3C76X 2HZRA 1A18A 5HTEA 5HCDC 1X8UA 1QWDA 4QZTA 1DV9A 1LIEA 5D48A 1EXSA 3NP1A 1B4MA 1QY2A 1CBIA 2KTDA 4IAWA 5L8NA 4NP1A 2RCQA 4IB7A 1S44A 4YGGA 1YWDA 1YWAA 4K19A 3APUA 4ALBA 1YP6A 1SXXA 2WSJA 1LF7A 2W2AA 4QGVA 1O1UA 4HPAA 3PEDA 1FE3A 5DG4A 2L67A 2WUTA 4O9SA 3APXA 4ZFXA 1D2UA 2DM5A 1IW2A 1ICNA 3B2JA 3D95A 3B2KA 5KHPA 1U18A 5HA1A 4TKHA 3CBCA 2CM4A 2R74A 1ZNDA 2G79A 1E06A 5LJEA 1BRQA 2WQ9A 3WJGA 1CBQA 1X8NA 4TLJA 2A2GA 4CK4A 5KIDA 2X46A 1ZNHA 3VG5A 3O19A 1KXOA 4IMNA 1T68X 1X89A 3AKNA 1TW4A 1OPAA 3PPTA 5EEEA 5H9NA 2FR2A 4IB8A 4YKMA 1HQPA 1B0OA 1AB0A 2CM9A 4TKBA 4RUNA 3U9PC 1JJJA 1ACDA 2Q2PA 1BRPA 1EIOA 2LFOA 2AKQA 2GC9A 5LJDA 1ERBA 4ZR2A 1YWCA 1DFVA 5F6ZA 1LNMA 5D45A 1CBRA 4ORXA 3KQ0A 1H91A 2A0AA 1RBPA 3FW4A 2HZQA 4M6SA 3D96A 3NX1A 1GXAA 1S7DA 1SY2A 1X71A 4QGWA 4WFUA 1SA8A 4AW8A 4EXZA 2JU7A 4EDEA 5IO6A 4TJZA 3C77X 1BBPA 2P8GA 3VG2A 2OVAA 3FLLA 2LBAA 4RUUA 2GTFX 4BQUA 2R73A 1P6PA 2RA6A 1TOWA 2KT4B 3FMZA 1CRBA 2RQ0A 1DZKA 2FS6A 3O22A 4XMEA 1DF3A 1ICMA 1PMPA 4MVLA 1KQWA 1LKEA 1SXYA 1LPJA 4WFVA 5B29A 1VYFA 1LIDA 2HNXA 3AKMA 4YDBA 1HMSA 5EZ2A 2FWVA 5D4AA 4YFQA 5HZQA 1U17A 4OMXA 5H9KA 3NR3A 2X45A 1HBQA 1QQSA 2GJ5A 1IFBA 3TGAA 3F9DA 1ZNLA 3EBKA 3PECA 3SAOA 2A3FX 1S2PA 5BVQA 3UEVA 3TGCA 1BWYA 1EALA 2LBVA 1XKIA 4Y0SA 1GT4A 4ZH6A 2AH7X 4AZRA 5CE4A 3FENA 1GKAA 1MX8A 2ASNX 4TKJA 2OVEA 3NQ9A 3TF6A 2WQAE 4XMGA 1FENA 1OEJA 3WJFA 4ZHHA 3BY0A 4EEJA 2FTBA 2EU7X 5LJKA 4XMFA 2G7BA 2FRSA 2XKLA 3STKA 3P6GA 1HMRA 3UEWA 2N93A 2E4JA 3JS1A 1TXLA 1FTPA 4OMWA 4ZJ0A 3WBGA 2WWPA 4YGZA 4ZCBA 1MDCA 3EBWA 4I3BA 1GKAB 1ZNKA 2LB6A 5HCCC 3DTQA 5D47A 1X8OA 3VG3A 1KT6A 3EYCA 1JYJA 2IFBA 1KT3A 1LIBA 1EQDA 3TGBA 2FT9A 1KT5A 2L9CA 3BLGA 3OJYC 1I05A 1YUPA 1QFTA 3KFFA 1EUOA 3KFHA 5D8JA 4D6BA 1I06A 4XMDA 4NYRA 3I17A 3HWDA 4NNTA 3VG4A 3D97A 3FEPA 2HMBA 1E02A 1GX9A 3NX2A 1NP4A 4YBUA 3WJCA 1FEMA 2K23A 4IB9A 4AYHA 3FW5A 1FELA 2Q9SA 5IO5A 1R0UA 1AVGI 2QO5A 3FELA 3WXQA 1DZMA 4Y0PA 2L5PA 3FIQA 1KQXA 2QO4A 4GNWA 5HCEC 3GAQA 1KZWA 2CBRA 1QY1A 2ACPX 5LJBA 2ANSA 3NQ3A 3U0DA 1JBHA 4LKPA 3KFIA 5BVSA 3BDRA 2NP1A 1TOUA 2QM9A 1G7NA 5H9AA 3CQRA 5HTDA 3HWEA 3FA6A 1E00A 2WR6A 1ALBA 4QZUA 3WVMA 1EPBA 5HA0A 5L8IA 4YFRA 5H8TA 3P6HA 1OBQA 1CBSA 1Z24A 3I0AA 4QYNA 1GGLA 1IFCA 4XMCA 1MUPA 1SXUA 4YH0A 1A57A 1ADLA 1IKJA 3C78X 5C0NA 4QGXA 2A13A 1RLBE 1KZXA 4GNYA 4YGHA 1N0SA 3T1DA 5HZ6A 5FENA 3L4RA 4BOEA 1ERXA 2G78A 1G85A 2AT0X 3CMPA 2NNQA 4WBKA 3S26A 1YWBA 1XCAA 3FR5A 1O1VA 3JSQA 3CWKA 5LJGA 3G7XA 4ORYA 1GM6A 1U0XA 1QY0A 3BX8A 3HK1A 2PY1A 3ZQ3A 3EM0A 1IKEA 4TNNA 1QG5A 2F73A 1T0VA 4I3DA 1JV4A 3PH6A 1G74A 1ZNEA 1IIUA 3ELXA 1YP7A 1EW3A 3CR6A 4YDAA 5HWZA 4HPDA 1VPRA 2R56A 1MVGA 2QO6A 1VYGA 2OFRX 4ZHCA 5HAEA 5IO7A 3F8AA 1JZUA 4HPBA 1O8VA 1GT1A 1AELA 3UEXA 2QOSC 4Y0QA 4EFGA 1PM1X 2Q2MA 5F6BA 4TQ2A 2AMMX 2OZQA 2ACOA 2CZTA 1NGLA 1OBPA 5HZ8A 3BRNA 1SY0A 1CJ5A 3PP6A 1ML7A 4ARHA 2WEWA 3RSWA 1TVQA 4NLJA 1D3SA 3HWGA 1BSYA 2BLGA 5B27A 1OPBA 3VG7A 3APWA 1PBOA 1UZ2X 4AZPA 4OS0A 3TZSA 2NNEA 1GT3A 2XSTA 3STNA 5KICA 1BSOA 5LKEA 2AT5X 2RCTA 3DSZA 5LJCA 5HZ9A 4IAXA 3NADA 3IA8A 4AZOA 1BJ7A 2AT6X 4ES7A 3WJDA 4I9RA 5LKFA 1MX7A 3RZYA 4KIIA 2JOZA 2NNDA 2OFMX 2JN3A 2RD7C 2AT8X 3EMMA 2JU8A 4A60A 4ZGUA 4R0BA 4N7CA 3CBSA 4ORUA 2AT3X 1HBPA 2ALLX 1SY1A 3BX7A 3MVFA 4YMYA 2HLVA 1BLRA 1B8EA 4MVKA 4GETA 1KT7A 4AZMA 3FA9A 1FDQA 1LICA 2MJIA 3FA8A 1A2DA 2POAA 5H9LA 2LKKA 3PH5A 1I4UA 1I04A 1ZNGA 4IMOA 1LFOA 3P6EA 4ORSA 5F7GA 4YBPA 1QABE 1BM5A 2CZUA
chains in the Genus database with same CATH superfamily
1HMTA 4U8UM 4NLIA 4LKTA 1X8PA 3BU1A 1LUQA 4IRWA 4UU3A 4YCHA 3P6FA 1DC9A 1VWIB 2RTDB 1OEEA 2OY7A 1KFFA 4ALOA 4ZHGA 5CYBA 5L8OA 1B56A 1EPAA 1VWFB 3LTWA 4XMHA 3ZUOA 4UU2A 2FS7A 3E3CA 5EDBA 3STMX 4CDFA 2DJFA 4OS3A 4ZH9A 2OL7A 1X8QA 2RTJA 2Q4NA 2W2FA 1KOIA 3PQUA 3FEKA 4A8ZA 3N91A 5HZ5A 1JJUA 1NP1A 3MM0A 1NC9A 3KZAA 3ELZA 3QQ2A 5BVTA 4ZHDA 3ZW2A 4AZNA 2QCBA 5F1EA 2A8GA 4MISA 1ZRYA 1KL5A 3BS2A 2IZIA 1WUBA 2JU3A 3PQSA 4LZVA 1DZJA 1VYOA 2IZCB 4YFPA 5AQ6A 5FAZA 5B3MO 1BSQA 3MBTA 1T8VA 4BJ8A 2W2BA 4GH7A 1HY2A 3B2IA 4HFOA 2FR3A 4MVIA 4ODDA 3U03A 3FA7A 1SWTA 4D6AA 3HWFA 4YKOA 2X56A 4I3CA 4GUZA 4QAEA 1IJ8A 1VWGB 2M4LA 1KT4A 4GGRA 3FDCA 1BEBA 3B2LA 3QKGA 1SY3A 3AEHA 3FR4A 1QFVA 1HN2A 4DQ3A 4QYPA 1G5WA 1SXWA 2FLJA 1PEEA 4A1HA 2HYSA 1SRFA 3FR2A 2A2UA 3WZPA 4DQ4A 1UREA 2RTBB 3P6DA 1NQMA 3BU9A 3B2HA 3HOEA 5FFHA 1JYDA 4M7MA 4OS8A 1VWDB 4GE1A 4A1YA 4ORWA 5JR8A 2AL0X 2BS6A 3ZUIA 1SWBA 1LCZA 4PSQA 1GX8A 3Q6LA 4I9SA 4GRJA 2K62A 1STPA 2O62A 2OVSA 3WJEA 1OBUA 2RTCB 3CQNA 2IZHB 2RTRB 2YG2A 4L3RA 3SZHA 5DPQA 5LJHA 4YCEA 1JJXA 4GJSA 4NW4A 2MM3A 3KVNA 1STSB 5K06A 3K3LA 3S60A 4OELA 2GTLN 3NPOA 5IXGA 1OEKA 4N7DA 1LIFA 5EDCA 1HXLA 4ON1A 1GT5A 2MO5A 3H3IA 5HBSA 1RAVA 4HPCA 3UEUA 2AF5A 3WZQA 1RSUB 4LZUA 4ORRA 3WJBA 2L68A 4BX6A 1Y52X 1RSTB 4YGGA 2I5VO 1LDQA 2IZBA 4GKCA 3WYPA 4Y0RA 1VWOB 2OVDA 4BVMA 4O3ZA 1L6MA 3P6CA 4Z6JA 2RTEB 1AQBA 1A3YA 4IBAA 3VU1A 1DZPA 2WEXA 3IFBA 4IB6A 5K68A 3V8UA 3VG6A 1DF8A 3APVA 4ZHFA 5EPQA 2Q39A 1EI5A 3RDSA 2IZKA 4AZQA 4ZGFA 3KFGA 2CBSA 1KGLA 3BSZE 4U9CA 1EIIA 4NNSA 2X55A 3O2YA 1W5RA 4NYQA 5EEDA 1E5PA 5F58A 4BX6B 1YIVA 3C76X 2HZRA 4GGTA 1A18A 5HTEA 4I6SA 5HCDC 1I78A 1X8UA 4QRLA 1QWDA 4GDAA 2IZLB 2RTOB 4CDEA 1SWLA 4QZTA 3RY2A 1DV9A 4U46A 1LIEA 5D48A 1EXSA 3NP1A 1B4MA 1QY2A 1CBIA 2KTDA 4IAWA 4BX5A 5L8NA 4NP1A 2I5ZO 2RCQA 1S44A 4GDZA 1YWDA 4IABA 1WBIA 1YWAA 3APUA 4IB7A 4K19A 4ALBA 1SWCA 3P24A 1YP6A 1SXXA 2UYWA 2WSJA 1LF7A 1SWGA 2W2AA 4QGVA 1SRHA 1O1UA 4HPAA 3PEDA 1FE3A 5DG4A 2L67A 4CV7A 2WUTA 3VE2A 4O9SA 3APXA 4FGIB 4ZFXA 1D2UA 3OD9A 2DM5A 1IW2A 1ICNA 3B2JA 3D95A 3B2KA 3WYQA 5KHPA 1U18A 5HA1A 1SWRA 4TKHA 4BX5B 3CBCA 1VWJB 2CM4A 2C4IA 4KT5A 2R74A 1ZNDA 2G79A 2RTAA 1E06A 4C5PA 1BRQA 2WQ9A 2YMSA 3RDMA 1CBQA 3SLTA 3WJGA 5LJEA 1X8NA 1PTSA 4TLJA 1W4TA 1VWMB 1LCWA 2A2GA 4CK4A 5KIDA 4O3XB 2X46A 1ZNHA 3VG5A 3O19A 1KXOA 4IMNA 1T68X 4Z27A 3PDFA 2JMBA 1X89A 1Y9LA 3T2XA 2BT9A 3AKNA 1TW4A 1OPAA 3PPTA 2BC3A 5EEEA 2FR2A 5H9NA 4IB8A 2RTPB 4YKMA 4O3YA 3VHHA 1HQPA 1B0OA 1AB0A 2IZFB 4Z2OA 2CM9A 4TKBA 4RUNA 3U9PC 1JJJA 1ACDA 2Q2PA 1BRPA 2RTQB 1EIOA 3RE6A 2LFOA 3ZW0A 1MOYA 2AKQA 2RTGB 3S5VA 2FKGA 1GX3A 1VWPB 2GC9A 5LJDA 1ERBA 3RY1A 3SZIA 1Y53X 2RTLA 1YWCA 4ZR2A 1DFVA 5F6ZA 1LNMA 3LHNA 3PK2A 5D45A 1CBRA 4ORXA 3KQ0A 1H91A 3RDOA 2X8FA 2A0AA 1RBPA 3FW4A 2HZQA 4M6SA 3D96A 3NX1A 5FQ7E 1GXAA 1S7DA 3HTYA 1PBYA 2GTLM 1SY2A 1X71A 4JGLA 4QGWA 4WFUA 1SA8A 3MG5A 2OY5O 2JU7A 3OBLA 4AW8A 4EXZA 4EDEA 2IZDB 5IO6A 4TJZA 3C77X 1BBPA 2P8GA 3VG2A 3ZW0B 2OVAA 3NQKA 3FLLA 2LBAA 1JIWI 4RUUA 1SWDA 2GTFX 4BQUA 1MM9A 3ZI8A 2R73A 2PI3O 2X4MA 1P6PA 3P02A 1W6FA 2RA6A 1TOWA 3SLJA 2KT4B 3FMZA 1CRBA 5B5GA 2OF8A 4U3QA 2RQ0A 1DZKA 5AJCA 2FS6A 3O22A 4XMEA 5L3YA 1DF3A 1ICMA 1PMPA 4MVLA 1SWKA 2QMIA 1HXZA 1KQWA 1LKEA 1UYNX 3F6ZB 1LELA 1SXYA 4U8UN 1LPJA 2UZ2A 4WFVA 5B29A 1JMZA 1VYFA 5F2BA 1LIDA 2HNXA 3AKMA 4YDBA 3X00A 3FYFA 1HMSA 5EZ2A 1Y9TA 2DJGA 2FWVA 4NV8A 5D4AA 1SWHA 4YFQA 3LV4A 5HZQA 1U17A 2FGSA 2BSZA 4O4XA 2KD2A 4OMXA 1SWSA 5H9KA 3NR3A 3RDXA 2X45A 1NDJA 1HBQA 1QQSA 2A5BA 2GJ5A 1IFBA 1Y0GA 3TGAA 3F9DA 4COTA 1VWRB 3EW1A 1ZNLA 3EBKA 2ZAIA 3EC5A 3PECA 3SAOA 1S2PA 2A3FX 2C1QA 2OF9A 4MIRA 5BVQA 3UEVA 3TGCA 1BWYA 1VWKB 1EALA 2LBVA 1K24A 3RDQA 3RBYA 5AJBA 1XKIA 4Y0SA 1GT4A 4ZH6A 4KC8A 4KCAA 4OKAA 3VHMA 2AH7X 4AZRA 5CE4A 3FENA 3ZZVA 2RTNB 1GKAA 1MX8A 2ASNX 4EQAC 4TKJA 2OVEA 3NQ9A 3TF6A 2WQAE 4XMGA 1FENA 1OEJA 4BBOA 3UAQA 3VPJE 4KC7A 3WJFA 3BY0A 4ZHHA 4EEJA 1JMXA 2FTBA 2EU7X 5LJKA 4EKVA 4XMFA 2G7BA 2FRSA 1I9HA 4Z28A 2XKLA 3STKA 3P6GA 1SWNA 2OFBA 1HMRA 4JO6A 3UEWA 2N93A 2E4JA 3JS1A 1TXLA 1FTPA 5B10O 4OMWA 2OL8O 3HOLA 3WBGA 2VFCA 4ZJ0A 2IZGB 2WWPA 4YGZA 4ZCBA 1MDCA 3EBWA 2FHNX 4I3BA 1GKAB 1N7YA 1N43A 1SWEA 1VWQB 1ZNKA 4FBOA 4LQZA 3RWXA 2LB6A 5HCCC 2RN4A 3WZNA 3DTQA 5IRUA 3SZJA 4O4OA 4GGZA 5D47A 5FQ6E 3GE2A 1X8OA 3VG3A 1KT6A 2MWHA 3EYCA 4Y59A 4GJVA 3T2WA 2OY1O 1JYJA 2IFBA 1N4JA 2G5LA 4CPEA 2RTHB 3VHIA 1KT3A 1LIBA 1EQDA 4QNIA 3TGBA 2FT9A 1KT5A 2L9CA 5IRWA 3BLGA 4JNJA 3OJYC 1I05A 1YUPA 1QFTA 3AUMO 3KFFA 1EUOA 3KFHA 5D8JA 4D6BA 1LDOA 1I06A 2BHVA 4XMDA 1VWHB 4NYRA 3I17A 3HWDA 4NNTA 3RKGA 3VG4A 1SWJA 3D97A 3FEPA 4DCBA 2HMBA 1E02A 1E2TA 1GX9A 1NP4A 3NX2A 4YBUA 1FEMA 3WJCA 3ZW1A 1SWFA 2K23A 4IB9A 4AYHA 2OL6O 3FW5A 2FKJA 2IZEB 2MF6A 1FELA 2Q9SA 5IO5A 1K3BA 3T6FA 1FJ1E 5B2AO 1R0UA 1AVGI 2QO5A 4BX7A 3FELA 3WXQA 1DZMA 3SOTA 2GTLO 4Y0PA 2L5PA 1RXJA 3FIQA 2VFBA 1KQXA 2QO4A 4GNWA 2Y32A 5HCEC 2G8CO 3GAQA 1KZWA 1JQPA 2CBRA 1QY1A 2ACPX 1SWUA 2ANSA 3NQ3A 5LJBA 3U0DA 4LKPA 1JBHA 3KFIA 5BVSA 3BDRA 3ZW1B 2NP1A 1TOUA 2QM9A 1G7NA 3JQOA 5H9AA 4BCSA 4MVEA 3CQRA 5HTDA 1N9YA 4Y5DA 3HWEA 2OFAA 1E00A 3FA6A 3OE3A 2WR6A 2ZSCA 2Y3EA 1ALBA 4QZUA 3WVMA 4CPIA 4Z2VA 1EPBA 5HA0A 5L8IA 1MEPA 4YFRA 4BX7B 1HQQA 4CPFA 1SWPA 5H8TA 2Z4IA 3P6HA 1OBQA 1CBSA 1Z24A 3WZOA 3I0AA 5B5FA 4QYNA 2WPUA 1GGLA 1IFCA 4XMCA 1MUPA 1SXUA 4YH0A 2IZJA 3CKGA 1ADLA 1IKJA 2RTIB 3MX7A 1A57A 3C78X 5C0NA 4QGXA 2A13A 1RLBE 5K67A 1SRGA 1KZXA 4GNYA 4YGHA 4GU8A 2IZAA 5JD2A 1N0SA 1SLFB 3T1DA 5HZ6A 4ID2A 3EW2A 5FENA 1SWQA 3D9WA 3L4RA 4GZVA 4BOEA 1ERXA 2BS5A 2G78A 1G85A 2AT0X 3HPEA 2F01A 2NNQA 2OY8A 1SLGB 2QOMA 3CMPA 4WBKA 3S26A 1YWBA 1XCAA 3FR5A 1O1VA 5CSEA 2C1SA 3JSQA 3T6LA 3CWKA 5LJGA 3G7XA 4ORYA 1GM6A 4YVBA 3RE5A 1SRJA 1U0XA 1QY0A 3BX8A 3HK1A 2PY1A 3ZQ3A 1KL3A 1IKEA 1Y55X 2JW1A 3EM0A 5B11O 2RTFB 4CDCA 2A5CA 4TNNA 1QG5A 2F73A 1T0VA 3CKFA 4I3DA 1JV4A 3PH6A 1G74A 1ZNEA 1IIUA 1SWOA 1YP7A 1EW3A 3CR6A 1VWNB 3ELXA 4YDAA 5HWZA 4HPDA 4B55A 1VPRA 1VWCB 2FHLA 1VWBB 2R56A 1MVGA 5IRAA 4FBRA 2QO6A 1VYGA 2OFRX 2KTSA 4DNEA 4ZHCA 5HAEA 4CDDA 5IO7A 1KL4A 3F8AA 4HPBA 1JZUA 1O8VA 1GT1A 1AELA 4I95A 3UEXA 4PJ2A 4CPHA 2CAMA 2QOSC 4Y0QA 2JGSA 1STRB 4WHIA 4EFGA 2LA7A 1PM1X 5BYPA 2Q2MA 5F6BA 4GD9A 1UYOX 4TQ2A 1MK5A 2AMMX 2OZQA 2ACOA 2CZTA 1NGLA 3FIDA 1OBPA 4L1NA 2F09A 4CSBA 3BRNA 5FQ8E 5HZ8A 1SY0A 1VWEB 3PP6A 1ML7A 4HWMA 4JHQA 4ARHA 1CJ5A 2WEWA 3RDUA 3RSWA 1TVQA 1N9MA 4NLJA 1D3SA 3HWGA 5CHKA 3VE1A 1VWAB 1BSYA 4GK9A 2BLGA 4O49A 5B27A 1OPBA 1NQNA 3VG7A 2AVIA 3APWA 4CPHB 1PBOA 3ZWEA 4Z2PA 1UZ2X 1AVEA 4AZPA 4OS0A 3TZSA 2X32A 2ZAGA 2NNEA 1GT3A 2XSTA 3STNA 5KICA 1BSOA 2X8SA 5LKEA 1RXHA 2AT5X 3NBXX 2Y3FA 2RCTA 3DSZA 4MEEA 4ML7B 5LJCA 5AEOA 5HZ9A 2X8TA 4IAXA 1SMPI 3WOVA 3NADA 4O4SA 3IA8A 1SLDB 1BJ7A 1VWLB 2AT6X 4AZOA 4ES7A 3Q34A 4FBVA 3SLOA 2RTKA 4O4UA 4FQBB 4I9RA 3WJDA 5LKFA 1MX7A 3RZYA 3S5XA 1SLEB 4QQ1A 4KIIA 4OEMA 2JOZA 2NNDA 2JN3A 2OFMX 2RD7C 2AT8X 3EMMA 2JU8A 2HKDA 4I60A 4NV7A 2OYBO 4ZGUA 4R0BA 1OSPO 4N7CA 2GH7A 3CBSA 4ORUA 2AT3X 1HBPA 2ALLX 1SY1A 2KW1A 3BX7A 3MVFA 1SREA 2HLVA 4YMYA 1BLRA 4BGFA 2X34A 1B8EA 3D4RA 4INNA 4GETA 4MVKA 2VDFA 1KT7A 4AZMA 3FA9A 1FDQA 1AVDA 1LICA 2MJIA 3VGWA 3FA8A 2MHDA 1A2DA 2POAA 4U8UO 2Z4HA 5H9LA 2LKKA 4KH8A 3PH5A 1I4UA 1I04A 4A60A 1SRIA 2RTMA 1ZNGA 4IMOA 1LFOA 1LCVA 1RXKA 3P6EA 4ORSA 5F7GA 4YBPA 1NBXA 1SWAA 1QABE 1BM5A 2CZUA 4O3WA
chains in the Genus database with same CATH topology
1HMTA 4U8UM 4NLIA 4LKTA 1X8PA 3BU1A 4CSBA 4YCHA 3P6FA 1DC9A 4ALOA 1OEEA 4ZHGA 5L8OA 5CYBA 1B56A 1EPAA 4XMHA 3ZUOA 4UU2A 2FS7A 3E3CA 5EDBA 3STMX 4OS3A 4ZH9A 1X8QA 2Q4NA 2W2FA 1KOIA 3PQUA 3FEKA 4A8ZA 3N91A 5HZ5A 1NP1A 5BVTA 3KZAA 3ELZA 4ZHDA 3ZW2A 4AZNA 5F1EA 4MISA 1ZRYA 3BS2A 4LZVA 3PQSA 4UU3A 2JU3A 4YFPA 5AQ6A 1DZJA 5FAZA 1BSQA 3MBTA 1T8VA 2W2BA 4GH7A 3B2IA 4MVIA 4HFOA 2FR3A 4ODDA 3U03A 3FA7A 4D6AA 3HWFA 4YKOA 4I3CA 4QAEA 2M4LA 1KT4A 1BEBA 3B2LA 3QKGA 1SY3A 3FR4A 1QFVA 1HN2A 4DQ3A 4QYPA 1G5WA 1SXWA 2FLJA 1PEEA 4A1HA 2HYSA 3FR2A 2A2UA 4DQ4A 1UREA 3P6DA 3BU9A 3B2HA 3HOEA 5FFHA 1JYDA 4M7MA 4OS8A 4GE1A 4A1YA 5JR8A 4ORWA 2AL0X 2BS6A 3ZUIA 4PSQA 1GX8A 3Q6LA 4I9SA 4GRJA 2K62A 2O62A 2OVSA 3WJEA 1OBUA 3CQNA 2YG2A 4L3RA 5LJHA 5DPQA 1JJXA 4YCEA 4NW4A 2MM3A 5K06A 3K3LA 3S60A 2GTLN 3NPOA 1OEKA 4N7DA 1LIFA 5EDCA 4ON1A 5HBSA 1GT5A 2MO5A 3H3IA 4HPCA 3UEUA 4LZUA 4ORRA 3WJBA 2L68A 4GKCA 4Y0RA 2OVDA 4BVMA 4O3ZA 1L6MA 3P6CA 1AQBA 1A3YA 4IBAA 3VU1A 1DZPA 2WEXA 3IFBA 4IB6A 3V8UA 3VG6A 3APVA 4ZHFA 5EPQA 2Q39A 1EI5A 4AZQA 4ZGFA 3KFGA 2CBSA 1KGLA 3BSZE 4U9CA 1EIIA 4NNSA 3O2YA 5EEDA 4NYQA 1E5PA 5F58A 1YIVA 3C76X 2HZRA 1A18A 5HTEA 4I6SA 5HCDC 1X8UA 4QRLA 1QWDA 4QZTA 1DV9A 1LIEA 5D48A 1EXSA 3NP1A 1B4MA 1QY2A 1CBIA 2KTDA 4IAWA 5L8NA 4NP1A 2RCQA 4IABA 1S44A 4GDZA 1YWDA 4IB7A 1YWAA 4K19A 3APUA 4YGGA 4ALBA 3P24A 1YP6A 1SXXA 2WSJA 1LF7A 2W2AA 4QGVA 1O1UA 4HPAA 3PEDA 1FE3A 5DG4A 2L67A 4CV7A 2WUTA 3VE2A 4O9SA 3APXA 4FGIB 4ZFXA 1D2UA 3OD9A 2DM5A 1IW2A 1ICNA 3B2JA 3D95A 3B2KA 5KHPA 1U18A 5HA1A 4TKHA 3CBCA 2CM4A 4KT5A 2R74A 1ZNDA 2G79A 1E06A 5LJEA 1BRQA 2WQ9A 2YMSA 3WJGA 1CBQA 1X8NA 4TLJA 2A2GA 4CK4A 5KIDA 4O3XB 2X46A 1ZNHA 3VG5A 3O19A 1KXOA 4IMNA 1T68X 2JMBA 1X89A 1Y9LA 2BT9A 3AKNA 1TW4A 1OPAA 3PPTA 5EEEA 5H9NA 2FR2A 4IB8A 4YKMA 4O3YA 1HQPA 1B0OA 1AB0A 2CM9A 4TKBA 4RUNA 3U9PC 1JJJA 1ACDA 2Q2PA 1BRPA 1EIOA 2LFOA 3ZW0A 2AKQA 3S5VA 2GC9A 5LJDA 1ERBA 4ZR2A 1YWCA 1DFVA 5F6ZA 1LNMA 3LHNA 5D45A 1CBRA 4ORXA 3KQ0A 1H91A 2X8FA 2A0AA 1RBPA 3FW4A 2HZQA 4M6SA 3D96A 3NX1A 5FQ7E 1GXAA 1S7DA 3HTYA 2GTLM 1SY2A 1X71A 4JGLA 4QGWA 4WFUA 1SA8A 4AW8A 4EXZA 2JU7A 3OBLA 4EDEA 5IO6A 4TJZA 3C77X 1BBPA 2P8GA 3VG2A 3ZW0B 2OVAA 3NQKA 3FLLA 2LBAA 1JIWI 4RUUA 2GTFX 4BQUA 3ZI8A 2R73A 1P6PA 3P02A 2RA6A 1TOWA 2KT4B 3FMZA 1CRBA 4U3QA 2RQ0A 1DZKA 5AJCA 2FS6A 3O22A 4XMEA 1DF3A 1ICMA 1PMPA 4MVLA 3F6ZB 2QMIA 1KQWA 1LKEA 1SXYA 4U8UN 1LPJA 4WFVA 5B29A 1VYFA 1LIDA 2HNXA 3AKMA 4YDBA 3FYFA 1HMSA 5EZ2A 1Y9TA 2FWVA 5D4AA 4YFQA 3LV4A 5HZQA 1U17A 4O4XA 2KD2A 4OMXA 5H9KA 3NR3A 2X45A 1HBQA 1QQSA 2GJ5A 1IFBA 3TGAA 3F9DA 4COTA 1ZNLA 3EBKA 2ZAIA 3PECA 3SAOA 2A3FX 1S2PA 5BVQA 4MIRA 3UEVA 3TGCA 1BWYA 1EALA 2LBVA 3RBYA 5AJBA 1XKIA 4Y0SA 1GT4A 4ZH6A 4KC8A 4KCAA 2AH7X 4AZRA 5CE4A 3FENA 3ZZVA 1GKAA 1MX8A 2ASNX 4EQAC 4TKJA 2OVEA 3NQ9A 3TF6A 2WQAE 4XMGA 1FENA 1OEJA 3UAQA 3VPJE 4KC7A 3WJFA 3BY0A 4ZHHA 4EEJA 2FTBA 2EU7X 5LJKA 4XMFA 2G7BA 2FRSA 2XKLA 3STKA 3P6GA 1HMRA 3UEWA 2N93A 2E4JA 3JS1A 1TXLA 1FTPA 4OMWA 3HOLA 3WBGA 4ZJ0A 2WWPA 4YGZA 4ZCBA 1MDCA 3EBWA 4I3BA 1GKAB 1ZNKA 4FBOA 4LQZA 3RWXA 2LB6A 5HCCC 2RN4A 3DTQA 4O4OA 5D47A 5FQ6E 3GE2A 1X8OA 3VG3A 1KT6A 2MWHA 3EYCA 1JYJA 2IFBA 1KT3A 1LIBA 1EQDA 4QNIA 3TGBA 2FT9A 1KT5A 2L9CA 3BLGA 3OJYC 1I05A 1YUPA 1QFTA 3KFFA 1EUOA 3KFHA 5D8JA 4D6BA 1I06A 2BHVA 4XMDA 4NYRA 3I17A 3HWDA 4NNTA 3RKGA 3VG4A 3D97A 3FEPA 2HMBA 1E02A 1GX9A 3NX2A 1NP4A 4YBUA 3WJCA 1FEMA 3ZW1A 2K23A 4IB9A 4AYHA 3FW5A 1FELA 2Q9SA 5IO5A 1R0UA 1AVGI 2QO5A 3FELA 3WXQA 1DZMA 3SOTA 2GTLO 4Y0PA 2L5PA 3FIQA 1KQXA 2QO4A 4GNWA 5HCEC 3GAQA 1KZWA 2CBRA 1QY1A 2ACPX 5LJBA 2ANSA 3NQ3A 3U0DA 1JBHA 4LKPA 3KFIA 5BVSA 3BDRA 3ZW1B 2NP1A 1TOUA 2QM9A 1G7NA 3JQOA 5H9AA 4MVEA 3CQRA 5HTDA 3HWEA 3FA6A 1E00A 3OE3A 2WR6A 1ALBA 4QZUA 3WVMA 1EPBA 5HA0A 5L8IA 4YFRA 5H8TA 2Z4IA 3P6HA 1OBQA 1CBSA 1Z24A 3I0AA 4QYNA 1GGLA 1IFCA 4XMCA 1MUPA 1SXUA 4YH0A 1A57A 1ADLA 1IKJA 3MX7A 3C78X 5C0NA 4QGXA 2A13A 1RLBE 1KZXA 4GNYA 4YGHA 4GU8A 1N0SA 3T1DA 5HZ6A 4ID2A 5FENA 3L4RA 4GZVA 4BOEA 1ERXA 2BS5A 2G78A 1G85A 2AT0X 3CMPA 2NNQA 4WBKA 3S26A 1YWBA 1XCAA 3FR5A 1O1VA 3JSQA 3CWKA 5LJGA 3G7XA 4ORYA 1GM6A 1U0XA 1QY0A 3BX8A 3HK1A 2PY1A 3ZQ3A 3EM0A 1IKEA 2JW1A 4TNNA 1QG5A 2F73A 1T0VA 4I3DA 1JV4A 3PH6A 1G74A 1ZNEA 1IIUA 3ELXA 1YP7A 1EW3A 3CR6A 4YDAA 5HWZA 4HPDA 1VPRA 2R56A 1MVGA 4FBRA 2QO6A 1VYGA 2OFRX 2KTSA 4ZHCA 5HAEA 5IO7A 3F8AA 1JZUA 4HPBA 1O8VA 1GT1A 1AELA 4I95A 3UEXA 4PJ2A 2QOSC 4Y0QA 4WHIA 4EFGA 2LA7A 1PM1X 5BYPA 2Q2MA 5F6BA 4TQ2A 2AMMX 2OZQA 2ACOA 2CZTA 1NGLA 1OBPA 4L1NA 2F09A 5HZ8A 3BRNA 5FQ8E 1SY0A 1CJ5A 3PP6A 1ML7A 4HWMA 4ARHA 2WEWA 3RSWA 1TVQA 4NLJA 1D3SA 3HWGA 3VE1A 4GK9A 1BSYA 2BLGA 4O49A 5B27A 1OPBA 3VG7A 3APWA 1PBOA 3ZWEA 1UZ2X 4AZPA 4OS0A 3TZSA 2ZAGA 2NNEA 1GT3A 2XSTA 3STNA 5KICA 1BSOA 2X8SA 5LKEA 2AT5X 3NBXX 2RCTA 3DSZA 5LJCA 4ML7B 5AEOA 5HZ9A 2X8TA 4IAXA 1SMPI 3WOVA 3NADA 4O4SA 3IA8A 4AZOA 1BJ7A 2AT6X 4ES7A 4FBVA 4O4UA 4FQBB 4I9RA 3WJDA 5LKFA 1MX7A 3RZYA 3S5XA 4QQ1A 4KIIA 2JOZA 2NNDA 2OFMX 2JN3A 2RD7C 2AT8X 3EMMA 2JU8A 4A60A 4ZGUA 4R0BA 4N7CA 3CBSA 4ORUA 2AT3X 1HBPA 2ALLX 1SY1A 2KW1A 3BX7A 3MVFA 2HLVA 4YMYA 1BLRA 3D4RA 1B8EA 4INNA 4MVKA 4GETA 1KT7A 4AZMA 3FA9A 1FDQA 1LICA 2MJIA 3FA8A 2MHDA 1A2DA 2POAA 4U8UO 2Z4HA 5H9LA 2LKKA 4KH8A 3PH5A 1I4UA 1I04A 1ZNGA 4IMOA 1LFOA 3P6EA 4ORSA 5F7GA 4YBPA 1QABE 1BM5A 2CZUA 4O3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMT A;  4NLI A;  4LKT A;  1X8P A;  3BU1 A;  4YCH A;  3P6F A;  1DC9 A;  4ALO A;  1OEE A;  4ZHG A;  5L8O A;  1B56 A;  1EPA A;  4XMH A;  3ZUO A;  4UU2 A;  2FS7 A;  5EDB A;  3STM X;  4OS3 A;  4ZH9 A;  1X8Q A;  2Q4N A;  2W2F A;  1KOI A;  3FEK A;  4A8Z A;  5HZ5 A;  1NP1 A;  5BVT A;  3KZA A;  3ELZ A;  4ZHD A;  4AZN A;  5F1E A;  1ZRY A;  3BS2 A;  4LZV A;  4UU3 A;  5AQ6 A;  2JU3 A;  4YFP A;  1DZJ A;  5FAZ A;  1BSQ A;  3MBT A;  1T8V A;  2W2B A;  4GH7 A;  3B2I A;  4MVI A;  4HFO A;  2FR3 A;  4ODD A;  3U03 A;  3FA7 A;  4D6A A;  3HWF A;  4YKO A;  4I3C A;  4QAE A;  1KT4 A;  1BEB A;  3B2L A;  3QKG A;  1SY3 A;  3FR4 A;  1QFV A;  1HN2 A;  4DQ3 A;  4QYP A;  1G5W A;  1SXW A;  2FLJ A;  1PEE A;  4A1H A;  2HYS A;  3FR2 A;  2A2U A;  4DQ4 A;  1URE A;  3P6D A;  3BU9 A;  3B2H A;  5FFH A;  1JYD A;  4M7M A;  4OS8 A;  4GE1 A;  4A1Y A;  5JR8 A;  4ORW A;  2AL0 X;  3ZUI A;  4PSQ A;  1GX8 A;  3Q6L A;  4I9S A;  4GRJ A;  2K62 A;  2O62 A;  3WJE A;  1OBU A;  3CQN A;  2YG2 A;  5LJH A;  5DPQ A;  1JJX A;  4YCE A;  2MM3 A;  5K06 A;  3K3L A;  3NPO A;  1OEK A;  4N7D A;  1LIF A;  5EDC A;  5HBS A;  1GT5 A;  2MO5 A;  4HPC A;  3UEU A;  4LZU A;  4ORR A;  3WJB A;  2L68 A;  4GKC A;  4Y0R A;  2OVD A;  4BVM A;  1L6M A;  3P6C A;  1AQB A;  1A3Y A;  4IBA A;  1DZP A;  2WEX A;  3IFB A;  4IB6 A;  3VG6 A;  3APV A;  4ZHF A;  5EPQ A;  2Q39 A;  4AZQ A;  3KFG A;  2CBS A;  1KGL A;  3BSZ E;  1EII A;  4NNS A;  3O2Y A;  5EED A;  4NYQ A;  1E5P A;  5F58 A;  1YIV A;  3C76 X;  2HZR A;  1A18 A;  5HTE A;  5HCD C;  1X8U A;  1QWD A;  4QZT A;  1DV9 A;  1LIE A;  5D48 A;  1EXS A;  3NP1 A;  1B4M A;  1QY2 A;  1CBI A;  2KTD A;  4IAW A;  5L8N A;  4NP1 A;  2RCQ A;  4IB7 A;  1S44 A;  4YGG A;  1YWD A;  1YWA A;  4K19 A;  3APU A;  4ALB A;  1YP6 A;  1SXX A;  2WSJ A;  1LF7 A;  2W2A A;  4QGV A;  1O1U A;  4HPA A;  3PED A;  1FE3 A;  5DG4 A;  2L67 A;  2WUT A;  4O9S A;  3APX A;  4ZFX A;  1D2U A;  2DM5 A;  1IW2 A;  1ICN A;  3B2J A;  3D95 A;  3B2K A;  5KHP A;  1U18 A;  5HA1 A;  4TKH A;  3CBC A;  2CM4 A;  2R74 A;  1ZND A;  2G79 A;  1E06 A;  5LJE A;  1BRQ A;  2WQ9 A;  3WJG A;  1CBQ A;  1X8N A;  4TLJ A;  2A2G A;  4CK4 A;  5KID A;  2X46 A;  1ZNH A;  3VG5 A;  3O19 A;  1KXO A;  4IMN A;  1T68 X;  1X89 A;  3AKN A;  1TW4 A;  1OPA A;  3PPT A;  5EEE A;  5H9N A;  2FR2 A;  4IB8 A;  4YKM A;  1HQP A;  1B0O A;  1AB0 A;  2CM9 A;  4TKB A;  4RUN A;  3U9P C;  1JJJ A;  1ACD A;  2Q2P A;  1BRP A;  1EIO A;  2LFO A;  2AKQ A;  2GC9 A;  5LJD A;  1ERB A;  4ZR2 A;  1YWC A;  1DFV A;  5F6Z A;  1LNM A;  5D45 A;  1CBR A;  4ORX A;  3KQ0 A;  1H91 A;  2A0A A;  1RBP A;  3FW4 A;  2HZQ A;  4M6S A;  3D96 A;  3NX1 A;  1GXA A;  1S7D A;  1SY2 A;  1X71 A;  4QGW A;  4WFU A;  1SA8 A;  4AW8 A;  4EXZ A;  2JU7 A;  4EDE A;  5IO6 A;  4TJZ A;  3C77 X;  1BBP A;  2P8G A;  3VG2 A;  2OVA A;  3FLL A;  2LBA A;  4RUU A;  2GTF X;  4BQU A;  2R73 A;  1P6P A;  2RA6 A;  1TOW A;  2KT4 B;  3FMZ A;  1CRB A;  2RQ0 A;  1DZK A;  2FS6 A;  3O22 A;  4XME A;  1DF3 A;  1ICM A;  1PMP A;  4MVL A;  1KQW A;  1LKE A;  1SXY A;  1LPJ A;  4WFV A;  5B29 A;  1VYF A;  1LID A;  2HNX A;  3AKM A;  4YDB A;  1HMS A;  5EZ2 A;  2FWV A;  5D4A A;  4YFQ A;  5HZQ A;  1U17 A;  4OMX A;  5H9K A;  3NR3 A;  2X45 A;  1HBQ A;  1QQS A;  2GJ5 A;  1IFB A;  3TGA A;  3F9D A;  1ZNL A;  3EBK A;  3PEC A;  3SAO A;  2A3F X;  1S2P A;  5BVQ A;  3UEV A;  3TGC A;  1BWY A;  1EAL A;  2LBV A;  1XKI A;  4Y0S A;  1GT4 A;  4ZH6 A;  2AH7 X;  4AZR A;  5CE4 A;  3FEN A;  1GKA A;  1MX8 A;  2ASN X;  4TKJ A;  2OVE A;  3NQ9 A;  3TF6 A;  2WQA E;  4XMG A;  1FEN A;  1OEJ A;  3WJF A;  4ZHH A;  3BY0 A;  4EEJ A;  2FTB A;  2EU7 X;  5LJK A;  4XMF A;  2G7B A;  2FRS A;  2XKL A;  3STK A;  3P6G A;  1HMR A;  3UEW A;  2N93 A;  2E4J A;  3JS1 A;  1TXL A;  1FTP A;  4OMW A;  4ZJ0 A;  3WBG A;  2WWP A;  4YGZ A;  4ZCB A;  1MDC A;  3EBW A;  4I3B A;  1GKA B;  1ZNK A;  2LB6 A;  5HCC C;  3DTQ A;  5D47 A;  1X8O A;  3VG3 A;  1KT6 A;  3EYC A;  1JYJ A;  2IFB A;  1KT3 A;  1LIB A;  1EQD A;  3TGB A;  2FT9 A;  1KT5 A;  2L9C A;  3BLG A;  3OJY C;  1I05 A;  1YUP A;  1QFT A;  3KFF A;  1EUO A;  3KFH A;  5D8J A;  4D6B A;  1I06 A;  4XMD A;  4NYR A;  3I17 A;  3HWD A;  4NNT A;  3VG4 A;  3D97 A;  3FEP A;  2HMB A;  1E02 A;  1GX9 A;  3NX2 A;  1NP4 A;  4YBU A;  3WJC A;  1FEM A;  2K23 A;  4IB9 A;  4AYH A;  3FW5 A;  1FEL A;  2Q9S A;  5IO5 A;  1R0U A;  1AVG I;  2QO5 A;  3FEL A;  3WXQ A;  1DZM A;  4Y0P A;  2L5P A;  3FIQ A;  1KQX A;  2QO4 A;  4GNW A;  5HCE C;  3GAQ A;  1KZW A;  2CBR A;  1QY1 A;  2ACP X;  5LJB A;  2ANS A;  3NQ3 A;  3U0D A;  1JBH A;  4LKP A;  3KFI A;  5BVS A;  3BDR A;  2NP1 A;  1TOU A;  2QM9 A;  1G7N A;  5H9A A;  3CQR A;  5HTD A;  3HWE A;  3FA6 A;  1E00 A;  2WR6 A;  1ALB A;  4QZU A;  3WVM A;  1EPB A;  5HA0 A;  5L8I A;  4YFR A;  5H8T A;  3P6H A;  1OBQ A;  1CBS A;  1Z24 A;  3I0A A;  4QYN A;  1GGL A;  1IFC A;  4XMC A;  1MUP A;  1SXU A;  4YH0 A;  1A57 A;  1ADL A;  1IKJ A;  3C78 X;  5C0N A;  4QGX A;  2A13 A;  1RLB E;  1KZX A;  4GNY A;  4YGH A;  1N0S A;  3T1D A;  5HZ6 A;  5FEN A;  3L4R A;  4BOE A;  1ERX A;  2G78 A;  1G85 A;  2AT0 X;  3CMP A;  2NNQ A;  4WBK A;  3S26 A;  1YWB A;  1XCA A;  3FR5 A;  1O1V A;  3JSQ A;  3CWK A;  5LJG A;  3G7X A;  4ORY A;  1GM6 A;  1U0X A;  1QY0 A;  3BX8 A;  3HK1 A;  2PY1 A;  3ZQ3 A;  3EM0 A;  1IKE A;  4TNN A;  1QG5 A;  2F73 A;  1T0V A;  4I3D A;  1JV4 A;  3PH6 A;  1G74 A;  1ZNE A;  1IIU A;  3ELX A;  1YP7 A;  1EW3 A;  3CR6 A;  4YDA A;  5HWZ A;  4HPD A;  1VPR A;  2R56 A;  1MVG A;  2QO6 A;  1VYG A;  2OFR X;  4ZHC A;  5HAE A;  5IO7 A;  3F8A A;  1JZU A;  4HPB A;  1O8V A;  1GT1 A;  1AEL A;  3UEX A;  2QOS C;  4Y0Q A;  4EFG A;  1PM1 X;  2Q2M A;  5F6B A;  4TQ2 A;  2AMM X;  2OZQ A;  2ACO A;  2CZT A;  1NGL A;  1OBP A;  5HZ8 A;  3BRN A;  1SY0 A;  1CJ5 A;  3PP6 A;  1ML7 A;  4ARH A;  2WEW A;  3RSW A;  1TVQ A;  4NLJ A;  1D3S A;  3HWG A;  1BSY A;  2BLG A;  5B27 A;  1OPB A;  3VG7 A;  3APW A;  1PBO A;  1UZ2 X;  4AZP A;  4OS0 A;  3TZS A;  2NNE A;  1GT3 A;  2XST A;  3STN A;  5KIC A;  1BSO A;  5LKE A;  2AT5 X;  2RCT A;  3DSZ A;  5LJC A;  5HZ9 A;  4IAX A;  3NAD A;  3IA8 A;  4AZO A;  1BJ7 A;  2AT6 X;  4ES7 A;  3WJD A;  4I9R A;  5LKF A;  1MX7 A;  3RZY A;  4KII A;  2JOZ A;  2NND A;  2OFM X;  2JN3 A;  2RD7 C;  2AT8 X;  3EMM A;  2JU8 A;  4A60 A;  4ZGU A;  4R0B A;  4N7C A;  3CBS A;  4ORU A;  2AT3 X;  1HBP A;  2ALL X;  1SY1 A;  3BX7 A;  3MVF A;  4YMY A;  2HLV A;  1BLR A;  1B8E A;  4MVK A;  4GET A;  1KT7 A;  4AZM A;  3FA9 A;  1FDQ A;  1LIC A;  2MJI A;  3FA8 A;  1A2D A;  2POA A;  5H9L A;  2LKK A;  3PH5 A;  1I4U A;  1I04 A;  1ZNG A;  4IMO A;  1LFO A;  3P6E A;  4ORS A;  5F7G A;  4YBP A;  1QAB E;  1BM5 A;  2CZU A; 
#chains in the Genus database with same CATH topology
 1HMT A;  4U8U M;  4NLI A;  4LKT A;  1X8P A;  3BU1 A;  1LUQ A;  4IRW A;  4UU3 A;  4YCH A;  3P6F A;  1DC9 A;  1VWI B;  2RTD B;  1OEE A;  2OY7 A;  1KFF A;  4ALO A;  4ZHG A;  5CYB A;  5L8O A;  1B56 A;  1EPA A;  1VWF B;  3LTW A;  4XMH A;  3ZUO A;  4UU2 A;  2FS7 A;  3E3C A;  5EDB A;  3STM X;  4CDF A;  2DJF A;  4OS3 A;  4ZH9 A;  2OL7 A;  1X8Q A;  2RTJ A;  2Q4N A;  2W2F A;  1KOI A;  3PQU A;  3FEK A;  4A8Z A;  3N91 A;  5HZ5 A;  1JJU A;  1NP1 A;  3MM0 A;  1NC9 A;  3KZA A;  3ELZ A;  3QQ2 A;  5BVT A;  4ZHD A;  3ZW2 A;  4AZN A;  2QCB A;  5F1E A;  2A8G A;  4MIS A;  1ZRY A;  1KL5 A;  3BS2 A;  2IZI A;  1WUB A;  2JU3 A;  3PQS A;  4LZV A;  1DZJ A;  1VYO A;  2IZC B;  4YFP A;  5AQ6 A;  5FAZ A;  5B3M O;  1BSQ A;  3MBT A;  1T8V A;  4BJ8 A;  2W2B A;  4GH7 A;  1HY2 A;  3B2I A;  4HFO A;  2FR3 A;  4MVI A;  4ODD A;  3U03 A;  3FA7 A;  1SWT A;  4D6A A;  3HWF A;  4YKO A;  2X56 A;  4I3C A;  4GUZ A;  4QAE A;  1IJ8 A;  1VWG B;  2M4L A;  1KT4 A;  4GGR A;  3FDC A;  1BEB A;  3B2L A;  3QKG A;  1SY3 A;  3AEH A;  3FR4 A;  1QFV A;  1HN2 A;  4DQ3 A;  4QYP A;  1G5W A;  1SXW A;  2FLJ A;  1PEE A;  4A1H A;  2HYS A;  1SRF A;  3FR2 A;  2A2U A;  3WZP A;  4DQ4 A;  1URE A;  2RTB B;  3P6D A;  1NQM A;  3BU9 A;  3B2H A;  3HOE A;  5FFH A;  1JYD A;  4M7M A;  4OS8 A;  1VWD B;  4GE1 A;  4A1Y A;  4ORW A;  5JR8 A;  2AL0 X;  2BS6 A;  3ZUI A;  1SWB A;  1LCZ A;  4PSQ A;  1GX8 A;  3Q6L A;  4I9S A;  4GRJ A;  2K62 A;  1STP A;  2O62 A;  2OVS A;  3WJE A;  1OBU A;  2RTC B;  3CQN A;  2IZH B;  2RTR B;  2YG2 A;  4L3R A;  3SZH A;  5DPQ A;  5LJH A;  4YCE A;  1JJX A;  4GJS A;  4NW4 A;  2MM3 A;  3KVN A;  1STS B;  5K06 A;  3K3L A;  3S60 A;  4OEL A;  2GTL N;  3NPO A;  5IXG A;  1OEK A;  4N7D A;  1LIF A;  5EDC A;  1HXL A;  4ON1 A;  1GT5 A;  2MO5 A;  3H3I A;  5HBS A;  1RAV A;  4HPC A;  3UEU A;  2AF5 A;  3WZQ A;  1RSU B;  4LZU A;  4ORR A;  3WJB A;  2L68 A;  4BX6 A;  1Y52 X;  1RST B;  4YGG A;  2I5V O;  1LDQ A;  2IZB A;  4GKC A;  3WYP A;  4Y0R A;  1VWO B;  2OVD A;  4BVM A;  4O3Z A;  1L6M A;  3P6C A;  4Z6J A;  2RTE B;  1AQB A;  1A3Y A;  4IBA A;  3VU1 A;  1DZP A;  2WEX A;  3IFB A;  4IB6 A;  5K68 A;  3V8U A;  3VG6 A;  1DF8 A;  3APV A;  4ZHF A;  5EPQ A;  2Q39 A;  1EI5 A;  3RDS A;  2IZK A;  4AZQ A;  4ZGF A;  3KFG A;  2CBS A;  1KGL A;  3BSZ E;  4U9C A;  1EII A;  4NNS A;  2X55 A;  3O2Y A;  1W5R A;  4NYQ A;  5EED A;  1E5P A;  5F58 A;  4BX6 B;  1YIV A;  3C76 X;  2HZR A;  4GGT A;  1A18 A;  5HTE A;  4I6S A;  5HCD C;  1I78 A;  1X8U A;  4QRL A;  1QWD A;  4GDA A;  2IZL B;  2RTO B;  4CDE A;  1SWL A;  4QZT A;  3RY2 A;  1DV9 A;  4U46 A;  1LIE A;  5D48 A;  1EXS A;  3NP1 A;  1B4M A;  1QY2 A;  1CBI A;  2KTD A;  4IAW A;  4BX5 A;  5L8N A;  4NP1 A;  2I5Z O;  2RCQ A;  1S44 A;  4GDZ A;  1YWD A;  4IAB A;  1WBI A;  1YWA A;  3APU A;  4IB7 A;  4K19 A;  4ALB A;  1SWC A;  3P24 A;  1YP6 A;  1SXX A;  2UYW A;  2WSJ A;  1LF7 A;  1SWG A;  2W2A A;  4QGV A;  1SRH A;  1O1U A;  4HPA A;  3PED A;  1FE3 A;  5DG4 A;  2L67 A;  4CV7 A;  2WUT A;  3VE2 A;  4O9S A;  3APX A;  4FGI B;  4ZFX A;  1D2U A;  3OD9 A;  2DM5 A;  1IW2 A;  1ICN A;  3B2J A;  3D95 A;  3B2K A;  3WYQ A;  5KHP A;  1U18 A;  5HA1 A;  1SWR A;  4TKH A;  4BX5 B;  3CBC A;  1VWJ B;  2CM4 A;  2C4I A;  4KT5 A;  2R74 A;  1ZND A;  2G79 A;  2RTA A;  1E06 A;  4C5P A;  1BRQ A;  2WQ9 A;  2YMS A;  3RDM A;  1CBQ A;  3SLT A;  3WJG A;  5LJE A;  1X8N A;  1PTS A;  4TLJ A;  1W4T A;  1VWM B;  1LCW A;  2A2G A;  4CK4 A;  5KID A;  4O3X B;  2X46 A;  1ZNH A;  3VG5 A;  3O19 A;  1KXO A;  4IMN A;  1T68 X;  4Z27 A;  3PDF A;  2JMB A;  1X89 A;  1Y9L A;  3T2X A;  2BT9 A;  3AKN A;  1TW4 A;  1OPA A;  3PPT A;  2BC3 A;  5EEE A;  2FR2 A;  5H9N A;  4IB8 A;  2RTP B;  4YKM A;  4O3Y A;  3VHH A;  1HQP A;  1B0O A;  1AB0 A;  2IZF B;  4Z2O A;  2CM9 A;  4TKB A;  4RUN A;  3U9P C;  1JJJ A;  1ACD A;  2Q2P A;  1BRP A;  2RTQ B;  1EIO A;  3RE6 A;  2LFO A;  3ZW0 A;  1MOY A;  2AKQ A;  2RTG B;  3S5V A;  2FKG A;  1GX3 A;  1VWP B;  2GC9 A;  5LJD A;  1ERB A;  3RY1 A;  3SZI A;  1Y53 X;  2RTL A;  1YWC A;  4ZR2 A;  1DFV A;  5F6Z A;  1LNM A;  3LHN A;  3PK2 A;  5D45 A;  1CBR A;  4ORX A;  3KQ0 A;  1H91 A;  3RDO A;  2X8F A;  2A0A A;  1RBP A;  3FW4 A;  2HZQ A;  4M6S A;  3D96 A;  3NX1 A;  5FQ7 E;  1GXA A;  1S7D A;  3HTY A;  1PBY A;  2GTL M;  1SY2 A;  1X71 A;  4JGL A;  4QGW A;  4WFU A;  1SA8 A;  3MG5 A;  2OY5 O;  2JU7 A;  3OBL A;  4AW8 A;  4EXZ A;  4EDE A;  2IZD B;  5IO6 A;  4TJZ A;  3C77 X;  1BBP A;  2P8G A;  3VG2 A;  3ZW0 B;  2OVA A;  3NQK A;  3FLL A;  2LBA A;  1JIW I;  4RUU A;  1SWD A;  2GTF X;  4BQU A;  1MM9 A;  3ZI8 A;  2R73 A;  2PI3 O;  2X4M A;  1P6P A;  3P02 A;  1W6F A;  2RA6 A;  1TOW A;  3SLJ A;  2KT4 B;  3FMZ A;  1CRB A;  5B5G A;  2OF8 A;  4U3Q A;  2RQ0 A;  1DZK A;  5AJC A;  2FS6 A;  3O22 A;  4XME A;  5L3Y A;  1DF3 A;  1ICM A;  1PMP A;  4MVL A;  1SWK A;  2QMI A;  1HXZ A;  1KQW A;  1LKE A;  1UYN X;  3F6Z B;  1LEL A;  1SXY A;  4U8U N;  1LPJ A;  2UZ2 A;  4WFV A;  5B29 A;  1JMZ A;  1VYF A;  5F2B A;  1LID A;  2HNX A;  3AKM A;  4YDB A;  3X00 A;  3FYF A;  1HMS A;  5EZ2 A;  1Y9T A;  2DJG A;  2FWV A;  4NV8 A;  5D4A A;  1SWH A;  4YFQ A;  3LV4 A;  5HZQ A;  1U17 A;  2FGS A;  2BSZ A;  4O4X A;  2KD2 A;  4OMX A;  1SWS A;  5H9K A;  3NR3 A;  3RDX A;  2X45 A;  1NDJ A;  1HBQ A;  1QQS A;  2A5B A;  2GJ5 A;  1IFB A;  1Y0G A;  3TGA A;  3F9D A;  4COT A;  1VWR B;  3EW1 A;  1ZNL A;  3EBK A;  2ZAI A;  3EC5 A;  3PEC A;  3SAO A;  1S2P A;  2A3F X;  2C1Q A;  2OF9 A;  4MIR A;  5BVQ A;  3UEV A;  3TGC A;  1BWY A;  1VWK B;  1EAL A;  2LBV A;  1K24 A;  3RDQ A;  3RBY A;  5AJB A;  1XKI A;  4Y0S A;  1GT4 A;  4ZH6 A;  4KC8 A;  4KCA A;  4OKA A;  3VHM A;  2AH7 X;  4AZR A;  5CE4 A;  3FEN A;  3ZZV A;  2RTN B;  1GKA A;  1MX8 A;  2ASN X;  4EQA C;  4TKJ A;  2OVE A;  3NQ9 A;  3TF6 A;  2WQA E;  4XMG A;  1FEN A;  1OEJ A;  4BBO A;  3UAQ A;  3VPJ E;  4KC7 A;  3WJF A;  3BY0 A;  4ZHH A;  4EEJ A;  1JMX A;  2FTB A;  2EU7 X;  5LJK A;  4EKV A;  4XMF A;  2G7B A;  2FRS A;  1I9H A;  4Z28 A;  2XKL A;  3STK A;  3P6G A;  1SWN A;  2OFB A;  1HMR A;  4JO6 A;  3UEW A;  2N93 A;  2E4J A;  3JS1 A;  1TXL A;  1FTP A;  5B10 O;  4OMW A;  2OL8 O;  3HOL A;  3WBG A;  2VFC A;  4ZJ0 A;  2IZG B;  2WWP A;  4YGZ A;  4ZCB A;  1MDC A;  3EBW A;  2FHN X;  4I3B A;  1GKA B;  1N7Y A;  1N43 A;  1SWE A;  1VWQ B;  1ZNK A;  4FBO A;  4LQZ A;  3RWX A;  2LB6 A;  5HCC C;  2RN4 A;  3WZN A;  3DTQ A;  5IRU A;  3SZJ A;  4O4O A;  4GGZ A;  5D47 A;  5FQ6 E;  3GE2 A;  1X8O A;  3VG3 A;  1KT6 A;  2MWH A;  3EYC A;  4Y59 A;  4GJV A;  3T2W A;  2OY1 O;  1JYJ A;  2IFB A;  1N4J A;  2G5L A;  4CPE A;  2RTH B;  3VHI A;  1KT3 A;  1LIB A;  1EQD A;  4QNI A;  3TGB A;  2FT9 A;  1KT5 A;  2L9C A;  5IRW A;  3BLG A;  4JNJ A;  3OJY C;  1I05 A;  1YUP A;  1QFT A;  3AUM O;  3KFF A;  1EUO A;  3KFH A;  5D8J A;  4D6B A;  1LDO A;  1I06 A;  2BHV A;  4XMD A;  1VWH B;  4NYR A;  3I17 A;  3HWD A;  4NNT A;  3RKG A;  3VG4 A;  1SWJ A;  3D97 A;  3FEP A;  4DCB A;  2HMB A;  1E02 A;  1E2T A;  1GX9 A;  1NP4 A;  3NX2 A;  4YBU A;  1FEM A;  3WJC A;  3ZW1 A;  1SWF A;  2K23 A;  4IB9 A;  4AYH A;  2OL6 O;  3FW5 A;  2FKJ A;  2IZE B;  2MF6 A;  1FEL A;  2Q9S A;  5IO5 A;  1K3B A;  3T6F A;  1FJ1 E;  5B2A O;  1R0U A;  1AVG I;  2QO5 A;  4BX7 A;  3FEL A;  3WXQ A;  1DZM A;  3SOT A;  2GTL O;  4Y0P A;  2L5P A;  1RXJ A;  3FIQ A;  2VFB A;  1KQX A;  2QO4 A;  4GNW A;  2Y32 A;  5HCE C;  2G8C O;  3GAQ A;  1KZW A;  1JQP A;  2CBR A;  1QY1 A;  2ACP X;  1SWU A;  2ANS A;  3NQ3 A;  5LJB A;  3U0D A;  4LKP A;  1JBH A;  3KFI A;  5BVS A;  3BDR A;  3ZW1 B;  2NP1 A;  1TOU A;  2QM9 A;  1G7N A;  3JQO A;  5H9A A;  4BCS A;  4MVE A;  3CQR A;  5HTD A;  1N9Y A;  4Y5D A;  3HWE A;  2OFA A;  1E00 A;  3FA6 A;  3OE3 A;  2WR6 A;  2ZSC A;  2Y3E A;  1ALB A;  4QZU A;  3WVM A;  4CPI A;  4Z2V A;  1EPB A;  5HA0 A;  5L8I A;  1MEP A;  4YFR A;  4BX7 B;  1HQQ A;  4CPF A;  1SWP A;  5H8T A;  2Z4I A;  3P6H A;  1OBQ A;  1CBS A;  1Z24 A;  3WZO A;  3I0A A;  5B5F A;  4QYN A;  2WPU A;  1GGL A;  1IFC A;  4XMC A;  1MUP A;  1SXU A;  4YH0 A;  2IZJ A;  3CKG A;  1ADL A;  1IKJ A;  2RTI B;  3MX7 A;  1A57 A;  3C78 X;  5C0N A;  4QGX A;  2A13 A;  1RLB E;  5K67 A;  1SRG A;  1KZX A;  4GNY A;  4YGH A;  4GU8 A;  2IZA A;  5JD2 A;  1N0S A;  1SLF B;  3T1D A;  5HZ6 A;  4ID2 A;  3EW2 A;  5FEN A;  1SWQ A;  3D9W A;  3L4R A;  4GZV A;  4BOE A;  1ERX A;  2BS5 A;  2G78 A;  1G85 A;  2AT0 X;  3HPE A;  2F01 A;  2NNQ A;  2OY8 A;  1SLG B;  2QOM A;  3CMP A;  4WBK A;  3S26 A;  1YWB A;  1XCA A;  3FR5 A;  1O1V A;  5CSE A;  2C1S A;  3JSQ A;  3T6L A;  3CWK A;  5LJG A;  3G7X A;  4ORY A;  1GM6 A;  4YVB A;  3RE5 A;  1SRJ A;  1U0X A;  1QY0 A;  3BX8 A;  3HK1 A;  2PY1 A;  3ZQ3 A;  1KL3 A;  1IKE A;  1Y55 X;  2JW1 A;  3EM0 A;  5B11 O;  2RTF B;  4CDC A;  2A5C A;  4TNN A;  1QG5 A;  2F73 A;  1T0V A;  3CKF A;  4I3D A;  1JV4 A;  3PH6 A;  1G74 A;  1ZNE A;  1IIU A;  1SWO A;  1YP7 A;  1EW3 A;  3CR6 A;  1VWN B;  3ELX A;  4YDA A;  5HWZ A;  4HPD A;  4B55 A;  1VPR A;  1VWC B;  2FHL A;  1VWB B;  2R56 A;  1MVG A;  5IRA A;  4FBR A;  2QO6 A;  1VYG A;  2OFR X;  2KTS A;  4DNE A;  4ZHC A;  5HAE A;  4CDD A;  5IO7 A;  1KL4 A;  3F8A A;  4HPB A;  1JZU A;  1O8V A;  1GT1 A;  1AEL A;  4I95 A;  3UEX A;  4PJ2 A;  4CPH A;  2CAM A;  2QOS C;  4Y0Q A;  2JGS A;  1STR B;  4WHI A;  4EFG A;  2LA7 A;  1PM1 X;  5BYP A;  2Q2M A;  5F6B A;  4GD9 A;  1UYO X;  4TQ2 A;  1MK5 A;  2AMM X;  2OZQ A;  2ACO A;  2CZT A;  1NGL A;  3FID A;  1OBP A;  4L1N A;  2F09 A;  4CSB A;  3BRN A;  5FQ8 E;  5HZ8 A;  1SY0 A;  1VWE B;  3PP6 A;  1ML7 A;  4HWM A;  4JHQ A;  4ARH A;  1CJ5 A;  2WEW A;  3RDU A;  3RSW A;  1TVQ A;  1N9M A;  4NLJ A;  1D3S A;  3HWG A;  5CHK A;  3VE1 A;  1VWA B;  1BSY A;  4GK9 A;  2BLG A;  4O49 A;  5B27 A;  1OPB A;  1NQN A;  3VG7 A;  2AVI A;  3APW A;  4CPH B;  1PBO A;  3ZWE A;  4Z2P A;  1UZ2 X;  1AVE A;  4AZP A;  4OS0 A;  3TZS A;  2X32 A;  2ZAG A;  2NNE A;  1GT3 A;  2XST A;  3STN A;  5KIC A;  1BSO A;  2X8S A;  5LKE A;  1RXH A;  2AT5 X;  3NBX X;  2Y3F A;  2RCT A;  3DSZ A;  4MEE A;  4ML7 B;  5LJC A;  5AEO A;  5HZ9 A;  2X8T A;  4IAX A;  1SMP I;  3WOV A;  3NAD A;  4O4S A;  3IA8 A;  1SLD B;  1BJ7 A;  1VWL B;  2AT6 X;  4AZO A;  4ES7 A;  3Q34 A;  4FBV A;  3SLO A;  2RTK A;  4O4U A;  4FQB B;  4I9R A;  3WJD A;  5LKF A;  1MX7 A;  3RZY A;  3S5X A;  1SLE B;  4QQ1 A;  4KII A;  4OEM A;  2JOZ A;  2NND A;  2JN3 A;  2OFM X;  2RD7 C;  2AT8 X;  3EMM A;  2JU8 A;  2HKD A;  4I60 A;  4NV7 A;  2OYB O;  4ZGU A;  4R0B A;  1OSP O;  4N7C A;  2GH7 A;  3CBS A;  4ORU A;  2AT3 X;  1HBP A;  2ALL X;  1SY1 A;  2KW1 A;  3BX7 A;  3MVF A;  1SRE A;  2HLV A;  4YMY A;  1BLR A;  4BGF A;  2X34 A;  1B8E A;  3D4R A;  4INN A;  4GET A;  4MVK A;  2VDF A;  1KT7 A;  4AZM A;  3FA9 A;  1FDQ A;  1AVD A;  1LIC A;  2MJI A;  3VGW A;  3FA8 A;  2MHD A;  1A2D A;  2POA A;  4U8U O;  2Z4H A;  5H9L A;  2LKK A;  4KH8 A;  3PH5 A;  1I4U A;  1I04 A;  4A60 A;  1SRI A;  2RTM A;  1ZNG A;  4IMO A;  1LFO A;  1LCV A;  1RXK A;  3P6E A;  4ORS A;  5F7G A;  4YBP A;  1NBX A;  1SWA A;  1QAB E;  1BM5 A;  2CZU A;  4O3W A; 
#chains in the Genus database with same CATH homology
 1HMT A;  4U8U M;  4NLI A;  4LKT A;  1X8P A;  3BU1 A;  4CSB A;  4YCH A;  3P6F A;  1DC9 A;  4ALO A;  1OEE A;  4ZHG A;  5L8O A;  5CYB A;  1B56 A;  1EPA A;  4XMH A;  3ZUO A;  4UU2 A;  2FS7 A;  3E3C A;  5EDB A;  3STM X;  4OS3 A;  4ZH9 A;  1X8Q A;  2Q4N A;  2W2F A;  1KOI A;  3PQU A;  3FEK A;  4A8Z A;  3N91 A;  5HZ5 A;  1NP1 A;  5BVT A;  3KZA A;  3ELZ A;  4ZHD A;  3ZW2 A;  4AZN A;  5F1E A;  4MIS A;  1ZRY A;  3BS2 A;  4LZV A;  3PQS A;  4UU3 A;  2JU3 A;  4YFP A;  5AQ6 A;  1DZJ A;  5FAZ A;  1BSQ A;  3MBT A;  1T8V A;  2W2B A;  4GH7 A;  3B2I A;  4MVI A;  4HFO A;  2FR3 A;  4ODD A;  3U03 A;  3FA7 A;  4D6A A;  3HWF A;  4YKO A;  4I3C A;  4QAE A;  2M4L A;  1KT4 A;  1BEB A;  3B2L A;  3QKG A;  1SY3 A;  3FR4 A;  1QFV A;  1HN2 A;  4DQ3 A;  4QYP A;  1G5W A;  1SXW A;  2FLJ A;  1PEE A;  4A1H A;  2HYS A;  3FR2 A;  2A2U A;  4DQ4 A;  1URE A;  3P6D A;  3BU9 A;  3B2H A;  3HOE A;  5FFH A;  1JYD A;  4M7M A;  4OS8 A;  4GE1 A;  4A1Y A;  5JR8 A;  4ORW A;  2AL0 X;  2BS6 A;  3ZUI A;  4PSQ A;  1GX8 A;  3Q6L A;  4I9S A;  4GRJ A;  2K62 A;  2O62 A;  2OVS A;  3WJE A;  1OBU A;  3CQN A;  2YG2 A;  4L3R A;  5LJH A;  5DPQ A;  1JJX A;  4YCE A;  4NW4 A;  2MM3 A;  5K06 A;  3K3L A;  3S60 A;  2GTL N;  3NPO A;  1OEK A;  4N7D A;  1LIF A;  5EDC A;  4ON1 A;  5HBS A;  1GT5 A;  2MO5 A;  3H3I A;  4HPC A;  3UEU A;  4LZU A;  4ORR A;  3WJB A;  2L68 A;  4GKC A;  4Y0R A;  2OVD A;  4BVM A;  4O3Z A;  1L6M A;  3P6C A;  1AQB A;  1A3Y A;  4IBA A;  3VU1 A;  1DZP A;  2WEX A;  3IFB A;  4IB6 A;  3V8U A;  3VG6 A;  3APV A;  4ZHF A;  5EPQ A;  2Q39 A;  1EI5 A;  4AZQ A;  4ZGF A;  3KFG A;  2CBS A;  1KGL A;  3BSZ E;  4U9C A;  1EII A;  4NNS A;  3O2Y A;  5EED A;  4NYQ A;  1E5P A;  5F58 A;  1YIV A;  3C76 X;  2HZR A;  1A18 A;  5HTE A;  4I6S A;  5HCD C;  1X8U A;  4QRL A;  1QWD A;  4QZT A;  1DV9 A;  1LIE A;  5D48 A;  1EXS A;  3NP1 A;  1B4M A;  1QY2 A;  1CBI A;  2KTD A;  4IAW A;  5L8N A;  4NP1 A;  2RCQ A;  4IAB A;  1S44 A;  4GDZ A;  1YWD A;  4IB7 A;  1YWA A;  4K19 A;  3APU A;  4YGG A;  4ALB A;  3P24 A;  1YP6 A;  1SXX A;  2WSJ A;  1LF7 A;  2W2A A;  4QGV A;  1O1U A;  4HPA A;  3PED A;  1FE3 A;  5DG4 A;  2L67 A;  4CV7 A;  2WUT A;  3VE2 A;  4O9S A;  3APX A;  4FGI B;  4ZFX A;  1D2U A;  3OD9 A;  2DM5 A;  1IW2 A;  1ICN A;  3B2J A;  3D95 A;  3B2K A;  5KHP A;  1U18 A;  5HA1 A;  4TKH A;  3CBC A;  2CM4 A;  4KT5 A;  2R74 A;  1ZND A;  2G79 A;  1E06 A;  5LJE A;  1BRQ A;  2WQ9 A;  2YMS A;  3WJG A;  1CBQ A;  1X8N A;  4TLJ A;  2A2G A;  4CK4 A;  5KID A;  4O3X B;  2X46 A;  1ZNH A;  3VG5 A;  3O19 A;  1KXO A;  4IMN A;  1T68 X;  2JMB A;  1X89 A;  1Y9L A;  2BT9 A;  3AKN A;  1TW4 A;  1OPA A;  3PPT A;  5EEE A;  5H9N A;  2FR2 A;  4IB8 A;  4YKM A;  4O3Y A;  1HQP A;  1B0O A;  1AB0 A;  2CM9 A;  4TKB A;  4RUN A;  3U9P C;  1JJJ A;  1ACD A;  2Q2P A;  1BRP A;  1EIO A;  2LFO A;  3ZW0 A;  2AKQ A;  3S5V A;  2GC9 A;  5LJD A;  1ERB A;  4ZR2 A;  1YWC A;  1DFV A;  5F6Z A;  1LNM A;  3LHN A;  5D45 A;  1CBR A;  4ORX A;  3KQ0 A;  1H91 A;  2X8F A;  2A0A A;  1RBP A;  3FW4 A;  2HZQ A;  4M6S A;  3D96 A;  3NX1 A;  5FQ7 E;  1GXA A;  1S7D A;  3HTY A;  2GTL M;  1SY2 A;  1X71 A;  4JGL A;  4QGW A;  4WFU A;  1SA8 A;  4AW8 A;  4EXZ A;  2JU7 A;  3OBL A;  4EDE A;  5IO6 A;  4TJZ A;  3C77 X;  1BBP A;  2P8G A;  3VG2 A;  3ZW0 B;  2OVA A;  3NQK A;  3FLL A;  2LBA A;  1JIW I;  4RUU A;  2GTF X;  4BQU A;  3ZI8 A;  2R73 A;  1P6P A;  3P02 A;  2RA6 A;  1TOW A;  2KT4 B;  3FMZ A;  1CRB A;  4U3Q A;  2RQ0 A;  1DZK A;  5AJC A;  2FS6 A;  3O22 A;  4XME A;  1DF3 A;  1ICM A;  1PMP A;  4MVL A;  3F6Z B;  2QMI A;  1KQW A;  1LKE A;  1SXY A;  4U8U N;  1LPJ A;  4WFV A;  5B29 A;  1VYF A;  1LID A;  2HNX A;  3AKM A;  4YDB A;  3FYF A;  1HMS A;  5EZ2 A;  1Y9T A;  2FWV A;  5D4A A;  4YFQ A;  3LV4 A;  5HZQ A;  1U17 A;  4O4X A;  2KD2 A;  4OMX A;  5H9K A;  3NR3 A;  2X45 A;  1HBQ A;  1QQS A;  2GJ5 A;  1IFB A;  3TGA A;  3F9D A;  4COT A;  1ZNL A;  3EBK A;  2ZAI A;  3PEC A;  3SAO A;  2A3F X;  1S2P A;  5BVQ A;  4MIR A;  3UEV A;  3TGC A;  1BWY A;  1EAL A;  2LBV A;  3RBY A;  5AJB A;  1XKI A;  4Y0S A;  1GT4 A;  4ZH6 A;  4KC8 A;  4KCA A;  2AH7 X;  4AZR A;  5CE4 A;  3FEN A;  3ZZV A;  1GKA A;  1MX8 A;  2ASN X;  4EQA C;  4TKJ A;  2OVE A;  3NQ9 A;  3TF6 A;  2WQA E;  4XMG A;  1FEN A;  1OEJ A;  3UAQ A;  3VPJ E;  4KC7 A;  3WJF A;  3BY0 A;  4ZHH A;  4EEJ A;  2FTB A;  2EU7 X;  5LJK A;  4XMF A;  2G7B A;  2FRS A;  2XKL A;  3STK A;  3P6G A;  1HMR A;  3UEW A;  2N93 A;  2E4J A;  3JS1 A;  1TXL A;  1FTP A;  4OMW A;  3HOL A;  3WBG A;  4ZJ0 A;  2WWP A;  4YGZ A;  4ZCB A;  1MDC A;  3EBW A;  4I3B A;  1GKA B;  1ZNK A;  4FBO A;  4LQZ A;  3RWX A;  2LB6 A;  5HCC C;  2RN4 A;  3DTQ A;  4O4O A;  5D47 A;  5FQ6 E;  3GE2 A;  1X8O A;  3VG3 A;  1KT6 A;  2MWH A;  3EYC A;  1JYJ A;  2IFB A;  1KT3 A;  1LIB A;  1EQD A;  4QNI A;  3TGB A;  2FT9 A;  1KT5 A;  2L9C A;  3BLG A;  3OJY C;  1I05 A;  1YUP A;  1QFT A;  3KFF A;  1EUO A;  3KFH A;  5D8J A;  4D6B A;  1I06 A;  2BHV A;  4XMD A;  4NYR A;  3I17 A;  3HWD A;  4NNT A;  3RKG A;  3VG4 A;  3D97 A;  3FEP A;  2HMB A;  1E02 A;  1GX9 A;  3NX2 A;  1NP4 A;  4YBU A;  3WJC A;  1FEM A;  3ZW1 A;  2K23 A;  4IB9 A;  4AYH A;  3FW5 A;  1FEL A;  2Q9S A;  5IO5 A;  1R0U A;  1AVG I;  2QO5 A;  3FEL A;  3WXQ A;  1DZM A;  3SOT A;  2GTL O;  4Y0P A;  2L5P A;  3FIQ A;  1KQX A;  2QO4 A;  4GNW A;  5HCE C;  3GAQ A;  1KZW A;  2CBR A;  1QY1 A;  2ACP X;  5LJB A;  2ANS A;  3NQ3 A;  3U0D A;  1JBH A;  4LKP A;  3KFI A;  5BVS A;  3BDR A;  3ZW1 B;  2NP1 A;  1TOU A;  2QM9 A;  1G7N A;  3JQO A;  5H9A A;  4MVE A;  3CQR A;  5HTD A;  3HWE A;  3FA6 A;  1E00 A;  3OE3 A;  2WR6 A;  1ALB A;  4QZU A;  3WVM A;  1EPB A;  5HA0 A;  5L8I A;  4YFR A;  5H8T A;  2Z4I A;  3P6H A;  1OBQ A;  1CBS A;  1Z24 A;  3I0A A;  4QYN A;  1GGL A;  1IFC A;  4XMC A;  1MUP A;  1SXU A;  4YH0 A;  1A57 A;  1ADL A;  1IKJ A;  3MX7 A;  3C78 X;  5C0N A;  4QGX A;  2A13 A;  1RLB E;  1KZX A;  4GNY A;  4YGH A;  4GU8 A;  1N0S A;  3T1D A;  5HZ6 A;  4ID2 A;  5FEN A;  3L4R A;  4GZV A;  4BOE A;  1ERX A;  2BS5 A;  2G78 A;  1G85 A;  2AT0 X;  3CMP A;  2NNQ A;  4WBK A;  3S26 A;  1YWB A;  1XCA A;  3FR5 A;  1O1V A;  3JSQ A;  3CWK A;  5LJG A;  3G7X A;  4ORY A;  1GM6 A;  1U0X A;  1QY0 A;  3BX8 A;  3HK1 A;  2PY1 A;  3ZQ3 A;  3EM0 A;  1IKE A;  2JW1 A;  4TNN A;  1QG5 A;  2F73 A;  1T0V A;  4I3D A;  1JV4 A;  3PH6 A;  1G74 A;  1ZNE A;  1IIU A;  3ELX A;  1YP7 A;  1EW3 A;  3CR6 A;  4YDA A;  5HWZ A;  4HPD A;  1VPR A;  2R56 A;  1MVG A;  4FBR A;  2QO6 A;  1VYG A;  2OFR X;  2KTS A;  4ZHC A;  5HAE A;  5IO7 A;  3F8A A;  1JZU A;  4HPB A;  1O8V A;  1GT1 A;  1AEL A;  4I95 A;  3UEX A;  4PJ2 A;  2QOS C;  4Y0Q A;  4WHI A;  4EFG A;  2LA7 A;  1PM1 X;  5BYP A;  2Q2M A;  5F6B A;  4TQ2 A;  2AMM X;  2OZQ A;  2ACO A;  2CZT A;  1NGL A;  1OBP A;  4L1N A;  2F09 A;  5HZ8 A;  3BRN A;  5FQ8 E;  1SY0 A;  1CJ5 A;  3PP6 A;  1ML7 A;  4HWM A;  4ARH A;  2WEW A;  3RSW A;  1TVQ A;  4NLJ A;  1D3S A;  3HWG A;  3VE1 A;  4GK9 A;  1BSY A;  2BLG A;  4O49 A;  5B27 A;  1OPB A;  3VG7 A;  3APW A;  1PBO A;  3ZWE A;  1UZ2 X;  4AZP A;  4OS0 A;  3TZS A;  2ZAG A;  2NNE A;  1GT3 A;  2XST A;  3STN A;  5KIC A;  1BSO A;  2X8S A;  5LKE A;  2AT5 X;  3NBX X;  2RCT A;  3DSZ A;  5LJC A;  4ML7 B;  5AEO A;  5HZ9 A;  2X8T A;  4IAX A;  1SMP I;  3WOV A;  3NAD A;  4O4S A;  3IA8 A;  4AZO A;  1BJ7 A;  2AT6 X;  4ES7 A;  4FBV A;  4O4U A;  4FQB B;  4I9R A;  3WJD A;  5LKF A;  1MX7 A;  3RZY A;  3S5X A;  4QQ1 A;  4KII A;  2JOZ A;  2NND A;  2OFM X;  2JN3 A;  2RD7 C;  2AT8 X;  3EMM A;  2JU8 A;  4A60 A;  4ZGU A;  4R0B A;  4N7C A;  3CBS A;  4ORU A;  2AT3 X;  1HBP A;  2ALL X;  1SY1 A;  2KW1 A;  3BX7 A;  3MVF A;  2HLV A;  4YMY A;  1BLR A;  3D4R A;  1B8E A;  4INN A;  4MVK A;  4GET A;  1KT7 A;  4AZM A;  3FA9 A;  1FDQ A;  1LIC A;  2MJI A;  3FA8 A;  2MHD A;  1A2D A;  2POA A;  4U8U O;  2Z4H A;  5H9L A;  2LKK A;  4KH8 A;  3PH5 A;  1I4U A;  1I04 A;  1ZNG A;  4IMO A;  1LFO A;  3P6E A;  4ORS A;  5F7G A;  4YBP A;  1QAB E;  1BM5 A;  2CZU A;  4O3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...