1BBRH

The structure of residues 7-16 of the a alpha chain of human fibrinogen bound to bovine thrombin at 2.3 angstroms resolution
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
150
structure length
150
Chain Sequence
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPSILON-THROMBIN
publication title The structure of residues 7-16 of the A alpha-chain of human fibrinogen bound to bovine thrombin at 2.3-A resolution.
pubmed rcsb
source organism Bos taurus
molecule tags Serine protease
total genus 19
structure length 150
sequence length 150
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 1992-04-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bbrH00
1CBWC 5HYOA 2ANWA 5EPNA 5I25A 3I77A 3M5LA 2BHGA 4GAWA 2XNIA 2AGGX 4ZMAH 2NU4E 1E34B 1GHBF 3LT3A 4E7NA 1OSSA 1O31A 2GDDA 2XTTB 2B5TB 1ZPCA 2QN5T 1AZ8A 2PKSC 4Q7ZA 2FIRH 1MAYA 4ZROA 2I6QA 4ZKNU 1TRNA 1GBAA 1NM6A 2OC0A 3EDXB 2ZKSA 3LJOA 1P9SA 1HAOH 3SGBE 3FZDA 1PYTD 2Y82A 3GDVA 2VIVA 3JZ1B 1NFYA 1MMJN 3EGKH 2BQ7B 1C5XB 2GV6A 1DWEH 1ORFA 5C3NA 3M7UA 3BTWE 2Z9JA 5DPAA 1DUEA 5A0CA 1HAVA 1KSNA 3GCOA 2PWXA 5ETXA 4WMFA 2PTNA 3FP6E 6GCHF 1HUTH 1KXAA 1V2OT 2C90B 4J2YB 4YLUA 3MO9A 3SUFA 1NY22 2BD7A 2P8OC 1ABJH 2XXLA 1HXFH 1XXDA 2F3CE 2TBSA 1B0FA 1DLEA 2BB4A 2P3TB 4ISLA 3U1JB 1BTZA 1DPOA 4DJZB 3MU8A 5AVDA 1MTWA 1EUFA 4K1SA 4LXBH 1O2JA 1UTLM 2QC2A 1DXWA 3BF6H 1H1BA 1P05A 1RGQA 3VXEH 1MTUA 4BAMB 2ZU5A 1ZLRA 3M7QA 1H4WA 3QK1A 2A4QA 3BEIB 4O9VA 1TNJA 3GOVB 1FMGA 2H9HA 2H6MA 3MTYA 1NRQH 4OGYA 2A45B 4WVPE 3RXEA 2ZU2A 1AIXH 1EZUC 1UK3A 2Q6DA 3DFLA 5FCRA 4WXIA 1DS2E 8KME2 2K1QA 4IC5A 1YPGH 1O2PA 1PFXC 2ZEBA 2BX4A 4D8NA 3LGUA 1G32B 1UJ1A 1HYLA 1W8BH 2QF0A 1GJ4H 1UTKA 2ZHDA 4ZKRU 3SQHE 2QYIA 4Y8YA 4I32A 3P17H 1GMCG 1RIWC 5EXNA 4LZ1H 4NIVA 4FU7A 1ZYOA 3K6ZA 2G5NA 4X8VH 3OSYA 5EODA 1OWKA 4AB9A 3NPSA 1O5BB 4B73A 5A0AE 1L2EA 2ZGCA 3LGTA 2Y80A 1O2RA 2CXVA 1P2NA 2AH4X 3TJVA 1L1GA 1S83A 3U8OH 4NCYA 1TBZH 1C1RA 3OX7U 2FDAA 3P8OA 1C1QA 2A5AA 1WU1A 3UQOA 4WJG2 2VIQA 3LIWA 4K1EA 1MBMA 3A88A 4AOQA 1FONA 1NFWA 5GPIB 4X8UH 2R9PA 2BVSH 2SGAA 2AGEX 1C5QA 5E0JA 1FLEE 1Y3WA 2FP7B 2UUKB 4D7GA 1TGCA 9LPRA 4QT8C 2OTVA 1SGYE 4DG4A 1HAZB 8LPRA 1HAPH 2Z3CA 4R8TB 2XCNA 2GZ8A 1GJ9B 5L6NH 2J38A 4R0IA 2ALVA 1UTOA 1BMLA 3SNEA 1TMUH 4XBBA 1O3MA 2UWLA 1FY5A 2OINA 3HPTB 1BIOA 5JB8S 1O3JA 1PPHE 1ESBA 1BT7A 1JBUH 3O8DA 2ZECA 3MU4A 5DK1A 2CHAC 4MNXA 1A4WH 3LGVA 1GMDG 3H5CB 1MD8A 1O3FA 1LPGB 2VIPA 2A0QB 4JYTA 1YPHC 3SV6A 2PV9B 3LDXH 3GICB 2XC4A 1CBWB 4MPUA 1Z8JB 1C1WH 2HALA 1VITH 1GBCA 3A7WA 1P03A 3S0NA 1A7SA 1BRCE 1VJAU 1SVPA 2PKSB 1Y3YA 2XC5A 2ZZUH 1KXBA 1JIRA 2OBOA 2EEKA 1IAUA 1WAYB 1P09A 2EC9H 4GHQA 3RXHA 1NC6A 1TB6H 1N6XA 1O3KA 1FJSA 1K21H 1SMFE 5LPRA 2BOHB 3S7KB 3OY5U 1A5IA 2QV1A 1K1IA 4IN1A 1P2QA 3CENA 1TNKA 2SFAA 1H9IE 2VWOA 1P9UA 2CJIA 1G3EA 3SNCA 4ZXYH 2PUQH 3U8TH 1V2QT 1GJ7B 3HKIB 2FXRA 5TCCA 5C1XA 1TNHA 3A8DA 5FPTA 1PQ5A 1GMCF 3RXFA 1O2GH 2GCTC 2OC8A 1QA7A 1YGCH 4IW4E 2P8OB 1EOJA 2VVCA 3ZVDA 1W7XH 1ANDA 3E6PH 2B7DH 1SGEE 1Z1IA 2IPHA 2NU1E 4ABHA 1JRSA 4J1YA 1XKBC 2FOGA 2ZCKP 1LMWB 3N7OA 1SGQE 3LH1A 3SOSA 4JK5A 4CR5A 1LVOA 4ZKOU 3RXDA 3FP7E 1GI6A 3SJOA 2ZHEH 2BD5A 2BY5X 4AORA 1NESE 4ABFA 5A2MH 2Z3DA 1SPJA 1V2WT 3MH4A 3KN2A 2G8TA 4MLFB 3QN7A 1KXEA 2Y6TA 2O8WA 2G55A 1TRYA 2GMTC 1AVXA 1S0RA 4CHAC 2ILNA 5F03A 1ZOMA 2EI7A 4FUFA 3NKKA 1QBOA 2GTBA 2J95A 1GI4A 2Q1JA 1QBNA 3RXPA 4YO9A 1C5NH 4INKA 1T32A 2FO9A 2P94A 4FVBA 1RIWB 3M35A 1SGRE 4BANB 1GI7B 4BTUB 2VU8E 1S84A 1AFQB 5FXLA 1EQ9A 2OQ5A 2PSXA 3MI4A 3DFJA 4I8HA 1LKAA 1PQAA 1LDTT 3NK8A 3OTJE 3VFEA 1GMDF 1BUIA 3TH3H 5SGAE 1HJ8A 2VGCB 2H1UA 3O8CA 1A5HA 3BSQA 2R0LA 4NA7A 3RC4A 3I78A 3RXRA 4TWYA 2VWLA 2OLGA 4YM9A 1Q3XA 4M7GA 2UWPA 1YLCA 2VWNA 1ESTA 1FN8A 1O34A 2R2WU 1TAWA 1O3AA 4GCHG 1NRRH 1YF4A 1SI5H 2AYWA 3BG4C 3MU1A 4H42U 2ZA5A 5J4SA 4YT6H 3GYMA 4FUCA 4I31A 4DVAU 1XUIA 1UTJA 2AIPA 4TPIZ 1OX1A 4ZHAA 1BHXF 3RXAA 2FX6A 1DM4B 2F9VA 3WY8A 1SGDE 1T4VH 1T8NA 2W26A 4XFQA 3OU0A 1FUJA 5GDSH 1UVUH 1W2KH 3SU3A 1D3PB 2V35A 3RU4T 3V13A 1YYY1 2KAIB 1O2UA 2BLQA 1S85A 3HATH 4Z0KA 2D8WA 2WPJS 1ZGIA 3B23B 3LC3A 1C2FA 1LPZB 5H4IB 3KIDU 1QA0A 2A4GA 4ABBA 1SLVB 2VJ1A 2CHAB 1HIAB 3SV8A 2ZIQH 5F8XA 1ETTH 2BVXH 3F1SB 1FQ3A 2V0BA 1YBWA 2W5EA 1G2LA 2H5DA 3AAUA 2QCYA 4NFFA 4XBDA 4GSOA 1GI3A 1ELTA 3F6UH 1SLUB 1Y3VA 1NPMA 3P8GA 1GBTA 1IQFA 1AKSB 1KTSB 3E3TA 2C3SA 4ZXXH 2Z7FE 3LU9B 3SHAH 1YP9A 4TPYA 1E38B 1P11E 2F9UA 5JB9S 1OWDA 1T8LA 1CA0C 1J16A 1DUAA 1UTNA 1NFXA 1NRPH 3ATIA 1FI8A 5T6FA 5EXLA 4NSYA 2CMYA 3LGYA 1FAKH 1J9CH 2WV4A 2O9QA 4TY7A 1GHZA 1KXFA 4FXGH 1EB1H 2Z3EA 1TLDA 2ZHWH 3C1KA 2FOHA 4AGJA 3U9AH 3SI3H 5EG4A 3PLBA 5B6OA 1TMTH 1P10A 1OYTH 1HIAA 2BLWA 1IQKA 1ZSJA 1C2IA 3DD2H 2WYGA 2ODPA 4FU9A 4WY3A 5DO4H 1CHGA 3PTNA 1WTGH 1AUTC 4A7IB 1GG6C 1OKXA 1BTWA 1AWHB 5ABWA 2SGPE 3NXPA 2FESH 2ZWLH 2OC7A 1UCYE 1C4Y2 1MUEB 2BD9A 5HM9A 3LJJA 1A61H 3G01A 2J94A 3RU4E 3E90B 1BHXB 1A5GH 3RU4D 3URCA 3SQEE 1DWBH 1W7GH 1GVLA 2BY8X 3T25A 2R3UA 4Y8ZA 3BIVH 3TNTA 1C2KA 4GCHF 4GHTA 5AFYH 3ZZ3A 1TGNA 1TQ0B 1ELGA 3RXIA 3A87A 5F8ZA 1SGTA 5JDUB 1L4DA 1CT2E 5C5NA 2GMTB 4CHAB 4Q80A 1BBRE 1ANEA 1HAYB 1LVYA 1G9IE 1QJ1B 1QY6A 2XYAA 3SW2B 1WBGB 2OBQA 4LK4A 1BA8B 5EQSA 4HGCA 4HTCH 5A09A 1OWHA 1D6WA 1DITH 1FN6A 5DJ7A 1O5EH 7ESTE 5LPFA 1C5VA 2PGBB 1O3CA 1GDNA 1BJVA 1C1SA 1OP2A 1RTFB 5GJ4B 1QRWA 4D9RA 5LPEA 3TK5A 4D7FA 4CR9A 3GDUA 3P92A 3VPKA 3JZ2B 1WCZA 1K1OA 4O3TA 1LCYA 1GBLA 4AB8A 1YM0A 1C5YB 4X2YA 4CBNA 3BG4B 1TPOA 2Y7ZA 1TFXA 5DP8A 4NSVA 1HFDA 2VNTA 1SGFA 1C1MA 4DURA 3MFJA 3HGPA 3DT0H 4NA8A 1V2LT 2WYJA 4MQAA 3D49H 1BTXA 2TGDA 2C8ZB 1C1VH 2ZDLA 4CRAA 1P12E 2ZTYA 3BEUA 2ESTE 4X1QU 3GY6A 2ZHQH 1G3CA 2ZU4A 3RXTA 1QIXB 4Q7XA 4HFPB 1ZRKA 2HNTF 2YNBA 1DWCH 4DOQA 1LTOA 1NT1A 2A2XH 1P3EA 2W7SA 2PGQB 3K65B 3A8AA 4LZ4B 7GCHF 4NZQA 3BTQE 5ESBA 4JCNA 4RKOB 1GJ8B 1Y5UT 5J4QA 1XXFA 3CS7A 2H2ZA 1V2PT 2C4FH 1LO6A 1GGDC 2BDYA 1GI5A 1C9TA 3IITA 2BDIA 3E1XB 1O3LA 3NZIA 2ZF0H 1MAXA 1SFQB 1YC0A 1O2MA 2Y5GA 1B7XB 1TGTA 1DWDH 1M9UA 3RXMA 3M7TA 1HB0B 5FAHA 1SBWA 2Q6GA 3RXLA 1CA0B 5C1YA 3RMLH 1XM1A 1ZGVA 4Q7YA 2BDBA 5E2OA 2WPIS 1C5MD 1T4UH 2BD2A 2OXSA 5FBEA 1SB1H 3V12A 1F5KU 1DOJA 3A83A 3Q77A 1JOUB 3UTUH 3SV2H 3GISB 4LOYH 1AN1E 1O2SA 1ZJDA 3RC5A 1WQVH 4Z6AH 1ELCA 1EATA 1A0JA 1MCTA 2STBE 3GDSA 3UIRA 1UTPA 1MQ5A 2P59A 1CGJE 4AYYB 1BQYA 1QL8A 1HGTH 3TGJE 2BOKA 1CT4E 3PM3A 4CH8B 4IMQA 1GBHA 1GBDA 1WSSH 4WH8A 2A32A 4CRGA 3I29A 3QWCH 5C5OA 3SU1A 3LGIA 1SG8B 1GG6B 2W3IA 3M5MA 1GL0E 1VZQH 3VGCC 5TJXA 3QTVH 4ABIA 1PPBH 3R3GB 1YPKH 1AVWA 2EI8A 2M5TA 2WPHS 1AUJA 3SUGA 2P95A 1F0RA 2W3KA 2ZFQH 1Q31A 1OWJA 1EB2A 2R3YA 2JH5D 2DUCA 2ZTXA 2O8TA 3ZYDA 1OPHB 3KF2A 2HGTH 3MNCA 4WWYA 3ZV9A 1ANCA 1N1LA 5DG6A 3PO1C 2WV5A 4X1NU 4GVUA 2A4RA 3SHCH 1MZAA 5DP9A 4UONA 2FLBH 5FX5A 1Z6EA 1AI8H 3ATKA 3UOUA 2JH0D 4AG2A 3VB4A 1P2IA 1CA8B 1ESAA 1FY3A 4YOIA 4WF8A 4NWLA 5GCHG 2OUAA 1P04A 3UR6A 1GJ6A 4UD9H 1C5LH 1CGHA 1C2HA 1HLTH 4A6LA 1QL9A 3LOXA 3BEFB 1JWTA 4H6SB 1UTQA 4I8JA 2HRVA 4B2AA 4BAQB 3A7TA 1AB9B 3VB6A 2PLXA 2ZDMA 1W11U 3TVJB 3RXUA 3HK3B 3A80A 1TGSZ 1H8IH 2A2QH 1NRSH 1V2MT 1ZMNA 3M5OA 1IQMA 1IQNA 2C8XB 1LHDH 1B0EA 2QXHA 2BDGA 3EA9A 1UCYK 3RXJA 3O8BA 3RM2H 3F9EA 1O5CB 2PHBA 4K5ZA 1GCTB 2QAAA 4UDWH 3SUDA 5CMXH 1V6DA 4KTUA 4NIXA 1NN6A 2JH6D 1N6YA 4ZAEA 1O3OA 2HOBA 3F9GA 1O2ZA 3ZZ7A 2GVFA 1GDQA 3SJIA 1HAHH 2BM2A 4I33A 3TJNA 4D76A 3S9CA 1TOMH 1QNJA 1RTKA 1EKBB 4K8YA 1E0FD 2NU0E 1A2CH 4IC6A 3URDA 1OP8A 2A7HA 1ARBA 1K1PA 1TA6A 1C1NA 2GZ7A 2LPRA 2FOCA 1C1TA 3RXBA 3F9HA 1PPZA 1OYQA 1BBRK 1D4PB 3RXOA 4GUXA 1EJAA 5EW1H 2UWOA 4X6NA 1SSXA 1UVPA 2BXUH 2Z9GA 4FU8A 4UFGH 2FI4E 3A8BA 1BOQA 1T8OA 1O2LA 1UCYH 2BLVA 3O8RA 1SLWB 4YZUA 3RLWH 1YPHE 4AYVB 1O3NA 6CHAC 1D3QB 1IHTH 1O3DA 1XUKA 1JRTA 1KIGH 1BRUP 5F6MA 1GGDB 5JBAS 2ZFRH 1O35A 1A46H 2J34A 3BTDE 3H7TA 1AWFH 2R0KA 2FEQH 2ZPSA 3D65E 3STIA 1SFIA 5GWZA 1FPCH 5EU8A 3LKWA 1EZXC 1SQOA 3MWIU 2FTLE 3E0PB 3VB5A 1C5SA 4YOJA 1ELBA 1NRNH 2GCHG 1HJAC 3DHKH 3SU2A 1O2IA 1LQDB 3MYWA 1BJUA 2ZDKA 3EA7A 4B75A 2V6NA 2O8UA 1O39A 2FZZA 1O3HA 3TK9A 1ABIH 2SGQE 2DE8A 1AE8H 1BBRH 3PWBA 3PB1E 3TNSA 3AW1A 3BV9B 1QHRB 5CHAC 1ZPBA 5EW2H 3FANA 4SGAE 3EA8A 1JMOH 1PPFE 1D3DB 1C1UH 2WINI 5E0GA 2G51A 3P8FA 4ABGA 3RLYH 3AASA 5FPSA 3T27A 6LPRA 5DP7A 5HM2A 1MQ6A 3KL6A 4U2WA 1TX6A 4WMEA 1EXFA 1AY6H 2SNVA 3QO6A 4BAHB 4INLA 1LHFH 1ZHRA 1T8MA 3SU0A 1TX7A 2FLRH 3BTGE 1X7AC 3VGCB 2ZG0H 3C27B 2VH0A 1EPTC 3PTBA 1AGJA 3T28A 2ZPQA 2VIDA 1ACBE 3TH2H 1CQQA 3KHVA 1HPGA 4ABAA 3TH4H 4ISIH 4MNYA 1ZSKA 1IQEA 4MPXA 1AO5A 3OYPA 1F7ZA 1UK2A 1KLJH 1OS8A 1HAIH 1K9OE 2UUYA 3PO1B 2RG3A 4WH6A 2FS8A 3SORA 1NU9A 2H9TH 3RXSA 1GJCB 2TPIZ 1D9IA 1QBVH 1EAIA 4TY6A 4THNH 4DIIH 1PPEE 2H9EH 1ZZZA 1BZXE 1GI0A 3PMJA 1QRXA 1FZZA 1OWEA 2RA3A 5T3HA 1FIWA 1GCDA 3D23A 4FUIA 4ZHLU 1TA2A 5FCKA 3K6YA 2ZC9H 2FI5E 4IN2A 4MTBA 2D2DA 3ODDA 3SU5A 2D26C 3PMBB 1P0SH 1G2MA 2TGAA 3Q3YA 1LVMA 4DY7B 4K3JA 1DXPA 1W0YH 2EA3A 1UTMA 4I8GA 1W3CA 3A82A 1G3BA 1W10U 2Y7XA 5T6GA 2ZNKH 2GKVE 4BTIB 1EP5A 5A8XA 1FV9A 1S82A 3SN8A 4FUDA 1NU7B 2BY6X 3SGQE 1ELEE 1WUNH 1TGBA 8ESTE 1NFUA 2CF9H 1AHTH 2Z9IA 1O5DH 1XVMA 1GBEA 1PJPA 3HGNA 2B8OH 4H4FA 2C8YB 1GDUA 5EQQA 1RFNA 2AFQB 1C5OH 1V2TT 1V2UT 4B76A 1K2I1 3A81A 3KQBA 4BNRA 4DGJA 2SGFE 1VITG 3V3MA 2F9PA 1MU8B 1YPEH 3M36A 3SNBA 1D6RA 3ZZ4A 4JZEH 1O2OA 3UPEA 1TE0A 1C2JA 1ZRBA 3TPIZ 1O2VA 2BD8A 1TWXB 3V7TA 2A4OA 2WPLS 2UUJB 1E35B 4F49A 4X6MA 1XVOA 1O3GA 2ZO3H 3DUXH 2V3HH 5C67A 5C1UA 1FY4A 3ENSB 3M37A 1K1MA 1SLXB 4DIHH 3S69A 1YPLH 1THSH 4WXVA 2FX4A 3SJ8A 1Y3XA 1GBBA 5T6DA 5EPYA 2GT8A 5EGMA 4IS5A 3PROA 3MMGA 1AMHA 1HJAB 1C2EA 1DY8A 1WTHD 3TLOA 4BOHA 2BY7X 4IMZA 2GCTB 1ETRH 3UOPA 1GHBG 4FUHA 1A1RA 4KELA 1EJNA 1GBKA 2Q6FA 1XUGA 2PKAB 4Y71A 3PMHB 3W94A 2ALPA 2HPQH 5CHAB 4JMYA 1OWIA 2BQ6B 1MU6B 1K22H 2ZGHA 2AERH 2AMDA 3PLPA 1O0DH 1PPGE 1P2OA 1C5WB 3GYLB 4E06H 2BZ6H 4D9QA 2NU3E 2ZGBH 4IBLH 5A0BA 2ZDAH 3ZVGA 3M3SA 4Y10E 5JBCS 1VR1H 2PSYA 1OP0A 4UFFH 3RP2A 2SGEE 5C2ZA 3E0NB 4JYUH 1QQ4A 3TU7H 4X1SU 2HNTC 4DCDA 3D62A 2Z6BD 1NS3A 2AGIX 4ZHMU 3B8JA 3GY2A 2FYQA 4OS5A 2PR3A 5A8ZA 3QLPH 6GCHG 5FBIA 1C5ZB 1BMAA 4XSKU 1LKBA 2G4TA 4AFUA 3S9BA 4U32A 3BN9A 2VIWA 1MKWK 3TGIE 3MH5A 2AS9A 2VB0A 2HNTE 4X1PU 3ATMA 4NIYA 2PKAA 4DW2U 1KYNA 1TRMA 1JIMA 1QR3E 1DVAH 1HAXB 3UUZA 2GV7A 1XMNB 5E8EH 3BTHE 5ESTE 4E7RG 1DDJA 1KLTA 1BRBE 1IQLA 3ZVCA 1V2NT 3QX5H 3MH7A 3RM0H 2VVUA 3ESTA 1GJ5H 3U1IB 4KP0A 1MTVA 4IGDA 1V2ST 3ATWA 3MO6A 2FYRA 3OY6U 2G00A 4OS4A 1E36B 4OS6A 2PUXB 1P3CA 1MH0A 1QL7A 3SGAE 1MKWH 1INCA 2G4UA 2WPMS 1TALA 3BIUH 1GI1A 3RC6A 1L4ZA 4NG9H 1ZTLA 3T29A 1D3TB 1AFEH 1EPTA 3UWIA 2FS9A 1HJ9A 1GHYH 2AEIH 1NO9H 1THPB 4BTTB 2ANYA 3P6ZB 4KKDA 1CHOG 1P2KA 3GCHC 3S9AA 1S5SA 3ZVFA 1P2JA 1JXPA 3U8RH 3PMAB 1O3IA 3W95A 3Q3KA 1PYTC 2FOMB 3F9FA 3VXFH 4KTCA 1LVBA 1GBMA 2O8LA 3NUMA 1OOKB 1N8OC 3E16B 3F68H 4ISNA 2PFEA 3MNBA 1GHAG 3ZZBA 1DICA 3ODFA 4PROA 1C5UA 1UVOA 4AN7A 2Y81A 3A7YA 4K2YA 1YKTA 1MBQA 2ZQ1A 3ZZ6A 1DLKB 1EP6A 1T7CA 1GJBB 1GI8B 1Z8RA 2J4IA 1L1NA 1FXYA 4AGKA 1C2MA 1TABE 2HPPH 3UNRA 4ZUHA 3A89A 3BTKE 1CE5A 4NZLA 2GZ9A 1GHWH 4O97A 2I6SA 4YLQH 4JYVH 1O3PB 3MU0A 1EAXA 1VGCC 2ZU1A 3QUMP 1DT2A 3MNSA 2BXTH 4U01A 4YTAA 2OQUA 6ESTA 1KXCA 1GBIA 1ETSH 2W7UA 5E2PA 1TBRH 1C5RA 1ZHPA 4X0WU 1V2KT 1WOFA 4A92A 1XX9A 2FOAA 2TRMA 4ESTE 1UO6A 1YPJH 3ATLA 1YLDA 3Q00A 1A3EH 1S6HA 4UEHH 1C5TA 1VCPA 4Y6DA 1TNLA 2A5KA 3M5NA 3A7VA 3AVZA 4B2BA 1O2TA 3B9FH 3TK6A 1TYNA 1RD3B 4NGAH 1O36A 5G4BA 3SBKA 7KMEH 1AE5A 3QGJA 3SJKA 3LC5A 4XOJA 1GI2A 1Z71A 2A1DB 2O8MA 4XDEA 3A86A 4CH2B 3E8LA 3Q3XA 4OGXA 1MD7A 5EXMA 3K2UA 3LGWA 2A7CA 2GD4B 3BG8A 1MTSA 1BB0B 2ZCHP 5FHTA 4JK6A 5DP3A 1HAGE 1GHXH 1QRZA 2AMQA 2ZFTA 1C2GA 1O38A 4ZKSU 1LHCH 4Y76A 1HBTH 1W12U 1ZSLA 4NA9H 4I8LA 5DP4A 1TPAE 3ITIA 1O2YA 2Z94A 3H7OA 3R0FA 4MG3A 5L2YH 2WUCA 3DA9B 1MCVA 3KQCA 1W14U 2V3OH 1O37A 2ASUB 1MKXK 1J17T 4B71A 1AFQC 1CHOF 2BY9X 4NWKA 1ZHMA 5BRRE 2ZU3A 3MNXA 1OXGA 4CRDA 2BDCA 2J2UA 3UREA 1EZSC 1ZTJA 2DE9A 3RXVA 2VGCC 1TX8A 1F5LA 1BMNH 3M3VA 1IQIA 1C2DA 1ZR0A 3QDZB 4Y79A 2IN2A 4K8BA 5FPYA 1GHAF 3CP7A 3ZYEA 1SQTA 1SGIB 5FX6A 5DP6A 2ZHFH 4JZDH 1TNGA 2FWWA 1BTYA 4AFZA 4JZIA 1F0TA 3A84A 3NCLA 2A5IA 1L0ZA 3E91A 1ARCA 2FMJA 1KXDA 2A31A 2OD3B 4UE7H 1Z8GA 2BMGB 3ZV8A 3FAOA 4E05H 1Q2WA 1MKXH 1RXPA 1ID5H 4JZ1A 4CRCA 1DX5M 4Y7BA 4DT7B 5K0HA 3UNQA 4F4OC 1FY1A 2GP9B 1IQJA 4X8TH 1ZJKA 1S6FA 1AD8H 4A1XA 2F9BH 5CE1A 4A5TS 1TOCB 2QXIA 1DY9A 1O5FH 3GCHB 2TGTA 1S0QA 2RA0A 1UVTH 1Z1JA 2P3UB 1YPMH 2Z9KA 3RMNH 1QQUA 3MH6A 4YT7H 3TGKE 3RDZA 1BCUH 2ZCLP 4CRBA 4UFEH 4XBCA 2AMPA 1YCPK 5EQRA 2RDLA 4BXWA 4X6PA 3MU5A 3MHWU 1N8OB 3PWCA 4RN6A 4X2XA 5AF9H 2LNCA 3RXQA 3TJUA 3P8NA 4OS1A 1A0LA 4CBOA 4SGBE 4TWWA 1QFKH 2J9NA 1WYKA 1G3DA 1HDTH 4MNWA 2VH6A 3VB7A 2XBWA 1SOTA 1EZQA 2XBXA 2QF3A 1AZZA 2XRCA 2ZFSA 1FDPA 5K7RA 4K69A 3RMMH 3UQVA 1O2WA 1QB1A 4Q2KA 1O32A 3GY4A 2XW9A 1TIOA 3SO3A 3NWUA 1J14A 4Y0YE 1GMHG 4ZH8A 1SGPE 1KY9A 2FOBA 1F0UA 1GI9B 1EAUA 1THRH 5EOKA 3TJOA 4Y7AA 1CO7E 3ZZ5A 1VGCB 1YCPH 1SGFG 3BTEE 1SGCA 1O5GH 1G30B 1O3EA 3RXGA 2ZTZA 3S7HB 3KQDA 1O2KA 4XE4A 5IYTA 1MZDA 2PW8H 2J92A 1J15A 1GBJA 3HK6B 1V2RT 1QCPA 2ODYB 5GCHF 2ZPRA 1F0SA 1LHEH 1P2MA 3BTME 1RJXB 3K9XB 2GDEH 5LH8A 1UHBB 1TPSA 2XC0A 1K1LA 4Y11E 1V3XA 5BPEA 1GPZA 2GT7A 2BQWB 3GY3A 1F92A 3PYHA 2HVXA 3T5FH 1A0HB 1GBFA 4K1TA 1CT0E 1G36A 1SHYA 2ANKH 5HXFA 2ZGJA 1TPPA 3KCGH 4AX9H 4CRFA 3SUEA 4ISOA 2JETC 1AU8A 1K28D 4GLYA 2GGVB 3GY7A 1QGFA 3UY9A 4MVNA 1UK4A 2G52A 3FP8E 5JBBS 1AVGH 2BDAA 1BMMH 1DANH 1P8VC 3KQEA 1XUJA 3IWMA 3SI4H 5F8TA 1P06A 2F83A 1HXEH 3SZNA 4OS7A 4Y8XA 7LPRA 4MNVA 5PTPA 1FNIA 3UR9A 2Y5HA 5AHGH 2XBYA 2THFB 2QXJA 1FAXA 1SHHB 1VJ9U 1V2VT 2VIOA 2B9LA 1C1PA 1Z6JH 3BTFE 2NWNA 1CVWH 1UHBA 3FVFB 2BD3A 4INHA 1TNIA 4VGCC 3TIUA 2FTMA 1GHVH 2FPZA 1W13U 1G37A 1TQ7B 4AZ2B 1LQEA 5L30H 2ULLA 3EYDA 1P01A 3P70B 3QZRA 2GX4A 1MTNC 5JYIA 1P57B 2QIQA 2BTCE 3RXCA 3LONA 2ZP0H 3UNSA 1Y5BT 4O3UA 4CREA 1F5RA 2IOTA 2H5CA 1GJDB 1EOLA 1NZQH 3FFGA 1C1OA 2SGDE 1RS0A 1QB9A 1CGIE 1SGNE 2WPKS 3SU4A 1SL3A 3EAJA 1FPHH 1C4V2 1GVZA 1IQHA 3SNAA 1ELFA 2CF8H 5LGOA 1ZMJA 1RRKA 1IHSH 2GCHF 4NIWA 4AFQA 2CN0H 2XWAA 3QGNB 4ABJA 1TBQH 1GMHF 2ZDVH 4RKJB 1C4U2 1EX3A 2QA9E 5HGGA 2F9NA 1F2SE 3PLKA 5IDKA 4AG1A 3KGPA 3ZVAA 2YNAA 4Y0ZE 2Y5FA 3UWJH 1NROH 3L6PA 2UUFB 1EASA 1VCQA 3ZZDA 2ANMH 1GVKB 4FUEA 4TYDA 1B5GH 1QURH 5DGJA 4AFSA 3L33A 3MOCA 3M3TA 3P95A 3RXKA 1T31A 4ABEA 2BDHA 1K1NA 3GY5A 8GCHG 1DSUA 3VEQB 4GPGA 2XCFA 2QGRA 4JZFH 4FUJA 4A1TA 6CHAB 2ZGXH 3TITA 1U6QA 4NFEA 1K1JA 1WV7H 1RTLA 4BXSA 2BYAX 3GCTG 3EE0B 3LH3A 2B0FA 1XUFA 2F9OA 1NTPA 2SNWA 4ABDA 1CU1A 1HRTH 2QXGA 2BX3A 4X2WA 1E37B 1O2NA 3A8CA 1KDQB 2RCEA 5L2ZH 2HWLB 2NU2E 3BTTE 1EAWA 3AAVA 2G81E 3A7ZA 4BAKB 1H9HE 1O2XA 1C5PA 2ODQA 4B2CA 1CSOE 3Q76A 4HZHA 3ZVEA 3KNXA 5JBTA 2KAIA 3ZZAA 3IG6B 3SV7A 2OP9A 1GWAA 2ZDNA 1QJ7B 1PPCE 2QY0B 3A7XA 1BDAA 4WMDA 3M61U 1BTPA 2TIOA 1ZPZA 5DP5A 1PQ7A 2A7JA 2VINA 7GCHG 1QJ6B 3KEEA 1SOZA 1UMAH 5TCAA 5E0HA 2TGPZ 2FODA 2CV3A 4UFDH 3A85A 4A1VA 2ZFFH 1V2JT 3ZZCA 5AFZH 2BLOA 2C93B 3STJA 2IJOB 3GY8A 1FIZA 4ASHA 3HKJB 4RSPA 3ELAH 3U98H 4U30A 1P02A 1O3BA 2FI3E 1AKSA 2XBVA 5I46H 2P3FH 1BTHH 1LPKB 2ZFPH 4MDSA 3RUOA 3VB3A 4OS2A 2G5VA 2OC1A 1DFPA 2P16A 2ZQ2A 3AW0A 1ELDE 1XKAC 1IQGA 1KDQA 1GL1A 1GJAB 1A3BH 1EPTB 1ELAA 2C8WB 1O30A 2BZAA 2JETB 2WUBA 4B74A 3PV4A 2BVRH 1HNEE 1TMBH 3UFAA 2STAE 2R2MB 1IOEA 2D1JA 1UVSH 2CGAA 2FOFA 1C9PA 3SV9A 3T2NA 1VCWA 4FUGA 3RMOH 3ZZ8A 4ISHH 2YOLA 3MO3A 1O33A 1Y5AT 1KLIH 1Y8TA 4KTSA 4YESB 5C20A 1ELVA 1H8DH 2BD4A 3SJ9A 1BITA 1YCPM 1VITF 2Z9LA 4K60A 1J8AA 3SNDA 9ESTA 1KTTB 2F91A 4O03A 1BRAA 2EI6A 4I8KA 1SQAA 1S81A 4X1RU 1O5AB 2VVVA 3CS0A 4KGAA 1Z8IB 2FOEA 4I7YH 1DSTA 1EJMA 1AB9C 1SC8U 1Y59T 1O2HA 4VGCB 4FUBA 2OCVB 1W0ZU 1ZMLA 1QTFA 4X6OA 1H9LB 1FY8E 8GCHF 4B1TA 3EQ0H 1Y3UA 5A8YA 1DE7H 2AIQA 1HV7A 4MPWA 2VWMA 2JKHA 1MTNB 2P93A 4X8SH 3ZVBA 1Z7KA 5HMAA 2XWBI 4FVDA 1O2QA 5GXPA 2PTCE 1WQSA 3ZZ9A 4BAOB 3T62A 3U69H 1GCTC 2FM2A 3GCTF 3LPRA 1HAVB 4H6TA 2ZI2H 1HCGA 3V0XA 3FZZA 1L1JA 2HLCA 3GCNA 4HI3A 1QB6A 5JPMH 3L3TA 4X2VA 1LHGH 1BTUA 1TONA 1ZTKA 3QTOH 3SU6A 1ANBA 4MPVA 4YOGA 1AQ7A 1XUHA 3T26A 1PQ8A 3QZQA 5DKMA 1C2LA 1SR5C 5GIBA
chains in the Genus database with same CATH superfamily
1CBWC 5HYOA 2ANWA 5EPNA 5I25A 3I77A 3M5LA 2BHGA 4GAWA 2XNIA 2AGGX 4ZMAH 2NU4E 1E34B 1GHBF 3LT3A 4E7NA 3FN8A 1OSSA 1O31A 2GDDA 2XTTB 2B5TB 1ZPCA 2QN5T 1AZ8A 2PKSC 4Q7ZA 2FIRH 1MAYA 4ZROA 2I6QA 4ZKNU 1TRNA 2XOKD 1GBAA 1NM6A 2OC0A 3EDXB 2ZKSA 3LJOA 1P9SA 1HAOH 3SGBE 3FZDA 1PYTD 2Y82A 3GDVA 2VIVA 3JZ1B 1NFYA 1MMJN 3EGKH 2BQ7B 1C5XB 2GV6A 1DWEH 2KCYA 1ORFA 5C3NA 3M7UA 3BTWE 3PRDA 2Z9JA 5B6LA 5DPAA 1DUEA 5A0CA 1HAVA 1KSNA 3GCOA 2PWXA 3AK5A 1EFRD 5ETXA 4WMFA 2PTNA 4F55A 3FP6E 6GCHF 1HUTH 1KXAA 1V2OT 2C90B 4J2YB 4YLUA 3MO9A 3SUFA 2JJ1D 1NY22 2BD7A 2P8OC 1ABJH 2XXLA 1HXFH 1XXDA 2F3CE 2TBSA 1B0FA 1DLEA 2BB4A 2P3TB 3KYGA 4ISLA 3U1JB 5HKKD 1BTZA 1DPOA 4DJZB 3MU8A 5AVDA 1MTWA 1EUFA 4K1SA 4LXBH 1O2JA 3WWFA 1UTLM 2QC2A 1DXWA 3BF6H 1H1BA 1P05A 1RGQA 3H09A 5FL7D 3VXEH 1MTUA 4BAMB 2ZU5A 1ZLRA 3FO8D 3M7QA 1H4WA 3QK1A 2A4QA 3BEIB 4O9VA 1TNJA 3GOVB 1FMGA 2H9HA 2H6MA 3MTYA 1NRQH 4OGYA 2A45B 4WVPE 3RXEA 2ZU2A 1AIXH 1EZUC 1UK3A 2Q6DA 3DFLA 5FCRA 4WXIA 2WV9A 1DS2E 8KME2 2K1QA 4IC5A 1YPGH 1O2PA 1PFXC 2ZEBA 2BX4A 4D8NA 3LGUA 4XRNA 1G32B 1UJ1A 1HYLA 1W8BH 2QF0A 2J5UA 1GJ4H 1UTKA 2ZHDA 4ZKRU 3SQHE 2QYIA 4Y8YA 4I32A 3P17H 1GMCG 1RIWC 5EXNA 4LZ1H 4NIVA 4FU7A 1ZYOA 3K6ZA 2G5NA 1YY3A 4X8VH 1MABB 3OSYA 5EODA 1OWKA 4AB9A 3NPSA 2JDID 1O5BB 4B73A 5A0AE 1L2EA 2ZGCA 4Q63A 3LGTA 2Y80A 1O2RA 2CXVA 1P2NA 2V3MA 2AH4X 3TJVA 1L1GA 1S83A 3U8OH 1NBME 4NCYA 1TBZH 1C1RA 3OX7U 2FDAA 3P8OA 1C1QA 2A5AA 1NBMD 1WU1A 3UQOA 4WJG2 2VIQA 3LIWA 4K1EA 1MBMA 1W0KD 3A88A 1FONA 4AOQA 1NFWA 5GPIB 4X8UH 2R9PA 2BVSH 2SGAA 2AGEX 1C5QA 5E0JA 1FLEE 1Y3WA 2FP7B 2UUKB 4D7GA 1TGCA 9LPRA 4QT8C 2OTVA 1SGYE 4DG4A 1HAZB 8LPRA 1HAPH 2Z3CA 4R8TB 2XCNA 3OAAD 2GZ8A 1GJ9B 5L6NH 2J38A 3PV5A 4R0IA 2ALVA 1UTOA 1BMLA 3SNEA 1TMUH 4XBBA 1O3MA 2UWLA 1FY5A 2OINA 3HPTB 1BIOA 4M9FA 5JB8S 1O3JA 1PPHE 1ESBA 1BT7A 1JBUH 3O8DA 2ZECA 3MU4A 5DK1A 2CHAC 3N99A 4MNXA 1A4WH 3LGVA 1GMDG 3H5CB 2HLDD 1MD8A 1O3FA 1LPGB 2VIPA 2A0QB 4JYTA 1YPHC 3SV6A 2PV9B 3LDXH 3GICB 2XC4A 1CBWB 4MPUA 1Z8JB 1C1WH 1WXRA 2HALA 1VITH 1GBCA 3A7WA 1P03A 3S0NA 1A7SA 1BRCE 1VJAU 1SVPA 1BMFD 2PKSB 1Y3YA 2XC5A 2ZZUH 1KXBA 1JIRA 2OBOA 2EEKA 1IAUA 1WAYB 1P09A 2EC9H 3CNRA 4GHQA 3RXHA 1NC6A 1TB6H 1N6XA 1O3KA 1FJSA 1K21H 1SMFE 5LPRA 2BOHB 3S7KB 3OY5U 1A5IA 2QV1A 1K1IA 4IN1A 1P2QA 3CENA 1TNKA 2SFAA 1H9IE 2VWOA 1P9UA 2CJIA 1G3EA 3SNCA 4ZXYH 1OHHD 2PUQH 3U8TH 1V2QT 1GJ7B 3HKIB 2FXRA 5TCCA 5C1XA 1TNHA 3A8DA 3OE7D 5FPTA 1PQ5A 1GMCF 3RXFA 1O2GH 2GCTC 2OC8A 1VKYA 1QA7A 1YGCH 4IW4E 2EQNA 2P8OB 1EOJA 2VVCA 3ZVDA 1W7XH 1ANDA 3E6PH 2B7DH 1WDIA 2KX4A 1SGEE 1Z1IA 2IPHA 2NU1E 4ABHA 3DSPA 1JRSA 4J1YA 1XKBC 2FOGA 2ZCKP 1LMWB 3N7OA 1SGQE 3LH1A 3SOSA 4JK5A 4CR5A 1LVOA 4ZKOU 3RXDA 3FP7E 1GI6A 3SJOA 2ZHEH 2BD5A 2BY5X 4AORA 1NESE 4ABFA 5A2MH 2Z3DA 1SPJA 1V2WT 3MH4A 3KN2A 2G8TA 4MLFB 2KR7A 3QN7A 1KXEA 2Y6TA 2O8WA 2G55A 1TRYA 2GMTC 1AVXA 1S0RA 4CHAC 2ILNA 5F03A 1ZOMA 2EI7A 4FUFA 3NKKA 4ACBA 1QBOA 2GTBA 2J95A 1GI4A 2Q1JA 1QBNA 3RXPA 4YO9A 1C5NH 4INKA 1E1QD 1T32A 2FO9A 2P94A 4FVBA 1RIWB 3M35A 1SGRE 4BANB 1GI7B 4BTUB 2VU8E 1S84A 1AFQB 5FXLA 1EQ9A 2OQ5A 2PSXA 3MI4A 3DFJA 4I8HA 1LKAA 1PQAA 2KM0A 1LDTT 3NK8A 3OTJE 3VFEA 1GMDF 1BUIA 3TH3H 5SGAE 1HJ8A 2VGCB 2H1UA 3O8CA 1A5HA 3BSQA 2R0LA 4NA7A 3RC4A 3I78A 3RXRA 4TWYA 2L74A 2VWLA 2OLGA 4YM9A 1Q3XA 4M7GA 2UWPA 1YLCA 2VWNA 1ESTA 1FN8A 1O34A 2R2WU 1TAWA 1O3AA 4GCHG 1NRRH 1YF4A 1SI5H 2AYWA 3BG4C 3MU1A 4H42U 2ZA5A 5J4SA 3KYFA 4YT6H 3GYMA 4FUCA 4I31A 4DVAU 1XUIA 4RT0A 1UTJA 2AIPA 4TPIZ 1OX1A 4ZHAA 1BHXF 3RXAA 2FX6A 1DM4B 2F9VA 3WY8A 1SGDE 1T4VH 1T8NA 2W26A 4XFQA 3OU0A 1FUJA 5GDSH 1UVUH 1W2KH 3DSOA 3SU3A 1D3PB 2LELA 2V35A 3RU4T 3V13A 1YYY1 2KAIB 1O2UA 2BLQA 1S85A 3HATH 4Z0KA 2D8WA 2WPJS 1ZGIA 3B23B 3LC3A 1C2FA 1LPZB 5H4IB 3KIDU 1QA0A 2A4GA 4ABBA 1SLVB 2VJ1A 2CHAB 1HIAB 3SV8A 2ZIQH 5F8XA 1ETTH 2BVXH 3F1SB 1FQ3A 2V0BA 1YBWA 5EJLA 2W5EA 1G2LA 2H5DA 3AAUA 2QCYA 4NFFA 4XBDA 4GSOA 1GI3A 1ELTA 3F6UH 1SLUB 1Y3VA 1NPMA 3P8GA 1GBTA 1IQFA 1AKSB 1KTSB 3E3TA 2C3SA 4ZXXH 2Z7FE 3LU9B 3SHAH 1YP9A 4TPYA 1E38B 1P11E 2F9UA 5JB9S 1OWDA 1T8LA 1CA0C 1J16A 1DUAA 1UTNA 1NFXA 1NRPH 4I86A 3ATIA 1FI8A 5T6FA 5EXLA 4NSYA 2CMYA 3LGYA 3U28C 1FAKH 1J9CH 2WV4A 2O9QA 3ZIAD 4TY7A 1GHZA 1KXFA 4FXGH 1EB1H 2Z3EA 1TLDA 2ZHWH 3C1KA 2FOHA 4AGJA 2KZ4A 2M2AA 3U9AH 3SI3H 5EG4A 3PLBA 5B6OA 1TMTH 1P10A 1OYTH 1HIAA 2BLWA 1IQKA 1ZSJA 1C2IA 3DD2H 2WYGA 2ODPA 4FU9A 4WY3A 5DO4H 1CHGA 3PTNA 1WTGH 1AUTC 4A7IB 1GG6C 1OKXA 1BTWA 1AWHB 5ABWA 2SGPE 3NXPA 2FESH 2ZWLH 2OC7A 1UCYE 1C4Y2 1MUEB 2BD9A 5HM9A 3LJJA 1A61H 3G01A 2J94A 3RU4E 3E90B 1BHXB 1A5GH 2XNDD 3RU4D 3URCA 3SQEE 1DWBH 1W7GH 1GVLA 2BY8X 1SKYE 3T25A 2R3UA 4Y8ZA 1H8HD 3BIVH 3TNTA 1C2KA 4GCHF 4GHTA 5AFYH 3ZZ3A 1TGNA 3OEED 1TQ0B 1ELGA 3RXIA 3WW7A 3A87A 5F8ZA 1SGTA 5JDUB 1L4DA 1CT2E 5C5NA 2GMTB 4CHAB 4Q80A 1BBRE 1ANEA 1HAYB 1LVYA 1G9IE 1QJ1B 1QY6A 2XYAA 3SW2B 1WBGB 2OBQA 4B6EA 1YLNA 3W1EA 4LK4A 1BA8B 5EQSA 4HGCA 4HTCH 5A09A 2QE7D 1OWHA 1D6WA 1DITH 1FN6A 5DJ7A 1O5EH 7ESTE 5LPFA 1C5VA 2PGBB 1O3CA 1GDNA 1BJVA 1C1SA 1OP2A 1RTFB 5GJ4B 1QRWA 4D9RA 5LPEA 3TK5A 4D7FA 4CR9A 3GDUA 3P92A 3VPKA 3JZ2B 1WCZA 1K1OA 4O3TA 1LCYA 1GBLA 4AB8A 1YM0A 4RI0A 1C5YB 4X2YA 4CBNA 3BG4B 1TPOA 2Y7ZA 1TFXA 5DP8A 4NSVA 1HFDA 2VNTA 1SGFA 1C1MA 4DURA 3MFJA 3HGPA 3DT0H 4NA8A 1V2LT 2WYJA 4MQAA 3D49H 1BTXA 2TGDA 2C8ZB 1C1VH 2ZDLA 4CRAA 1P12E 2ZTYA 3BEUA 2ESTE 4X1QU 3GY6A 2ZHQH 1G3CA 2ZU4A 3RXTA 1QIXB 4Q7XA 4HFPB 1ZRKA 2HNTF 2YNBA 1DWCH 4DOQA 1LTOA 1NT1A 2A2XH 1P3EA 2W7SA 2PGQB 3K65B 3A8AA 4LZ4B 7GCHF 4NZQA 3BTQE 5ESBA 2L6OA 4JCNA 4RKOB 1GJ8B 1Y5UT 5J4QA 1XXFA 3CS7A 2H2ZA 1V2PT 2C4FH 1LO6A 1GGDC 2BDYA 1GI5A 1C9TA 3IITA 2BDIA 3E1XB 1O3LA 3NZIA 2ZF0H 1MAXA 1SFQB 1YC0A 1O2MA 2Y5GA 3WWBA 1B7XB 2J98B 1TGTA 1DWDH 1M9UA 3RXMA 3M7TA 1HB0B 5FAHA 1SBWA 2Q6GA 3RXLA 1CA0B 5C1YA 5C0UA 3RMLH 4ACAA 1XM1A 1ZGVA 4Q7YA 2BDBA 5E2OA 2WPIS 1C5MD 1T4UH 2BD2A 2OXSA 5FBEA 1SB1H 3V12A 1F5KU 1DOJA 3A83A 3Q77A 1JOUB 3UTUH 3SV2H 3GISB 4LOYH 1AN1E 2JJ2D 1O2SA 1ZJDA 2LP6A 5CDFE 3RC5A 1WQVH 4Z6AH 5C0TA 1ELCA 1EATA 1A0JA 1MCTA 2STBE 3GDSA 3UIRA 1UTPA 1MQ5A 2P59A 1CGJE 4AYYB 1BQYA 1QL8A 1HGTH 3TGJE 2BOKA 1CT4E 3N7EA 3PM3A 4CH8B 4IMQA 1GBHA 1GBDA 2AHME 1WSSH 4WH8A 2A32A 4CRGA 3I29A 3QWCH 5C5OA 3SU1A 3LGIA 1SG8B 1GG6B 2W3IA 3M5MA 1GL0E 1VZQH 3VGCC 5TJXA 3QTVH 4ABIA 1PPBH 3R3GB 1YPKH 1AVWA 2EI8A 1W0JD 2J98A 2M5TA 2WPHS 1AUJA 3SUGA 2P95A 1F0RA 2W3KA 2ZFQH 1Q31A 1OWJA 1EB2A 2R3YA 2JH5D 2DUCA 2ZTXA 2O8TA 3ZYDA 1OPHB 3KF2A 2HGTH 3MNCA 4WWYA 3ZV9A 1ANCA 1N1LA 5DG6A 3PO1C 2WV5A 4X1NU 4GVUA 2A4RA 3SHCH 1MZAA 5DP9A 4UONA 2FLBH 5FX5A 1Z6EA 1AI8H 3FOAA 3ATKA 3UOUA 2JH0D 4AG2A 3VB4A 1P2IA 1CA8B 1ESAA 1FY3A 4YOIA 4WF8A 4NWLA 5GCHG 2OUAA 1P04A 3UR6A 1GJ6A 4UD9H 1C5LH 1CGHA 1C2HA 1HLTH 4A6LA 1QL9A 3LOXA 3SZEA 3BEFB 1JWTA 4H6SB 1UTQA 4I8JA 2HRVA 4B2AA 4BAQB 3A7TA 1AB9B 3VB6A 2PLXA 2ZDMA 1W11U 3TVJB 5DN6D 3RXUA 3HK3B 3A80A 1TGSZ 1H8IH 2A2QH 1NRSH 1V2MT 1ZMNA 3M5OA 1IQMA 2CK3D 1IQNA 2C8XB 1LHDH 1B0EA 2QXHA 2BDGA 3EA9A 1UCYK 3RXJA 3O8BA 3RM2H 3F9EA 1O5CB 2PHBA 4K5ZA 1GCTB 2QAAA 4UDWH 3SUDA 5CMXH 1V6DA 4KTUA 4NIXA 1NN6A 2JH6D 1N6YA 4ZAEA 1O3OA 2HOBA 3F9GA 1O2ZA 3ZZ7A 2GVFA 1GDQA 3SJIA 1HAHH 2BM2A 4I33A 3TJNA 4D76A 5KECA 3S9CA 1TOMH 1QNJA 1RTKA 1EKBB 4K8YA 5C94A 1E0FD 2NU0E 1A2CH 4IC6A 3URDA 1OP8A 2A7HA 1ARBA 1K1PA 1TA6A 1C1NA 2V7QD 2GZ7A 2LPRA 2FOCA 1C1TA 3RXBA 3F9HA 1PPZA 1OYQA 1BBRK 1D4PB 3RXOA 4GUXA 1EJAA 5EW1H 2UWOA 4X6NA 1SSXA 1UVPA 2BXUH 2Z9GA 4FU8A 4UFGH 2FI4E 3A8BA 1BOQA 1T8OA 1O2LA 1UCYH 2KCOA 2BLVA 3O8RA 1SLWB 4YZUA 3RLWH 1YPHE 4AYVB 1O3NA 6CHAC 1D3QB 1IHTH 1O3DA 1XUKA 1JRTA 1KIGH 1BRUP 5F6MA 1GGDB 5JBAS 2ZFRH 1O35A 1A46H 2J34A 3OTPA 3BTDE 3H7TA 1AWFH 2R0KA 2FEQH 2ZPSA 3D65E 3STIA 1SFIA 5GWZA 1FPCH 4YXWD 5EU8A 3LKWA 1EZXC 1SQOA 3MWIU 2FTLE 3E0PB 3VB5A 1C5SA 4YOJA 1ELBA 1NRNH 2GCHG 3OEHD 1HJAC 3DHKH 3F2FA 4AC9A 3SU2A 1O2IA 1LQDB 3MYWA 1BJUA 1E79D 2ZDKA 3EA7A 4B75A 2V6NA 2O8UA 1O39A 2FZZA 1O3HA 3UB0A 3TK9A 1ABIH 2SGQE 2DE8A 1AE8H 1BBRH 3PWBA 3F3BA 3PB1E 3TNSA 3AW1A 3BV9B 1QHRB 5CHAC 1ZPBA 5EW2H 3FANA 4SGAE 3EA8A 1JMOH 1PPFE 1D3DB 1C1UH 2WINI 5E0GA 2G51A 3P8FA 4ABGA 3RLYH 3AASA 5FPSA 3T27A 4XD7D 6LPRA 5DP7A 5HM2A 1MQ6A 3KL6A 4U2WA 1TX6A 4WMEA 1EXFA 1AY6H 2SNVA 3QO6A 4BAHB 4INLA 1LHFH 1ZHRA 1T8MA 3SU0A 1TX7A 2FLRH 3BTGE 1X7AC 3VGCB 2ZG0H 3C27B 2VH0A 1EPTC 3PTBA 1AGJA 1KMHB 2QF4A 3T28A 2YMSC 2ZPQA 2VIDA 1ACBE 3TH2H 1CQQA 3KHVA 1HPGA 5HIYA 4ABAA 3TH4H 4ISIH 4MNYA 1ZSKA 1IQEA 2WPDD 4MPXA 1UW7A 1AO5A 3OYPA 1F7ZA 1UK2A 1KLJH 2IPQX 1OS8A 1HAIH 1K9OE 2UUYA 3PO1B 2RG3A 4WH6A 2FS8A 3SORA 1NU9A 2H9TH 3RXSA 1GJCB 2TPIZ 1D9IA 1QBVH 1EAIA 4TY6A 4THNH 4DIIH 1PPEE 2H9EH 1ZZZA 1BZXE 1GI0A 3PMJA 1QRXA 1FZZA 1OWEA 2RA3A 5T3HA 1FIWA 1GCDA 3D23A 4FUIA 4ZHLU 1TA2A 5FCKA 3K6YA 2ZC9H 2FI5E 4IN2A 4MTBA 2D2DA 3ODDA 3SU5A 2D26C 3PMBB 1P0SH 1G2MA 2TGAA 3Q3YA 1LVMA 4DY7B 4K3JA 1DXPA 1W0YH 2EA3A 1UTMA 4I8GA 1W3CA 3A82A 1G3BA 1W10U 2Y7XA 5T6GA 2ZNKH 2GKVE 4BTIB 1EP5A 5A8XA 1FV9A 1H8ED 1S82A 3SN8A 4FUDA 1NU7B 2BY6X 3SGQE 1ELEE 1WUNH 1TGBA 8ESTE 1NFUA 2CF9H 1AHTH 2Z9IA 1O5DH 1XVMA 1GBEA 1PJPA 3HGNA 2B8OH 4H4FA 2C8YB 1GDUA 5EQQA 1RFNA 2AFQB 1C5OH 1V2TT 1V2UT 2K0QA 4B76A 1K2I1 3A81A 3KQBA 4BNRA 4DGJA 2SGFE 1VITG 3V3MA 2F9PA 1MU8B 1YPEH 3M36A 3SNBA 1D6RA 2F4LA 3ZZ4A 4JZEH 2GJGA 2J97A 1O2OA 3UPEA 1TE0A 1C2JA 1ZRBA 3TPIZ 1O2VA 2BD8A 1TWXB 3V7TA 2A4OA 2WPLS 2UUJB 1E35B 4F49A 4X6MA 1XVOA 1O3GA 2ZO3H 2QF5A 3DUXH 3MQKC 2V3HH 5C67A 5C1UA 1FY4A 3ENSB 3M37A 1K1MA 2K8IA 1SLXB 4DIHH 3S69A 1YPLH 1THSH 4WXVA 2FX4A 3OFND 3SJ8A 1Y3XA 1GBBA 5T6DA 5EPYA 1SQRA 2GT8A 5EGMA 4IS5A 3PROA 3MMGA 1AMHA 1HJAB 1C2EA 4FOUC 1QZ8A 1DY8A 1WTHD 3TLOA 4BOHA 2BY7X 4IMZA 2GCTB 1ETRH 3UOPA 3NRLA 1GHBG 4FUHA 1A1RA 4KELA 1EJNA 1GBKA 2Q6FA 1XUGA 2PKAB 4Y71A 3PMHB 3W94A 2ALPA 2HPQH 5CHAB 4JMYA 1OWIA 2BQ6B 1MU6B 1K22H 2HVYB 2ZGHA 2AERH 2AMDA 3PLPA 1O0DH 1PPGE 5HIZA 1P2OA 1C5WB 3GYLB 4E06H 2BZ6H 4D9QA 2NU3E 2ZGBH 4HG6A 4IBLH 5A0BA 2ZDAH 3ZVGA 3M3SA 4Y10E 5JBCS 1VR1H 2PSYA 1OP0A 2RDEA 4UFFH 3RP2A 2SGEE 5C2ZA 3E0NB 4JYUH 1QQ4A 3TU7H 4X1SU 2HNTC 4DCDA 3D62A 2Z6BD 1NS3A 2AGIX 4ZHMU 3B8JA 3GY2A 2FYQA 4OS5A 2PR3A 5A8ZA 3QLPH 6GCHG 2IJD1 5FBIA 1C5ZB 2YMSB 1BMAA 4XSKU 1LKBA 2G4TA 4AFUA 3S9BA 4U32A 3BN9A 2VIWA 1MKWK 3TGIE 3MH5A 2AS9A 2VB0A 2HNTE 1COWD 4X1PU 3ATMA 4NIYA 2PKAA 4DW2U 1KYNA 1TRMA 1JIMA 1QR3E 4TT3D 1DVAH 1HAXB 3UUZA 2GV7A 1XMNB 5E8EH 3BTHE 5ESTE 4E7RG 1DDJA 1KLTA 1BRBE 1IQLA 3F2GA 3ZVCA 1V2NT 3QX5H 3MH7A 3RM0H 2VVUA 3ESTA 1GJ5H 3U1IB 4KP0A 1MTVA 4IGDA 1V2ST 3ATWA 3MO6A 2FYRA 3OY6U 2G00A 4OS4A 1E36B 4OS6A 3EE7A 2PUXB 1P3CA 1MH0A 1QL7A 3SGAE 1MKWH 1INCA 2G4UA 2WPMS 1TALA 3BIUH 1GI1A 3RC6A 1L4ZA 4NG9H 1ZTLA 3T29A 5KEDA 1D3TB 1AFEH 1EPTA 3UWIA 2FS9A 1HJ9A 1GHYH 2AEIH 1NO9H 1THPB 2VBCA 3VG8A 4BTTB 2ANYA 3P6ZB 4KKDA 1CHOG 1P2KA 3GCHC 3S9AA 1S5SA 3ZVFA 1P2JA 1JXPA 3U8RH 3PMAB 5DSFA 1O3IA 3W95A 3Q3KA 1PYTC 2FOMB 3F9FA 3VXFH 4KTCA 1LVBA 1GBMA 2O8LA 3NUMA 1OOKB 1N8OC 3E16B 3F68H 4ISNA 2W6JD 2PFEA 3MNBA 1GHAG 4TSFD 3ZZBA 1DICA 3ODFA 4PROA 1C5UA 1UVOA 5KGOA 2PP6A 4AN7A 2Y81A 3A7YA 4K2YA 1YKTA 1MBQA 2ZQ1A 3ZZ6A 1DLKB 2OK5A 1EP6A 1T7CA 1GJBB 1GI8B 1Z8RA 2J4IA 1L1NA 1FXYA 4AGKA 1C2MA 1TABE 2HPPH 3UNRA 4ZUHA 3A89A 3BTKE 1CE5A 4NZLA 2GZ9A 1GHWH 4O97A 2I6SA 4YLQH 4JYVH 1O3PB 3MU0A 1EAXA 1VGCC 2ZU1A 4ZCNA 3QUMP 1DT2A 3MNSA 2BXTH 4U01A 3F0OA 4YTAA 2OQUA 6ESTA 1KXCA 1GBIA 1ETSH 2W7UA 5E2PA 1TBRH 1C5RA 1ZHPA 4X0WU 1V2KT 1WOFA 4A92A 1XX9A 2FOAA 2TRMA 4ESTE 1UO6A 1YPJH 3ATLA 1YLDA 3Q00A 1A3EH 1S6HA 4UEHH 1C5TA 1VCPA 4Y6DA 1TNLA 2A5KA 3M5NA 3A7VA 3AVZA 4B2BA 1O2TA 3B9FH 3TK6A 1TYNA 1RD3B 4NGAH 1O36A 5G4BA 3SBKA 7KMEH 1AE5A 3QGJA 3SJKA 3LC5A 4XOJA 1GI2A 1Z71A 2A1DB 2O8MA 4XDEA 3A86A 4CH2B 3E8LA 3Q3XA 4OGXA 1MD7A 5EXMA 3K2UA 3LGWA 2A7CA 2GD4B 3BG8A 1MTSA 4DT4A 1BB0B 2ZCHP 5FHTA 4JK6A 5DP3A 1HAGE 1GHXH 1QRZA 2AMQA 2ZFTA 5GNDA 1C2GA 1O38A 4ZKSU 1LHCH 4Y76A 1HBTH 1W12U 1ZSLA 4NA9H 4FETA 4I8LA 5DP4A 1TPAE 3ITIA 1O2YA 2Z94A 3H7OA 3R0FA 4MG3A 5L2YH 2WUCA 3DA9B 1MCVA 3KQCA 1W14U 2V3OH 1O37A 2ASUB 1MKXK 1J17T 4B71A 5C17A 1AFQC 1CHOF 2BY9X 4NWKA 1ZHMA 5BRRE 2ZU3A 3MNXA 4OM9A 1OXGA 4CRDA 2RFKC 2BDCA 2J2UA 3UREA 1EZSC 1ZTJA 2DE9A 3RXVA 2VGCC 1TX8A 1F5LA 1BMNH 3M3VA 1IQIA 1C2DA 1ZR0A 1S6LA 3QDZB 4Y79A 2IN2A 4K8BA 5FPYA 1GHAF 3CP7A 3ZYEA 1K0HA 1SQTA 1SGIB 5FX6A 5DP6A 2ZHFH 4JZDH 1TNGA 2FWWA 1BTYA 4AFZA 4JZIA 1F0TA 3A84A 3NCLA 2A5IA 1L0ZA 3E91A 1ARCA 2FMJA 1KXDA 2A31A 2OD3B 4UE7H 1Z8GA 2BMGB 3ZV8A 3FAOA 4E05H 1Q2WA 1MKXH 1RXPA 1ID5H 4JZ1A 4CRCA 1DX5M 4Y7BA 4DT7B 5K0HA 3UNQA 4F4OC 1FY1A 2GP9B 1IQJA 4X8TH 1ZJKA 1S6FA 1AD8H 4A1XA 2F9BH 4P02A 5CE1A 4A5TS 1TOCB 2QXIA 1DY9A 1O5FH 3GCHB 2TGTA 1S0QA 2RA0A 1UVTH 1Z1JA 2P3UB 1YPMH 2Z9KA 3RMNH 1QQUA 3MH6A 4YT7H 3PV2A 3TGKE 3RDZA 1BCUH 2ZCLP 4CRBA 4UFEH 4XBCA 2AMPA 1YCPK 5EQRA 2RDLA 4BXWA 4X6PA 3MU5A 3MHWU 1N8OB 3PWCA 4RN6A 4X2XA 5AF9H 2F43B 2LNCA 3RXQA 3TJUA 3P8NA 4OS1A 1A0LA 4CBOA 4SGBE 4TWWA 1QFKH 2J9NA 1WYKA 1G3DA 1HDTH 4MNWA 2VH6A 3VB7A 2XBWA 1SOTA 1EZQA 2XBXA 2QF3A 1AZZA 2XRCA 2ZFSA 1FDPA 5K7RA 4K69A 3RMMH 3UQVA 1O2WA 1QB1A 4Q2KA 1O32A 3GY4A 2XW9A 1TIOA 3SO3A 3NWUA 1J14A 4Y0YE 1GMHG 4ZH8A 1SGPE 5CHBA 1KY9A 2FOBA 1F0UA 3PRBA 1GI9B 1EAUA 1THRH 5EOKA 3TJOA 4Y7AA 1CO7E 3ZZ5A 1VGCB 1YCPH 1SGFG 3BTEE 1SGCA 1O5GH 5F53A 1G30B 1O3EA 3RXGA 2ZTZA 3S7HB 3KQDA 1O2KA 4XE4A 5IYTA 1MZDA 2PW8H 2J92A 4B6FA 5EJ1A 1J15A 1GBJA 3HK6B 1V2RT 5EIYA 1QCPA 2ODYB 3GS9A 5GCHF 2ZPRA 1F0SA 1LHEH 1P2MA 3BTME 1RJXB 3K9XB 2KFWA 2GDEH 5LH8A 1UHBB 1TPSA 2XC0A 1K1LA 4Y11E 1V3XA 5BPEA 1GPZA 2GT7A 2BQWB 3GY3A 1F92A 3PYHA 2HVXA 3UAIC 3T5FH 1A0HB 1GBFA 4K1TA 1CT0E 1G36A 1SHYA 2ANKH 5HXFA 2ZGJA 1TPPA 3KCGH 4AX9H 4CRFA 3SUEA 4ISOA 2JETC 1AU8A 1K28D 4GLYA 2GGVB 3GY7A 1QGFA 3UY9A 4MVNA 1UK4A 2G52A 3FP8E 5JBBS 1AVGH 2BDAA 1BMMH 1DANH 1P8VC 3KQEA 1XUJA 3IWMA 3SI4H 5F8TA 1P06A 2F83A 1HXEH 3SZNA 4OS7A 4Y8XA 7LPRA 3DSGA 4MNVA 5PTPA 1FNIA 3UR9A 2Y5HA 5AHGH 2XBYA 2THFB 2YMSD 3SYJA 2QXJA 1FAXA 1SHHB 1VJ9U 1V2VT 2VIOA 2B9LA 1C1PA 1Z6JH 3BTFE 2NWNA 1CVWH 1UHBA 3FVFB 2BD3A 4INHA 1TNIA 4VGCC 3TIUA 2FTMA 1GHVH 2FPZA 1W13U 1G37A 1TQ7B 4AZ2B 1LQEA 5L30H 2ULLA 3EYDA 1P01A 3P70B 3QZRA 2GX4A 2KCPA 1MTNC 5JYIA 1P57B 2QIQA 2BTCE 3RXCA 2WHXA 2ZP0H 3LONA 3UNSA 1Y5BT 4O3UA 4CREA 1F5RA 2IOTA 2H5CA 1GJDB 1EOLA 1NZQH 3FFGA 1C1OA 2SGDE 1RS0A 4P00A 1QB9A 1CGIE 1SGNE 2WPKS 3SU4A 1SL3A 3EAJA 1FPHH 1C4V2 1GVZA 1IQHA 3SNAA 1ELFA 2CF8H 5LGOA 1ZMJA 1RRKA 1IHSH 2GCHF 4NIWA 4AFQA 2CN0H 2XWAA 3QGNB 4ABJA 1TBQH 1GMHF 2ZDVH 4RKJB 1C4U2 1EX3A 2QA9E 5HGGA 4Q4LA 2F9NA 1F2SE 3PLKA 5IDKA 4AG1A 3KGPA 5IK2D 3ZVAA 2YNAA 4Y0ZE 2Y5FA 3UWJH 1NROH 3L6PA 2UUFB 1EASA 1VCQA 3ZZDA 2ANMH 1GVKB 4FUEA 4TYDA 1B5GH 1QURH 5DGJA 4AFSA 3L33A 3MOCA 3M3TA 3P95A 3RXKA 1FX0B 1T31A 4ABEA 2BDHA 1K1NA 3GY5A 5EJZA 8GCHG 1DSUA 3VEQB 2WZQA 4GPGA 2XCFA 2QGRA 4JZFH 4FUJA 4A1TA 6CHAB 2ZGXH 3TITA 1U6QA 4NFEA 1K1JA 1WV7H 1RTLA 4BXSA 2BYAX 3GCTG 3EE0B 3LH3A 2B0FA 1XUFA 2F9OA 1NTPA 2SNWA 3F0PA 4ABDA 1CU1A 1HRTH 2QXGA 2BX3A 4X2WA 1E37B 1O2NA 3A8CA 1KDQB 2RCEA 5L2ZH 2HWLB 2NU2E 3BTTE 1EAWA 3AAVA 3DCLA 2G81E 3A7ZA 4BAKB 1H9HE 1O2XA 1C5PA 2ODQA 4B2CA 1CSOE 3Q76A 4HZHA 3ZVEA 3KNXA 2WSSD 5JBTA 2KAIA 3ZZAA 3IG6B 3SV7A 2OP9A 1GWAA 2ZDNA 1QJ7B 1PPCE 2QY0B 3A7XA 1BDAA 4WMDA 3M61U 1BTPA 2TIOA 5T1VA 1ZPZA 5DP5A 1PQ7A 2A7JA 2VINA 7GCHG 1QJ6B 3KEEA 1SOZA 1UMAH 5TCAA 5E0HA 3F2HA 3FKSD 3N7DA 2TGPZ 2FODA 2CV3A 4UFDH 3A85A 4A1VA 2ZFFH 1V2JT 3ZZCA 5AFZH 2BLOA 2C93B 3STJA 2IJOB 3GY8A 1FIZA 4ASHA 3HKJB 4RSPA 3ELAH 3U98H 4U30A 1E1RD 2W6ID 3KQ5A 1P02A 1O3BA 2FI3E 1AKSA 2XBVA 5I46H 2P3FH 1BTHH 1LPKB 2ZFPH 4MDSA 3RUOA 3VB3A 4OS2A 2EY4C 4ASUD 2G5VA 2OC1A 1DFPA 2P16A 2ZQ2A 3AW0A 1YWUA 1ELDE 1XKAC 4Z1MD 1IQGA 1KDQA 1GL1A 1GJAB 1A3BH 4RT1A 1EPTB 1ELAA 2C8WB 1O30A 2BZAA 2JETB 2WUBA 4B74A 3PV4A 2BVRH 1HNEE 1TMBH 3UFAA 2STAE 2R2MB 1IOEA 2D1JA 1UVSH 2CGAA 2FOFA 1C9PA 3SV9A 2JIZD 3T2NA 1VCWA 4FUGA 3RMOH 2KCAA 4ISHH 3ZZ8A 2YOLA 3MO3A 1O33A 1Y5AT 1KLIH 1Y8TA 4KTSA 4YESB 5C20A 1ELVA 1H8DH 2BD4A 3SJ9A 1BITA 1YCPM 1VITF 2Z9LA 4K60A 1J8AA 3SNDA 9ESTA 1KTTB 2F91A 4O03A 1BRAA 2EI6A 4I8KA 1SQAA 1S81A 4X1RU 1O5AB 2VVVA 3CS0A 4KGAA 1Z8IB 2FOEA 4I7YH 1DSTA 1EJMA 1AB9C 1SC8U 1Y59T 1O2HA 4VGCB 4F48B 4FUBA 2OCVB 1W0ZU 1ZMLA 1QTFA 4X6OA 1H9LB 1FY8E 8GCHF 4B1TA 3EQ0H 1Y3UA 5A8YA 1DE7H 2AIQA 1HV7A 4MPWA 2VWMA 2JKHA 1MTNB 2P93A 4X8SH 3ZVBA 1Z7KA 5HMAA 2XWBI 4FVDA 1O2QA 5GXPA 2PTCE 1WQSA 3ZZ9A 4BAOB 3T62A 3U69H 1GCTC 2FM2A 3GCTF 3LPRA 1HAVB 4H6TA 2ZI2H 1HCGA 3V0XA 3FZZA 1L1JA 2HLCA 3GCNA 4HI3A 1QB6A 5JPMH 3L3TA 4X2VA 1LHGH 1BTUA 1TONA 1ZTKA 3QTOH 3SU6A 1ANBA 4MPVA 4YOGA 1AQ7A 1XUHA 3T26A 1PQ8A 3QZQA 5DKMA 1C2LA 1SR5C 5GIBA
chains in the Genus database with same CATH topology
1CBWC 5HYOA 2ANWA 5EPNA 5I25A 3I77A 3M5LA 2BHGA 4GAWA 2XNIA 2AGGX 4ZMAH 2NU4E 1E34B 1GHBF 3LT3A 4E7NA 1OSSA 1O31A 2GDDA 2XTTB 2B5TB 1ZPCA 2QN5T 1AZ8A 2PKSC 4Q7ZA 2FIRH 1MAYA 4ZROA 2I6QA 4ZKNU 1TRNA 1GBAA 1NM6A 2OC0A 3EDXB 2ZKSA 3LJOA 1P9SA 1HAOH 3SGBE 3FZDA 1PYTD 2Y82A 3GDVA 2VIVA 3JZ1B 1NFYA 1MMJN 3EGKH 2BQ7B 1C5XB 2GV6A 1DWEH 1ORFA 5C3NA 3M7UA 3BTWE 2Z9JA 5DPAA 1DUEA 5A0CA 1HAVA 1KSNA 3GCOA 2PWXA 5ETXA 4WMFA 2PTNA 3FP6E 6GCHF 1HUTH 1KXAA 1V2OT 2C90B 4J2YB 4YLUA 3MO9A 3SUFA 1NY22 2BD7A 2P8OC 1ABJH 2XXLA 1HXFH 1XXDA 2F3CE 2TBSA 1B0FA 1DLEA 2BB4A 2P3TB 4ISLA 3U1JB 1BTZA 1DPOA 4DJZB 3MU8A 5AVDA 1MTWA 1EUFA 4K1SA 4LXBH 1O2JA 1UTLM 2QC2A 1DXWA 3BF6H 1H1BA 1P05A 1RGQA 3VXEH 1MTUA 4BAMB 2ZU5A 1ZLRA 3M7QA 1H4WA 3QK1A 2A4QA 3BEIB 4O9VA 1TNJA 3GOVB 1FMGA 2H9HA 2H6MA 3MTYA 1NRQH 4OGYA 2A45B 4WVPE 3RXEA 2ZU2A 1AIXH 1EZUC 1UK3A 2Q6DA 3DFLA 5FCRA 4WXIA 1DS2E 8KME2 2K1QA 4IC5A 1YPGH 1O2PA 1PFXC 2ZEBA 2BX4A 4D8NA 3LGUA 1G32B 1UJ1A 1HYLA 1W8BH 2QF0A 1GJ4H 1UTKA 2ZHDA 4ZKRU 3SQHE 2QYIA 4Y8YA 4I32A 3P17H 1GMCG 1RIWC 5EXNA 4LZ1H 4NIVA 4FU7A 1ZYOA 3K6ZA 2G5NA 4X8VH 3OSYA 5EODA 1OWKA 4AB9A 3NPSA 1O5BB 4B73A 5A0AE 1L2EA 2ZGCA 3LGTA 2Y80A 1O2RA 2CXVA 1P2NA 2AH4X 3TJVA 1L1GA 1S83A 3U8OH 4NCYA 1TBZH 1C1RA 3OX7U 2FDAA 3P8OA 1C1QA 2A5AA 1WU1A 3UQOA 4WJG2 2VIQA 3LIWA 4K1EA 1MBMA 3A88A 4AOQA 1FONA 1NFWA 5GPIB 4X8UH 2R9PA 2BVSH 2SGAA 2AGEX 1C5QA 5E0JA 1FLEE 1Y3WA 2FP7B 2UUKB 4D7GA 1TGCA 9LPRA 4QT8C 2OTVA 1SGYE 4DG4A 1HAZB 8LPRA 1HAPH 2Z3CA 4R8TB 2XCNA 2GZ8A 1GJ9B 5L6NH 2J38A 4R0IA 2ALVA 1UTOA 1BMLA 3SNEA 1TMUH 4XBBA 1O3MA 2UWLA 1FY5A 2OINA 3HPTB 1BIOA 5JB8S 1O3JA 1PPHE 1ESBA 1BT7A 1JBUH 3O8DA 2ZECA 3MU4A 5DK1A 2CHAC 4MNXA 1A4WH 3LGVA 1GMDG 3H5CB 1MD8A 1O3FA 1LPGB 2VIPA 2A0QB 4JYTA 1YPHC 3SV6A 2PV9B 3LDXH 3GICB 2XC4A 1CBWB 4MPUA 1Z8JB 1C1WH 2HALA 1VITH 1GBCA 3A7WA 1P03A 3S0NA 1A7SA 1BRCE 1VJAU 1SVPA 2PKSB 1Y3YA 2XC5A 2ZZUH 1KXBA 1JIRA 2OBOA 2EEKA 1IAUA 1WAYB 1P09A 2EC9H 4GHQA 3RXHA 1NC6A 1TB6H 1N6XA 1O3KA 1FJSA 1K21H 1SMFE 5LPRA 2BOHB 3S7KB 3OY5U 1A5IA 2QV1A 1K1IA 4IN1A 1P2QA 3CENA 1TNKA 2SFAA 1H9IE 2VWOA 1P9UA 2CJIA 1G3EA 3SNCA 4ZXYH 2PUQH 3U8TH 1V2QT 1GJ7B 3HKIB 2FXRA 5TCCA 5C1XA 1TNHA 3A8DA 5FPTA 1PQ5A 1GMCF 3RXFA 1O2GH 2GCTC 2OC8A 1QA7A 1YGCH 4IW4E 2P8OB 1EOJA 2VVCA 3ZVDA 1W7XH 1ANDA 3E6PH 2B7DH 1SGEE 1Z1IA 2IPHA 2NU1E 4ABHA 1JRSA 4J1YA 1XKBC 2FOGA 2ZCKP 1LMWB 3N7OA 1SGQE 3LH1A 3SOSA 4JK5A 4CR5A 1LVOA 4ZKOU 3RXDA 3FP7E 1GI6A 3SJOA 2ZHEH 2BD5A 2BY5X 4AORA 1NESE 4ABFA 5A2MH 2Z3DA 1SPJA 1V2WT 3MH4A 3KN2A 2G8TA 4MLFB 3QN7A 1KXEA 2Y6TA 2O8WA 2G55A 1TRYA 2GMTC 1AVXA 1S0RA 4CHAC 2ILNA 5F03A 1ZOMA 2EI7A 4FUFA 3NKKA 1QBOA 2GTBA 2J95A 1GI4A 2Q1JA 1QBNA 3RXPA 4YO9A 1C5NH 4INKA 1T32A 2FO9A 2P94A 4FVBA 1RIWB 3M35A 1SGRE 4BANB 1GI7B 4BTUB 2VU8E 1S84A 1AFQB 5FXLA 1EQ9A 2OQ5A 2PSXA 3MI4A 3DFJA 4I8HA 1LKAA 1PQAA 1LDTT 3NK8A 3OTJE 3VFEA 1GMDF 1BUIA 3TH3H 5SGAE 1HJ8A 2VGCB 2H1UA 3O8CA 1A5HA 3BSQA 2R0LA 4NA7A 3RC4A 3I78A 3RXRA 4TWYA 2VWLA 2OLGA 4YM9A 1Q3XA 4M7GA 2UWPA 1YLCA 2VWNA 1ESTA 1FN8A 1O34A 2R2WU 1TAWA 1O3AA 4GCHG 1NRRH 1YF4A 1SI5H 2AYWA 3BG4C 3MU1A 4H42U 2ZA5A 5J4SA 4YT6H 3GYMA 4FUCA 4I31A 4DVAU 1XUIA 1UTJA 2AIPA 4TPIZ 1OX1A 4ZHAA 1BHXF 3RXAA 2FX6A 1DM4B 2F9VA 3WY8A 1SGDE 1T4VH 1T8NA 2W26A 4XFQA 3OU0A 1FUJA 5GDSH 1UVUH 1W2KH 3SU3A 1D3PB 2V35A 3RU4T 3V13A 1YYY1 2KAIB 1O2UA 2BLQA 1S85A 3HATH 4Z0KA 2D8WA 2WPJS 1ZGIA 3B23B 3LC3A 1C2FA 1LPZB 5H4IB 3KIDU 1QA0A 2A4GA 4ABBA 1SLVB 2VJ1A 2CHAB 1HIAB 3SV8A 2ZIQH 5F8XA 1ETTH 2BVXH 3F1SB 1FQ3A 2V0BA 1YBWA 2W5EA 1G2LA 2H5DA 3AAUA 2QCYA 4NFFA 4XBDA 4GSOA 1GI3A 1ELTA 3F6UH 1SLUB 1Y3VA 1NPMA 3P8GA 1GBTA 1IQFA 1AKSB 1KTSB 3E3TA 2C3SA 4ZXXH 2Z7FE 3LU9B 3SHAH 1YP9A 4TPYA 1E38B 1P11E 2F9UA 5JB9S 1OWDA 1T8LA 1CA0C 1J16A 1DUAA 1UTNA 1NFXA 1NRPH 3ATIA 1FI8A 5T6FA 5EXLA 4NSYA 2CMYA 3LGYA 1FAKH 1J9CH 2WV4A 2O9QA 4TY7A 1GHZA 1KXFA 4FXGH 1EB1H 2Z3EA 1TLDA 2ZHWH 3C1KA 2FOHA 4AGJA 3U9AH 3SI3H 5EG4A 3PLBA 5B6OA 1TMTH 1P10A 1OYTH 1HIAA 2BLWA 1IQKA 1ZSJA 1C2IA 3DD2H 2WYGA 2ODPA 4FU9A 4WY3A 5DO4H 1CHGA 3PTNA 1WTGH 1AUTC 4A7IB 1GG6C 1OKXA 1BTWA 1AWHB 5ABWA 2SGPE 3NXPA 2FESH 2ZWLH 2OC7A 1UCYE 1C4Y2 1MUEB 2BD9A 5HM9A 3LJJA 1A61H 3G01A 2J94A 3RU4E 3E90B 1BHXB 1A5GH 3RU4D 3URCA 3SQEE 1DWBH 1W7GH 1GVLA 2BY8X 3T25A 2R3UA 4Y8ZA 3BIVH 3TNTA 1C2KA 4GCHF 4GHTA 5AFYH 3ZZ3A 1TGNA 1TQ0B 1ELGA 3RXIA 3A87A 5F8ZA 1SGTA 5JDUB 1L4DA 1CT2E 5C5NA 2GMTB 4CHAB 4Q80A 1BBRE 1ANEA 1HAYB 1LVYA 1G9IE 1QJ1B 1QY6A 2XYAA 3SW2B 1WBGB 2OBQA 4LK4A 1BA8B 5EQSA 4HGCA 4HTCH 5A09A 1OWHA 1D6WA 1DITH 1FN6A 5DJ7A 1O5EH 7ESTE 5LPFA 1C5VA 2PGBB 1O3CA 1GDNA 1BJVA 1C1SA 1OP2A 1RTFB 5GJ4B 1QRWA 4D9RA 5LPEA 3TK5A 4D7FA 4CR9A 3GDUA 3P92A 3VPKA 3JZ2B 1WCZA 1K1OA 4O3TA 1LCYA 1GBLA 4AB8A 1YM0A 1C5YB 4X2YA 4CBNA 3BG4B 1TPOA 2Y7ZA 1TFXA 5DP8A 4NSVA 1HFDA 2VNTA 1SGFA 1C1MA 4DURA 3MFJA 3HGPA 3DT0H 4NA8A 1V2LT 2WYJA 4MQAA 3D49H 1BTXA 2TGDA 2C8ZB 1C1VH 2ZDLA 4CRAA 1P12E 2ZTYA 3BEUA 2ESTE 4X1QU 3GY6A 2ZHQH 1G3CA 2ZU4A 3RXTA 1QIXB 4Q7XA 4HFPB 1ZRKA 2HNTF 2YNBA 1DWCH 4DOQA 1LTOA 1NT1A 2A2XH 1P3EA 2W7SA 2PGQB 3K65B 3A8AA 4LZ4B 7GCHF 4NZQA 3BTQE 5ESBA 4JCNA 4RKOB 1GJ8B 1Y5UT 5J4QA 1XXFA 3CS7A 2H2ZA 1V2PT 2C4FH 1LO6A 1GGDC 2BDYA 1GI5A 1C9TA 3IITA 2BDIA 3E1XB 1O3LA 3NZIA 2ZF0H 1MAXA 1SFQB 1YC0A 1O2MA 2Y5GA 1B7XB 1TGTA 1DWDH 1M9UA 3RXMA 3M7TA 1HB0B 5FAHA 1SBWA 2Q6GA 3RXLA 1CA0B 5C1YA 3RMLH 1XM1A 1ZGVA 4Q7YA 2BDBA 5E2OA 2WPIS 1C5MD 1T4UH 2BD2A 2OXSA 5FBEA 1SB1H 3V12A 1F5KU 1DOJA 3A83A 3Q77A 1JOUB 3UTUH 3SV2H 3GISB 4LOYH 1AN1E 1O2SA 1ZJDA 3RC5A 1WQVH 4Z6AH 1ELCA 1EATA 1A0JA 1MCTA 2STBE 3GDSA 3UIRA 1UTPA 1MQ5A 2P59A 1CGJE 4AYYB 1BQYA 1QL8A 1HGTH 3TGJE 2BOKA 1CT4E 3PM3A 4CH8B 4IMQA 1GBHA 1GBDA 1WSSH 4WH8A 2A32A 4CRGA 3I29A 3QWCH 5C5OA 3SU1A 3LGIA 1SG8B 1GG6B 2W3IA 3M5MA 1GL0E 1VZQH 3VGCC 5TJXA 3QTVH 4ABIA 1PPBH 3R3GB 1YPKH 1AVWA 2EI8A 2M5TA 2WPHS 1AUJA 3SUGA 2P95A 1F0RA 2W3KA 2ZFQH 1Q31A 1OWJA 1EB2A 2R3YA 2JH5D 2DUCA 2ZTXA 2O8TA 3ZYDA 1OPHB 3KF2A 2HGTH 3MNCA 4WWYA 3ZV9A 1ANCA 1N1LA 5DG6A 3PO1C 2WV5A 4X1NU 4GVUA 2A4RA 3SHCH 1MZAA 5DP9A 4UONA 2FLBH 5FX5A 1Z6EA 1AI8H 3ATKA 3UOUA 2JH0D 4AG2A 3VB4A 1P2IA 1CA8B 1ESAA 1FY3A 4YOIA 4WF8A 4NWLA 5GCHG 2OUAA 1P04A 3UR6A 1GJ6A 4UD9H 1C5LH 1CGHA 1C2HA 1HLTH 4A6LA 1QL9A 3LOXA 3BEFB 1JWTA 4H6SB 1UTQA 4I8JA 2HRVA 4B2AA 4BAQB 3A7TA 1AB9B 3VB6A 2PLXA 2ZDMA 1W11U 3TVJB 3RXUA 3HK3B 3A80A 1TGSZ 1H8IH 2A2QH 1NRSH 1V2MT 1ZMNA 3M5OA 1IQMA 1IQNA 2C8XB 1LHDH 1B0EA 2QXHA 2BDGA 3EA9A 1UCYK 3RXJA 3O8BA 3RM2H 3F9EA 1O5CB 2PHBA 4K5ZA 1GCTB 2QAAA 4UDWH 3SUDA 5CMXH 1V6DA 4KTUA 4NIXA 1NN6A 2JH6D 1N6YA 4ZAEA 1O3OA 2HOBA 3F9GA 1O2ZA 3ZZ7A 2GVFA 1GDQA 3SJIA 1HAHH 2BM2A 4I33A 3TJNA 4D76A 3S9CA 1TOMH 1QNJA 1RTKA 1EKBB 4K8YA 1E0FD 2NU0E 1A2CH 4IC6A 3URDA 1OP8A 2A7HA 1ARBA 1K1PA 1TA6A 1C1NA 2GZ7A 2LPRA 2FOCA 1C1TA 3RXBA 3F9HA 1PPZA 1OYQA 1BBRK 1D4PB 3RXOA 4GUXA 1EJAA 5EW1H 2UWOA 4X6NA 1SSXA 1UVPA 2BXUH 2Z9GA 4FU8A 4UFGH 2FI4E 3A8BA 1BOQA 1T8OA 1O2LA 1UCYH 2BLVA 3O8RA 1SLWB 4YZUA 3RLWH 1YPHE 4AYVB 1O3NA 6CHAC 1D3QB 1IHTH 1O3DA 1XUKA 1JRTA 1KIGH 1BRUP 5F6MA 1GGDB 5JBAS 2ZFRH 1O35A 1A46H 2J34A 3BTDE 3H7TA 1AWFH 2R0KA 2FEQH 2ZPSA 3D65E 3STIA 1SFIA 5GWZA 1FPCH 5EU8A 3LKWA 1EZXC 1SQOA 3MWIU 2FTLE 3E0PB 3VB5A 1C5SA 4YOJA 1ELBA 1NRNH 2GCHG 1HJAC 3DHKH 3SU2A 1O2IA 1LQDB 3MYWA 1BJUA 2ZDKA 3EA7A 4B75A 2V6NA 2O8UA 1O39A 2FZZA 1O3HA 3TK9A 1ABIH 2SGQE 2DE8A 1AE8H 1BBRH 3PWBA 3PB1E 3TNSA 3AW1A 3BV9B 1QHRB 5CHAC 1ZPBA 5EW2H 3FANA 4SGAE 3EA8A 1JMOH 1PPFE 1D3DB 1C1UH 2WINI 5E0GA 2G51A 3P8FA 4ABGA 3RLYH 3AASA 5FPSA 3T27A 6LPRA 5DP7A 5HM2A 1MQ6A 3KL6A 4U2WA 1TX6A 4WMEA 1EXFA 1AY6H 2SNVA 3QO6A 4BAHB 4INLA 1LHFH 1ZHRA 1T8MA 3SU0A 1TX7A 2FLRH 3BTGE 1X7AC 3VGCB 2ZG0H 3C27B 2VH0A 1EPTC 3PTBA 1AGJA 3T28A 2ZPQA 2VIDA 1ACBE 3TH2H 1CQQA 3KHVA 1HPGA 4ABAA 3TH4H 4ISIH 4MNYA 1ZSKA 1IQEA 4MPXA 1AO5A 3OYPA 1F7ZA 1UK2A 1KLJH 1OS8A 1HAIH 1K9OE 2UUYA 3PO1B 2RG3A 4WH6A 2FS8A 3SORA 1NU9A 2H9TH 3RXSA 1GJCB 2TPIZ 1D9IA 1QBVH <