1BC6A

7-fe ferredoxin from bacillus schlegelii, nmr, 20 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
b'AYVITEPCIGTKDASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-FE FERREDOXIN
publication title Solution structure of the oxidized Fe7S8 ferredoxin from the thermophilic bacterium Bacillus schlegelii by 1H NMR spectroscopy.
pubmed doi rcsb
source organism Bacillus schlegelii
molecule tags Electron transport
total genus 23
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bc6A00
1SJ1A 1H7XA 3MM5A 4DHVA 1F5BA 5L8RC 3EXYA 3MMCA 2XSJB 1GTHA 1Y5LB 2VPWB 1R27B 1H0HB 1PC5A 1FRMA 1G6BA 2C3YA 2VKRA 1FRXA 5BYSA 1XERA 1FDAA 3IR6B 4YDDB 1B0TA 2GMHA 2VPXB 1FRKA 2WSCC 6FDRA 2WSFC 1BC6A 2FDNA 2C42A 2VPYB 4OV1A 6FD1A 4XDCA 1C4CA 4AYBD 3LW5C 3OR2A 4KT0C 2Z8QA 7FD1A 4XDDA 2XSJA 3OR2B 1FRLA 1AXQA 1FDDA 2V2KA 4L6V3 1B0PA 1G3OA 1KQFB 1VJWA 1KEKA 1DURA 1FXRA 3EGWB 1H7WA 3OR1B 1RGVA 3MMBA 1JNRB 2PMZD 1FDBA 1BWEA 5E7OB 3MMBB 2C3MA 2O01C 1FERA 1SIWB 1D3WA 1FTCA 1DFDA 1GAOA 1JB0C 1GT8A 1BQXA 2FGOA 2VPZB 3EUNA 2IVFB 1FRIA 4RKUC 2WAQD 3MM6A 1ROFA 2FD2A 3IR7B 4XK8C 1Q16B 3MM6B 1IQZA 2WB1D 1FDNA 1JNZB 1Y5NB 1FD2A 4CI0B 1FF2A 3IR5B 7FDRA 1CLFA 1A6LA 3OR1A 1SIZA 1PC4A 2FJBB 2V4JB 1DAXA 1BLUA 1GTEA 2C3PA 2WSEC 3MM9B 1KQGB 1BD6A 3MM7B 2GMJA 2FJDB 3MMAB 3MM5B 1H98A 5FD1A 2ZVSA 4ID8A 1WTFA 3MMCB 2C3OA 2C3UA 2PA8D 1Y4ZB 1F5CA 3C8YA 5CHCB 1K0TA 2PDAA 5BYRA 3PNIA 1F2GA 1FCAA 2V4JA 4OMFG 1HFEL 1Y5IB 3MM8A 3GYXB 1IR0A 2Y0SD 1B0VA 2FJAB 2UZAA 1FXDA 1FEHA 1FRJA 1FRHA 3MM8B 3MM9A 4Y28C 5BYQA 2FJEB 1C4AA 3HKZD 3MM7A 3MMAA 5CH7B
chains in the Genus database with same CATH superfamily
2MXYA 2IJRA 1VQ7S 1B7YB 1Q7LB 4Y65A 1SJQA 4EMDA 2GAHC 2LQJA 2V9KA 1ULRA 3M2VA 2R8IA 3HK2A 3VTIA 4X66F 1FNXH 4P9SA 3QGIA 3CDAA 4JB8B 4QJVA 1QSLA 2Z8QA 3M6XA 4KFBB 5HAOA 3M8RA 3OR2B 2WRMA 2B43A 4HDGA 4G1IA 5C25A 4PR6A 1RHQB 2CNNB 4K4WA 4K7QA 1QSYA 2CQ2A 1MU2B 5J1NA 4DQPA 2ZJRQ 4UZBA 2VPZB 2KM8C 1IKVA 3IN5A 1A7GE 3KHGA 3BGFA 4Q8EA 3QAEA 2L9DA 3KMSA 1PYOB 3BGRB 3K5OA 4AQYJ 1U6BA 2E7VA 4AL5A 5CZXA 4E0DA 5D78A 2OFGX 2AYBA 4KV8B 2N4DA 4R25A 2E5LF 2H51B 2BVZA 1N5TA 3M8QA 2LEAA 1RTHA 3RG6A 1R89A 2QN6B 3JQJA 1KR4A 4DPWA 2CQBA 3DRXA 1B99A 4JV2A 3E2EA 5J1EA 2CQ4A 3IR6B 4TYBA 3FMWA 2DNHA 4GKKJ 3R97A 4I69A 2VPYB 4GVBA 4HHHA 1X5PA 1FFSB 2QSFA 3ZZ0A 1NPPA 2AYGA 3WX4A 2VBZA 2ZZTA 3OVSA 2LQ9A 1NK6A 2QA4S 2J0SD 3BEGB 3B78A 3GP9A 3JTOA 1AFIA 2QMXA 3V4MA 2KT3A 3RBXA 2Y9HA 3P5BP 3HVRA 1GXUA 3RGIA 2QC3A 5KFUA 3I4PA 2JC1A 1SV5B 5DETA 2XMUA 3KHLA 4WE1A 1AT1B 2WVBA 1S0VA 3MXHP 2HIQA 4X4NA 1EARA 5HLFB 3MM9B 1HWLA 2OMLA 1KQGB 1OO0B 2FLPA 4MMOA 5DO2A 4KKOA 1SXLA 1I94F 3J80U 4KHPF 2VQFF 2CKWA 1H98A 1HNXF 3V81B 2Z30B 3GILA 3MPUB 1HI8A 2ZH6A 1F3VA 1LXNA 5CHCB 2JWNA 2HW3A 2FVPA 1N0UA 1VRTA 3GYNA 3C15B 3K5MA 4NMLA 1FA0A 1X0FA 2ZM6F 3ISNC 4OHWA 1X4BA 2KO1A 3MMCA 2OPQB 2J6SA 5DJBA 4OYBA 3HD1A 3MAAB 2GVZA 3C2PA 3Q2TC 2KFNA 4GKJJ 4WP9A 4Y2IA 1EETA 4Q44A 5CYQB 1RWNB 4CLLA 1N36F 4ICLB 3EGVA 1JLEB 1VBZA 2GHVC 3CJ0A 5F9LA 3TP2A 1PCAA 1RA6A 1S9FA 3K59A 5SZTA 3VAHA 4LQ9A 3U1NA 4GC7A 1JNZB 2X7IA 5D3GB 3KFWX 1NCLA 1C1CA 1GX6A 1YSJA 3FJ2A 1U1RA 1QM9A 3A8KA 3CJ3A 4W90B 1FX4A 1HWIA 4NASA 1NK7A 1FKPA 3BB5A 2FZKB 3QJJA 4FXDA 4X65J 3QBCA 2B7BB 1D9FA 4Y6IA 2FJAB 4OJHA 1KSPA 2HG4A 2I8EA 4TKTA 5IS2A 4WU3A 1UA1A 4KYZA 1RLCL 5E33A 3KOAA 1LWCB 1HNWJ 2LVWA 1FRMA 5KG6A 4B3OA 2H5IB 5F8JA 3CJSA 2RDJA 3BKUA 4DS4A 2Q3PA 2V69A 3JYTA 2CVEA 1R0AB 3W7BA 3WC2A 4ZPDA 1QLNA 4G1QB 4DJBA 2YX7A 1OQ6A 3OR1B 2VG7A 5EWGA 3EPIA 4ELUA 3ET6B 5D4OA 1TL7A 4F0KA 4J7CA 4TYAA 1KVKA 3HZGA 2VIHA 3QWUA 1W25A 2MTLA 4PZVA 3GJSB 3QLHB 4DV6J 3QWPA 2B9YA 2BMBA 4DV5J 1LWXA 4PAAA 2JHEA 2M8HA 2GIFA 4WJBA 4RW9B 3CT9A 4IFVB 3IAM9 4HH0A 1UZHA 4OQJA 3A3PB 1RHKB 3W9IA 1PYSB 4IYQA 4JI0F 1RT4A 2UUTA 1C0UB 2HRUA 3THPA 2BJ8A 2EBGA 4ZP6A 2HWHA 5HMYA 4ZN3A 4RJVA 1HD1A 2C2OB 3KLGB 3OR2A 4CO1A 3AAWB 3PW0A 2DEIA 4C8NA 5C24B 2ZOGA 5KG7A 1MU2A 1CJKB 4CT9A 4B9LA 1S1VB 1XWLA 2R7TA 4PXDA 4M5DB 2B8PA 3DOLB 4OJGA 4O3QA 1FF2A 2XCPA 3C6UB 4HACB 3BGRA 2OMOA 4PCQA 1CQMA 2F40A 2CNOB 3J7YU 3RB3A 1WJ9A 4MK9A 4P52A 3MGJA 5J1PA 5FD1A 2BKNA 1HI1A 2HMIB 1H2UX 3DRSB 5EWFA 4HL9A 3QJPA 3LWLA 2F8EX 1FEHA 2C2KB 1WKJA 3ZC4A 2HRTA 1IJFB 4ZVEA 2MZ1A 1TV6A 5KFXA 2HFSA 5JVGQ 3QFHA 5F9NA 2MZTA 4CLKA 2AV5A 2C2RA 4EO6A 1J5EJ 2IDEA 1S6OA 3TUZC 3CULA 4NLXA 2BM0A 2DNYA 1L3KA 2R7UA 3DM2B 4ED8A 3OJUA 2V63A 4C97A 3R5DA 4OI1A 4F0HA 4CP5A 5L1KA 1S6QA 2GAGC 3GV7B 3LUYA 2AJFE 2FGOA 4NYOA 2ZHBA 4JV1A 3TR5A 3OLBA 1XBWA 4PKDB 2DHAA 4CLFA 4BWMA 3CD0A 2CWXA 4DSIA 5KFLA 4TN2A 1N32F 4I6WA 2C3PA 2HNDA 3JB9k 4H4OA 3MM7B 2OTLS 4WFBQ 3M8PA 1SC4B 3V81A 4NLYA 1EP4A 2XY6A 4OX9F 3JQMA 1MWZA 4C2MA 1U1LA 1C2PA 4I64A 4AXIA 1S57A 2RILA 5IV4A 2ALZA 4ID5B 1H7XA 2KYZA 4OHZA 4DMZA 4NCGB 3MAAA 1Y5LB 1PSDA 2D9PA 4IUFA 2UUAJ 4ED5A 5CYQA 4ZLNA 2R8KA 1CS4B 2F1FA 5E41A 3MECB 2F3JA 1JLEA 4K4YA 1XEZA 1CJTB 3DU5A 4XDDA 5CAAA 4LFBJ 3TA2A 3FZBA 3BDPA 3FSIA 3QMQA 3CJKB 2N7CA 4WPAA 1VK8A 3HVAA 2B3TB 2DJWA 4USIA 4UY8T 4LREA 2QZ8A 1KFSA 3W5YA 3AJ1A 2FLOA 2DH7A 5T14A 1HL6A 1F60B 2KDOA 3HHLC 4R0EA 2R2TA 2QTWA 2RMLA 2G9OA 3OFFA 2HURA 3AOAA 1WEYA 5ETKA 4B3SF 1JLGB 3DDNA 4X62F 2ZH1A 2Z4PA 4JOUA 1T8EA 1KLNA 3D6FB 3AOBA 1I1GA 1RT3A 3PRBA 2L08A 4FS2A 1CC8A 4WU2A 2FJEB 4PWUA 3BO3A 2Z57B 4OX7A 1LWCA 4D3HA 1U2CA 1HA1A 1F9FA 5HK4A 1YI2S 1F2HA 2JZ5A 2ROPA 1TMMA 3NXZA 4USKA 1Y11A 3HVTA 5LJ5Y 1C4CA 5DGAA 1Y10A 3POTA 3KDOA 1IQTA 2AP6A 1IKYB 2V6AA 4WBFA 2LKZA 5DQGA 1O8BA 4DSLA 5J2PA 1EQ0A 3ET6A 2KG0A 4NLPA 2FTRA 4ZVQB 2VODA 2FHJA 2G2YA 3GPAA 1YDLA 3HT0A 3F44A 4DX8H 4J9KA 1WC1A 2OKQA 3DLEB 4M5GA 5GMEA 2JDJA 2MYFA 3CJ8A 2J9DA 1P9YA 2ASYA 2W9CB 2FJDB 1NJYA 3MM5B 2HNZB 3S1TA 1LNQA 2OIHA 4RNFA 3GTYX 3CC2S 4IFVA 4FXWA 2HHHF 3NY0A 1EIYB 3MR5A 1C0UA 4FVMA 3UNYA 4DU8A 3KLHB 3BKFA 2CZ4A 4U8YA 1WUUA 2EFPA 1DHMA 4HT5A 4YFUA 1YGYA 2W01A 2MB0B 2HPUA 1UVMA 2UXBJ 1B0TA 4LF4J 4LF7F 3BN7A 3IM8A 5D15A 1KLMB 1G7CB 4DFPA 4CLTA 5ETQA 1JKHB 2FC9A 3QIPB 2I6WA 2GGPB 1S1VA 3KK1B 1FKAF 2IFXA 2ZJPQ 4M5DA 4ELTA 2FY8A 5GAGU 4B3MF 4FYYB 1NDLA 4HACA 1PC4A 2DH9A 2WW8A 3GV8B 3DLLQ 3VZHA 2BE2A 3M4XA 1ZAVA 1JLBA 1RYSA 3H90A 4NL5A 1RHRB 2GJIA 2M88A 2YY3A 1RKJA 2C3UA 3DXSX 2ASDA 1TUGB 4CLPA 4C48A 4ED4A 4DL2A 3PG9A 3PXGa 4OZ1A 4ZCIA 4CIOA 1BUXA 1R6VA 1NJIT 3BBCA 1DRZA 2OPSB 4NPOA 3KNAA 5KFQA 4L72B 1OY6A 4J91A 1IWAA 4Q2LA 4WTOB 2HIYA 4YUDA 2NXCA 4U7CA 1NB7A 1T03B 3T1AA 5ETNA 2ROEA 1T02A 1DY3A 1FDDA 1XNRF 2VL1A 1RTZA 3AD7C 5BR8F 5HI7A 2MZQA 3R5GA 1OQ3A 4ECRA 2VDHA 2AJ1A 5L9XA 1D8ZA 4K50A 2J0QD 1RT6A 5LMNJ 2QSWA 1Q7YT 2WSEC 5L1JA 5DZ7A 3M2UB 4JV5J 3ZZYA 1HR0F 1HWJA 1GFWB 3K8WA 2C3OA 4A8FA 4YY3J 3TWZA 3MAQA 2HHSA 1Z1ZA 1TKDA 1KHVA 2AMCB 1WC4A 1Q86T 5DG9A 3DN9A 2FPHX 4J9NA 1IBCB 2BJ1A 4J5OA 1N88A 3G86A 2V9WA 3K2YA 5ETVA 4F4XA 3OVAA 4Y3CA 2VG6A 2VB6A 1CS4A 1UJ5A 4AE5A 3QO9A 2IDLA 5DDQC 4RBVA 4Y00A 3QT8A 3J81U 2RS2A 2G2ZA 1TK8A 3QGGA 3NEKA 3KJNB 4U95A 3CJKA 2IM2A 2IBKA 5F41A 2R42A 2ZH8A 4OX8A 3QT7A 3BKTA 4FPIA 1YBAA 4ILMA 3OTEA 1NDKA 1WOOA 3AD9C 2C2ZB 3QGPA 4IG3B 1VQPS 3NAIA 2DHGA 3SV3A 3H8YA 2MQOA 1UVKA 2VH7A 1RE1B 4CI0B 4NXMJ 4J9PA 3QZ7A 3AXMA 4C11A 2E5HA 2OEMA 1JLCA 2HRYA 4A46A 2V4JB 1WF0A 3E3XA 3HHKA 1TKXB 4DSEA 3HP6A 2KG1A 2KL8A 1BD6A 1UVNA 1FVSA 4FN5A 3WIUA 2J7WA 4ECXA 1FJ7A 1PJ6A 1RKIA 1NRKA 3I5CA 4OYXA 1FESA 5CYMB 3A13A 1LKZA 1NSAA 1XC9A 3R2CJ 2XWXA 2Z2MA 2RQCA 3ISND 5H9FK 5GAHI 3U1MA 3BF4A 1JXVA 1PJ7A 5D4NA 3E01A 1VQNS 2HZCA 5KFNA 1R0CB 2AX0A 3W5ZA 3BM7A 1TU0B 2X1FA 1IKYA 1HBNB 5DLFA 1XNQJ 2NQPA 3F73A 4JYAF 3KTQA 2HVDA 4ANEA 2HFZA 4F4KA 5CYJA 5FDLB 3T1HJ 4PG6A 3KDNA 3UD4P 1FTRA 2BV3A 1FD2A 1ZH5A 1PAEX 4LF5J 1LFWA 3HMJG 5IZHA 2R7SA 4X4SA 2WB4A 2B9EA 2LYVA 2MZJA 4JI7F 1VHFA 4GO5X 5GADI 1WHVA 2BDPA 4J9MA 5H9FJ 5ETTA 5A76A 1RDRA 4G65A 3L95X 1REVA 4A8KA 4EBDA 2CQIA 1VMBA 1TL3B 1BQMB 3KLHA 3HI9A 3R7NB 2HFNA 4X4RA 4W4MA 1RCXB 2HK3A 4CNYA 2MQ8A 3FC9A 3SDEA 2WSFC 3CVKA 3G6ES 4F8RA 4XDCA 1NK0A 3O5TB 3KLFB 5MLCV 2XGPA 3N79A 4N8NA 3GYGA 3VGVA 2GVDB 2WVCA 3HM9A 4LMZA 1RCOB 2CQPA 2MKKA 1BWEA 1V3RA 2WZ1A 3SSQA 3ADAC 5C42A 2IVFB 3JS9A 3BQ1A 2CA9A 3MD1A 2AKWB 3M32B 5M2RA 1P8GA 1J2VA 2BQRA 3CO9A 8RUCA 2WVDA 2YKOA 3VQTA 1ZAXA 2JL9A 3H2UB 4DPXA 5KG5A 3B4DA 5A2QU 3D3BJ 3D1QA 5IV3A 3QT5A 5DS7A 1TL4A 3EMTA 2XGQA 2N3LA 3OTOF 4JUZA 3TX8A 2CPDA 1U6FA 2HEKA 1T9TA 2I2YA 2VQEF 2FHKA 1KNZA 2YBVA 2ZH5A 2JVRA 1FHTA 4ELVA 1UPPA 3IG1A 1FRKA 2MLYA 1U49A 2BUNA 3CD7A 1T03A 4OHVA 1RTDA 3BYRA 4KHMA 1J5OA 3K89A 4Q2MA 5K14B 3AXKA 3Q86A 2MSSA 2GHWA 3DYAB 2BE7D 1LW0A 4URGA 1NPKA 3IR7B 2HLUA 3TA1A 2IIHA 4JI2F 1VQ8S 3THTA 2ACMA 1U8WA 1YBUA 4GC6A 4DQRA 3W2WA 2F4VJ 5K5MA 3UR0A 4NXNJ 1W2IA 4MYTA 3N28A 1NDCA 1VBXA 5BXIA 4DR3F 2HHWA 3MM8B 4Y28C 4H4MA 2YNFA 4TXSA 3R1HA 2B7CB 2ZOMA 2E5LJ 2VONA 3VALA 1RWWB 2HGNA 3HSGA 1BQNB 3FRZA 1E6YA 1FT8A 1U2FA 4TY9A 3ZFVA 4DSFA 1OPIA 3UDEA 4DQSA 2KHCA 1YJTA 1UMJA 1YK9A 2W1BA 5B0EA 1CVJA 4USTA 3MCSA 1HNVA 3C16B 4IFYA 5DQHA 3I0RA 1ZS6A 2EWHA 4IG3A 3V4IB 1TZ0A 1OWXA 2IVYA 4XO0A 4AT1B 1RYRA 2WB1D 2ZH4A 1X7VA 3X3UA 1YJUA 2MLZA 4OZ5A 1FK9B 2XYPB 1TKXA 4QPXA 2VV5A 3FFIA 4LUBA 3QIDA 2F5GA 5DG8A 3Q0AA 4A48A 3GSDA 1LWEB 5LOQA 3GB0A 3BSOA 2V67A 3JQKA 3AFGA 3WQPA 1VJQA 1HNXJ 4DR7F 2RUGA 2EC2A 2AT1B 3EVMA 2DR6A 4A8OA 4KSEB 2AHOB 3O44A 1YJRA 2A10A 2CQCA 1JJ2R 2QEXS 2PT0A 3M6WA 4BS2A 2NS1B 3ZNUA 4ZK7M 2DGWA 1Q78A 5EGYA 1WORA 3R6LB 3ENVA 2Q43A 1UPMB 4RUBA 1WELA 5IWAJ 4ZPAA 2H4YB 3C14B 3LA0A 2Q79A 5A2QY 2MHNA 1RAOA 2Z2YB 3HHLD 2K3KA 1S1WA 2QLJB 1RAIB 2IVMA 1YIJS 3OQ2A 1U24A 4FS1A 3FBFA 4ANCA 1Q53A 2DY9A 3LP1A 1S12A 4F50A 4L74A 4RX6A 2FJXA 1YJ9S 2AQ4A 2CQDA 2K1RB 3S01A 3CC4S 2ZHAA 3MEDA 2YKNB 2YWWA 2RF2B 1DTQA 1MN9A 2DB1A 4ETXA 1BQMA 1B64A 3MUMP 3MFHA 2XLKA 1LWFB 3MUVP 2ZD1B 3UN2A 1X4DA 3OL6A 3JTPA 4O44A 5KFHA 2V8HA 1WNEA 2U2FA 2HBZB 3SZ2A 1AFJA 4NMXA 2ZE2B 1HYSA 1CBKA 4NYZA 4KO0B 4FKYA 3KLFA 5J2QA 1JLAA 2F8HA 3CJRA 3TUJC 3EGNA 3NNAA 4PRFA 1K44A 4DR6J 2ZZNA 3IWNC 4PXEA 3O8WA 4IRDA 2VA2A 4XIUA 3CIMA 2BABA 1XMOJ 1IBMJ 3M32A 4OHXA 3OFHA 2E9ZA 1ITPA 3OW2R 2QA2A 3HHNB 3A8JA 2MY7A 1Q82T 1FKOB 2NZ4A 1YHQS 2HBRB 2JOQA 3RBEA 2HYIB 4B3TJ 3HFZB 2QG9B 4L76A 4DR2F 1S9EB 4B9VA 3HF5A 2XNQA 1LOUA 2CAJA 2PIIA 1S6PB 3N6LA 4JI5F 4LSNB 2OD4A 5F0UA 2M70A 1QE1A 4ECSA 2HNYB 1F2GA 5ITHA 5KT6A 4CH0S 1S4FA 4ZCLA 2RJZA 2XBPA 3PX6A 3IRWP 1HNZJ 3H42A 3VAKA 1SB6A 3MDFA 4K0KJ 1U0SA 3VGSA 4AL7A 2KH9A 2W9AA 3R6GB 2IC3A 3SSRA 1G4CA 1L3SA 3BGOP 2XYHB 3FZ2A 1EJ7L 3W63A 4LF9J 1MSWD 1JIHA 3H40A 3UO0A 3I5BA 1Y9OA 3WHIA 3NS7B 4RKUC 4C0HA 1JX4A 2PI5A 4H4KA 1DQ9A 3MD3A 3DLGA 4ZOSA 3RRKA 3TI0A 2AJQA 4BC9A 2DNQA 4RUHA 2JH3A 3NRBA 4ZS6A 5IT0A 5AJ3F 2ADBA 4RWWA 4QYRA 1AUDA 1LV5A 2DGUA 3D2WA 2I5JA 3MCOA 2YVSA 4F4WA 1JWWA 3MM8A 4C8ZA 3CO0P 4CZCA 5KFKA 4TLRA 4KB7A 2EKYA 1BQNA 3V6HA 3VV2B 2L9NA 5HP1B 4JI3F 1IKXB 1TELA 2LDIA 1DBDA 1YG0A 4PUOB 3UPFA 2HFVA 1SKRA 3TA0A 3GIKA 5D8HB 2R8HA 3M6UA 4NI2B 4R5PB 4ZVTB 3G82B 2R7XA 3ZZZA 5KFFA 3BJYA 2UU9F 4ILLA 1F6TA 2EFNA 1NZAA 2XNRA 5K8MA 4XK8C 4MYUA 4A47A 1FD8A 4LFAJ 4ECYA 3NP5A 2KT2A 4CTAB 2GHPA 1UA0A 5HMWA 1QDUB 2AZ3A 3D6HB 4RNNA 1B7FA 1FJGF 1RTIB 3OFEA 1RHMB 4HHUA 5D6GA 4I67A 2GCFA 1LWEA 5HROA 3N01A 1F5CA 4OZ2A 4P72A 2B5JA 1GMVA 3CXCR 3ILLA 1YITS 3UQSA 1UWAA 2OPRB 4ILRA 4NRTA 5K9FA 1HPZB 2NUHA 3GIRA 5HBMA 2VPXB 2DH8A 2L9WA 2MGZB 1IBLJ 1RAHB 1FI4A 1U6ZA 2XMWA 5KOXA 3GFYA 2W9BB 1FEEA 5KAKA 4RNHA 5LXRA 1SJFA 3CMES 5HJXA 3GIIA 1ZETA 1H7WA 4F02A 2R4FA 4BC7A 2YX4A 2ZBRA 1EX8A 3CDEA 4CWBA 5E3PA 1HI0P 2FZCB 3PRDA 2VFTA 3L9ZA 5CD4A 3E8OA 4I2PB 2AGPA 1P27B 3IRXA 4HI1A 2CPZA 3AA8A 3PKMA 2YKAA 3W65A 1IXKA 3GJRB 3KLIB 1S99A 2FJBB 5DGBA 4DV2F 2CQGA 3Q22A 1WHXA 4UY85 4WXWA 4F2RA 1WEZA 2O3DA 2ZWPA 2YKNA 3RAMA 1Q95G 1EZZB 4LF8F 3KXDA 4TQRA 1E6VA 5M2UA 5KFAA 5DDRC 1M1KT 1LWFA 2KYXA 2IRYA 3W8GA 5DDPC 2DR9A 4KE5A 1WHYA 4C3MA 3LP2B 2PFDA 2DKOB 1QTMA 3D4JA 2YNGA 1FRXA 2V2ZA 4OYMA 3KJVB 2F7VA 4DV7J 2R7OA 2XY7A 4O4RA 1WC0A 1EHWA 1NDPA 1FVQA 2DT9A 4YB6A 2QA4G 4DFMA 3Q8QB 1M5OC 1H72C 4ER8A 1LFPA 4ECVA 2XMJA 2IRXA 2LEBA 2KT5A 6AT1B 1HBOA 3FBBA 2DYAA 4U9RA 3FK4A 4LF6F 4OLOA 3M9OB 1YTYA 3K0JA 1BHNA 2R2UA 1SJ3P 2BJDA 5HMXA 1YJVA 1Q4RA 1WG4A 3D54A 3ZO7A 4DZ6A 3RYLA 2J6TA 3GFHA 3PHEA 3DFEA 3PJ9A 2Y8YA 3EZOA 3MFIA 3HJFA 3OJSA 3DMJA 4DQIA 1YLXA 5DZ6A 3MOZA 1UFLA 3TVZA 1ZOTA 2DNOA 4DCJB 2F65A 2EFQA 2XSJB 3T19A 2HHHJ 4RBUA 1Y3KA 1CEZA 1AW0A 5KT4A 4PWDB 3SEOA 5A0YA 2XMTA 1JLFA 2AYMA 4RW7B 2Q66A 5F8LA 5KFEA 1GNKA 4F0MA 3KUHA 1Q5YA 2Y1RI 2LXUA 4LF7J 1H3DA 4LRDA 3D0IE 2EW9A 2R3VA 5E2QA 2JRSA 2VJVA 3VQSA 5I42B 2F9DA 2HHPA 3UVJB 4DR1J 3MI7X 2VICA 3H4BA 3KWMA 3A12A 3SQOP 2MJUA 5HANA 2E1PA 1VQKS 4M5JA 1UVLA 2Y0BB 1R6YA 2OSQA 1NK8A 2IA6A 2WBRA 1RISA 1RJJA 1RTJB 4DUYF 1WOSA 4P71A 2W7OA 4EEYA 1UKUA 2GS8A 3R2DJ 5L9NA 3ENWA 3NCPA 1BGXT 1WOPA 3G8TA 2PSZA 2ZITA 1CJUA 4HR2A 2DR7A 1XQIA 2NXUA 4L3KA 4PUOA 1YJWS 3M1VA 1N52B 2BRLA 2E66A 2CPFA 1RQ0A 7AT1B 2KJWA 4R5PA 4OL8A 1S7HA 4DX7A 1FJCA 1V5IB 4QWAA 4KQZA 2FVCA 5HN0A 3NNCA 2KVIA 2DK2A 3RTVA 1KWMA 1TR0A 1JJ4A 4Q0BB 5F3ZA 3OBIA 2BA9A 2QV6A 2MKHA 1IKWB 2RDDA 3US5A 4I7FA 2LEPA 4CTAA 1W2BR 5BR8J 1R43A 4I0WA 3CSKA 1MW7A 1XMQF 1N34F 4B08A 1TKTB 4LT6A 2VA3A 3M05A 2C2NA 3ISZA 1RTIA 3EE3A 2LXFA 2VD3A 2H54B 3NGUA 3JAMY 4ECUA 4KAIA 2CPYA 2NR0A 3M2VB 5E3QA 2AX1A 5DG7A 4ZCMA 2UZAA 1FRJA 3FCHA 1D09B 4RW8A 4ZP8A 2QMUB 2OPRA 2YPYA 2DRDA 3BGLA 3T1YF 2K7JA 2R8GA 3VAFA 1CQNA 4HTJA 3D5MA 1X9MA 4DFJA 4V19J 3LPEA 5LM7E 1IKVB 1X9SA 5HVGA 1RBOB 1F5AA 1LEOA 3H98A 2QLFB 4DX6A 5EUHA 4ZDNA 2V50A 4CLSA 2W2QP 3DRYA 2FY1A 2WVFA 3TANA 2E7XA 2KXHA 3GMGA 3ZTPA 3I9ZA 4K4SA 3DLHA 4MTPA 3D0HE 3KYLA 1DTTB 2H48B 3M8QB 4AL6A 4KTQA 1GTEA 3CB4A 3GG1A 1Q1KA 4MKVA 2GA7A 1SI9A 1RTHB 2RU9A 2E29A 5G4DA 2RU3A 2XC9A 2BBEA 4O4GB 2MQQA 5AXMA 4LR9A 3C8YA 3OVBA 3HJVA 1U0HA 2HFOA 3P45B 5DRKA 1EQMA 2PC6A 3MR7A 2V4RA 4GVBB 1S5ZA 1OSCA 4JI6J 2CDQA 4RW4A 2M5YA 2UUCJ 3H5YA 4RO0A 4KBIA 2OI2A 2V34A 4YB7A 5F8HA 3EDRB 2J8AA 3M8YA 1RB0A 1YRTA 1CJVA 1BE4A 3RB4A 4OLPA 2W4CA 1KDNA 2GX8A 3I87A 1VCTA 2ZUAA 2XY5A 2VC1A 3FKBA 2R7RA 2ZKUA 4XPCA 3IWLA 1UWBA 2B56A 3P96A 1VQ6S 3RB0A 4ZKAA 3U02A 4KKOB 1F9EB 2UVWA 3HFKA 4FYXB 3P5TL 4WKYA 4JYAJ 1SH3A 4JI1J 3A3NB 2PEBA 2C1EB 4CQ1A 1VRTB 3RU0A 4CYUA 2PE8A 2MKJA 3FGVA 4DEZA 2CJBA 4AQYF 4ID8A 3MMCB 3WZ0A 1NUEA 2GVZB 5LMUJ 1V3ZA 1RT1A 2YNIA 3DHWC 4MJKA 2IYIA 5HSPA 2C2EA 1EETB 3BGUA 4ZPTR 1VR6A 1TL1B 1SJ1A 1ZA2B 3C6TB 1WSVA 2ROGA 1XK8A 2J7UA 4CT8A 5C7PA 1MMLA 3AJ2A 4QU7A 3N5FA 2HS3A 3W62A 3M8SA 3UDCA 3P3DA 2K8GA 2WSCC 2J6UA 4QU6A 4CNZA 2YNHA 4GKKF 1ZZFA 4IQMA 1S59A 2MQNA 4LRFA 1C1CB 1ZPWX 3BSCA 3J7YI 4ZVRB 2J7KA 4KR0B 4FF1A 1RSCA 1FKPB 4EGLA 1D3WA 5A8KB 4ZLJA 3I9V9 4XTTA 1CSJA 5KFGA 5IT9U 1X9WA 2CUYA 5AT1B 4B9UA 1R8PA 4BBYA 1RU2A 4IG0A 2LA4A 1K1SA 4XAKA 4B3OB 1WEXA 3TQEA 2HVZA 1WACA 4Q8FA 4PABA 3G8SA 3EZUA 4NLWA 1U1OA 3JYTB 1FNOA 3Q8VA 4CRJA 2K7KA 2VG7B 2UUBJ 4GKJF 1JXLA 4OZLA 1TL7B 3TAMA 3VGUA 4DV4J 1VRUA 5LSRA 1NKBA 2ZH7A 4C8KA 2PEHA 3W60A 1HD0A 1JQGA 1AROP 4PWWA 4DPOA 4Q0BA 1FTCA 4RZRA 3EUNA 1DLOA 4N41A 4KJIA 3ILIA 3I31A 2DR5A 1HLWA 2AEFA 1TKTA 5I3QA 3M8WA 2R2RA 1M5PC 1RT4B 1HW8A 3JSYA 4QW9A 1PAUB 4PQAA 2QYCA 4NLVA 4PG4A 1P1TA 3SIPB 5ADZA 2AJ0A 4Y34A 5D0EA 4F67A 2NCKL 4X65F 1NK4A 4ED3A 3LP0A 2VG5B 1N33J 2DGXA 3CCUS 4DUZJ 5IC6B 1U4BA 1HNWF 4CM2A 2GMHA 3RAQA 3NCQA 3ITHB 2W8LA 2D3ZA 3I4HX 2GQQA 1X4AA 3TZWA 1IN0A 3D28A 5AE1A 2QT7A 1FRLA 2A2CA 2Y8WA 4UW2A 3QT6A 3J81j 4DV3F 1GQEA 1RADB 3PW7A 3MMBB 1NO8A 2LU2A 2UP1A 1NEEA 2P9GA 4RUCA 3C3LA 1R3NA 2XLIA 4ERDA 4K4VA 1DTTA 1TL5A 3PW2A 4USHA 1UL3A 4USJC 1S6UA 1PBAA 3PYFA 4K5SA 4O4GA 4DV6F 2KRRA 2ZKTA 2R9LA 4RU9A 4IKAA 5B7WA 1TV6B 2QMWA 4UF4A 4DV5F 5CQGA 3GR1A 4OI0A 5D77A 1DZ5A 4FYWB 3PIOQ 1NHKL 4F25A 4KIAA 1HKAA 3IMQJ 2R7QA 2ZJQQ 1KTQA 4DU7A 4IH5A 2BKOA 2L3MA 4PXCA 3F0NA 4ES2A 1T05B 2DR8A 3QYYA 3OUYA 1VBKA 2BW7A 2ZBQA 2ADCA 1GMWD 1ICEB 1YJNS 3RAXA 1S6QB 3TQ1A 3RW6A 2RQMA 2KXFA 4OX6A 1A9NB 1XR6A 3AB4B 3VF0B 4MIBA 3PYEA 2D7SA 4DQQA 2RAQA 3MEGB 3EVOA 2JLEA 2DO0A 4ZIVA 2XMKA 3GG0A 2HNDB 2OHDA 3PYGA 1RT5A 1NAQA 4H4OB 2FD2A 3M8PB 2J9CA 4NLUA 2ZBCA 1VI7A 1HW9A 1EP4B 4URQU 3V6KA 5B0BA 1V3SA 5KFSA 3UW1A 3I0SB 2JFKA 4CH1A 3D0GE 5JXSA 2KI2A 4CO2A 3PEJA 2F63A 2HHUA 4GVLA 5U47A 4J9VA 1Q81T 3ENQA 1TL1A 3C6TA 3LOUA 4LR7A 1HARA 1TK0A 4OYIA 1FFWB 1YRUA 3PX0A 4DR5J 1TUWA 5GAGI 2KJVA 1WDDA 3Q8YA 4WTYA 5I3UB 4QIGA 1J5EF 4WZQA 2RB7A 4HHJA 5A8KA 1VOMA 3HHEA 3VGTA 2HGLA 2KHDA 8AT1B 1IVZA 4QR2A 2FQQB 1U48A 3MWBA 2OGUA 3LH2S 1SL1A 1FDNA 5IM0A 1RT3B 3THVA 2HVEA 4P75A 2YXLA 3AD8C 5D0RA 3KK2A 4EO8A 3N6NA 3TEHB 1S10A 2XZWA 2DITA 4MFBB 3TW0A 3ZTOA 4GRSA 4OMFG 2AWZA 4DR2J 1N4LA 3IFEA 3TVYA 2BACA 3MMAA 3HVTB 2XMVA 1EAYC 2YTCA 1KOOA 5F8NA 2QL9B 3POTB 3TJ8A 3CCTA 2LDYA 2GW8A 5FLXU 3D7SB 1G1XA 2L41A 2UUAF 5J2PB 1LQ9A 5KG4A 2BR0A 2B6AB 3FBEA 5IXUA 4NLOA 4IRCA 4QBUA 5C2CA 2B0GA 3CC7S 5CZVA 4RNOA 1U1QA 1RACB 5GAEU 3PR4A 1NHUA 3BREA 2I9SA 1FNMA 3BYPA 1S1UB 5JUMA 1R8BA 3SCKE 4IH6A 4DR4J 1VQLS 3LAMA 1P1LA 2MMYA 3RBDA 5E0OA 2CQ3A 2BJ9A 1ZTWA 3ETMA 3KKFA 3M30A 3IBWA 4RLEA 2CPIA 3RB6A 2B9WA 2Y0SD 3BV8A 3TVKA 3T9ZA 1IM6A 4DL3A 3BPDA 2VG5A 4NA1A 5H9EK 4YHHJ 4LQ3A 3NCRA 2RRBA 5B0CA 3FRYA 5L46A 4ZPCA 1DJ0A 3UE2A 3ITHA 3QRRA 4WF9Q 1XR7A 1IM4A 4ZJQA 3VAMA 3J80Y 3JXOA 1B0PA 5FIIA 3M9NB 4DS5A 1SKWA 5F8IA 3MMBA 4QWBA 2AD9A 2VUGA 5D0GA 2QYGA 2BE2B 4J9QA 2RRNA 1JLBB 1RAFB 1NM2A 4L3NA 5CABA 3DLBA 1L3UA 3RUBL 1N5YB 1H74A 4IR1A 4M5MA 1WI6A 3OL9A 3JSMA 5H9EJ 2ZVSA 4UUWA 4HI2A 3OHBA 4N7TA 3G71S 4C98A 4Y2MA 3DOMA 5LSOA 3PO4A 1OYEA 3WIVA 1HFEL 4Q5VA 3GCWP 2YQ3A 4DF8A 4F3OA 1VDHA 1T05A 1S79A 1NJXA 2EEYA 1URRA 4LRAA 4W98A 4UQGA 4NYPA 2ZFHA 3PJXA 4EFAC 2CYYA 2O5DA 4FNIA 4ZPBA 4X4OA 2UXBF 4LF4F 1VS3A 3W8PA 3NS6A 1SL0A 1GX5A 1IBKJ 3MEGA 3D6TB 1MROA 1KN6A 2DNPA 1O6XA 5F0WA 2FHOB 3G8QA 1RT6B 2ZNZA 2O01C 4FYVB 3OFGA 4EYIB 2IM3A 1QUVA 2QL7B 4DFKA 3KLEA 5KG3A 2B8QA 3K58A 3F41A 2M9KA 4AD6A 1TMJA 1VC5A 3W9HA 4PG7A 4FP9A 4K59A 3I0SA 2CXEA 2E7WA 1MWQA 2VG6B 3A1YG 4FKXA 3QO9B 2I0XA 4IO1A 2DNKA 4WIQA 2QIFA 4NRUA 3IGVA 4KGZB 2J5AA 5I3UA 2FDNA 3I32A 4TU7A 2KN4A 3L7UA 4ZPWR 2GIQA 2KFYA 3H4DA 4Q43A 2XS5A 3CD5A 7FD1A 4DV1F 1AZSB 1UFKA 3NWGA 5JVHQ 3IA0A 3UNGC 5B0DA 2A3JA 4ZP9A 4C11B 3EGWB 1O0PA 1U8SA 4MAKA 1JLCB 4CLWA 3JSRA 4P10A 2DHSA 3R8YA 1NPRA 1MG7A 2HHTA 4WFYA 1WC3A 1H38A 4QWEA 1OSDA 4N47A 3PKYA 5A8WA 5ETSA 2ABYA 4L75A 3TJAA 4N56A 5LMNF 2JEIA 2NPFA 2XB2D 1QUPA 4IO9Q 3SYZA 4MFBA 4JV5F 3R7SB 4LVOP 2XSFA 4TY8A 2ZOFA 1M5SA 3E01B 3R9LA 1PG5B 4YY3F 1Y5IB 4X84A 3I56S 3NBPB 1C4AA 1IUJA 3DI6A 3RBZA 5K20B 3L4BC 1N6QA 4YQWA 1PKUA 2LQ5A 4U67Q 2CJKA 3B54A 3T9NA 5IOLA 3DC2A 5KT5A 4F36A 4X64J 4DLEA 3LAKA 2DXDA 4FF2A 1UJ6A 2B6AA 1R31A 4O0IA 1NK9A 3FEXB 2XMAA 1TAUA 2J0WA 2XQCA 2FLNA 5HL7Q 1KONA 5IQ6A 1NSQA 1FDBA 3G96A 2XULA 1CULB 4Y2KA 1P9QC 4DSKA 2DY1A 1K47A 1WWHA 2WAQD 4CLZA 4WFAQ 1SQFA 1S1UA 5A8RA 5D0HA 5G0RA 4OYAA 3QZ8A 2HAIA 4FZVA 4NXMF 2HQCA 1FE4A 1REVB 1U2RA 1OMSA 2GMLA 4C8MA 2R2SA 3PACA 3CTRA 2CZVC 2OAUA 3V6DA 2VFRA 2HQGA 1OIAA 3KHHA 5BYRA 2GZOA 4QPTA 4USVA 1RWUA 2XZDB 1PILA 1SQGA 3SDEB 2DGOA 3AT1B 3W2VA 4MK7A 4OHYA 1PIEA 5L8RC 1SUQA 3U27A 5LSLA 4CLUA 2YKMA 3KK3A 4NOHA 5M2PA 3SCLE 4RUAA 5HMZA 3N4WA 3D68A 3DNCA 2CJAA 4QR1A 3HZEA 3CF5Q 4K8RA 4OV1A 4OV6A 5C42B 4JI4J 4OI4A 3FDSA 1UEKA 1D9DA 3M2RA 4QIFA 1K9MT 3VHQA 4RU2A 2CG4A 1HHQA 3ZTSA 3H2VE 2QRRA 3OT9A 3ZZRA 3G6XA 1TVRA 3T1HF 1U1KA 4OYOA 1U26A 4WP3A 2QFJA 5HJYA 1HWKA 5EDWA 4QIEA 1N5YA 4LF5F 4USUA 3CDUA 1TK5A 2JEGA 2ZWOA 1VFJA 2IM1A 2WOMA 1GK8A 2CJQA 3J7AN 1K0TA 3Q8SB 2CPEA 3PTWA 3QSIA 3IG1B 1FXDA 4UOFA 3IWXA 2MZRA 2HHVA 3T41A 4F4AA 5J2NB 1RTDB 1J5OB 1KC8T 2E5JA 2D9OA 3KLVA 2OFHX 2X3GA 4Z37A 2FJWA 4QOTA 5DQIA 1LW0B 2AIRB 3AODA 2LU1A 4ZVHA 4EWTA 3CJTA 1YZ7A 5RUBA 2CRLA 4FVCA 2MDAA 2C3MA 3P4UB 3W2WB 3HLUA 2CPXA 2BJ3A 4YEAA 1QY7A 2H4WB 1R8CA 1W26A 1V9OA 1HBUA 3VCDA 2RHSB 1OPZA 4KPCA 1NB2A 4H4MB 3V2UC 4DN9A 2B4VA 2HVHA 2K2PA 2YNFB 3BH6B 1D0EA 2E5IA 3PIPQ 2G1DA 1JLQA 2D3UA 4ATNA 3ENAA 3CMAS 3ZZUA 2HBQB 4PPZA 1E6YB 3KMQA 2IHR1 3RW7A 2LMIA 3ETOA 2J9DE 3HSZA 2GC8A 1HNVB 2ATLA 2EC0A 4IFYB 3I0RB 3TZYA 4D3GA 1XTZA 5LL6d 4ES1A 1GEHA 4DPYA 3PZPA 4ANDA 4WXOA 1AZSA 3EJMA 3HULA 4WFXA 2YX1A 4QIWD 1L5UA 1Z2ZA 3GFXA 2FVQA 4DLGA 3DRRB 4U96A 3BZQA 3HSJA 3FFIB 4U7UD 4LIRA 3ZTRA 2IPOB 2QX0A 4DI6A 2B4UA 3M8ZA 2N7YA 5AE3A 4YOEA 4PQUB 4CO0A 1WTFA 2F4VF 2D41A 2H65B 4HT7A 4NXNF 3LGHA 5DDOC 3IS9A 3PW4A 3NBPA 1WG1A 1IR0A 1QAIA 4ED0A 1XJWB 5IC4B 5SUHA 1KD1T 4N77A 1Y00A 2RS8A 1D8YA 3BQ0A 1YVFA 4J37A 3ZZTA 5J2MA 2WTFA 4FYDA 4C3LA 3R7BB 1BY9A 1APSA 1T3OA 4HLBA 4PPDA 2XZTB 1V5VA 3R5JB 4QZVB 1RT7B 3CW2C 4KHRA 2X1BA 1S1WB 3D66A 4DWIA 1CULA 4WZMA 1SJ4P 1DARA 3N9UC 2J0XA 4EI2A 2IAJA 3LP1B 4ZMMA 2CQ0A 4DV0J 1RHUB 3GWCA 2LCWA 4QWDA 1OS5A 2XO6A 4NLDA 2W25A 1HQUA 3MEDB 4CM0A 2DIVA 1FE0A 3C19A 2E9RX 1CPZA 4YB5A 4LBPA 1DTQB 3CEDA 1WSRA 3MEEA 2IJNA 4J9LA 2BE9B 2OLWA 4O44B 2GJ2A 2Y1JA 4O3SA 4DCOB 1HYSB 2IMOA 1RAEB 4Y0FA 3HKZD 5J2QB 1V6HA 1JLAB 2GV1A 1HIYA 5EHHA 1H0HB 4WWSA 3JSBA 3MPWA 1YRXA 2KU7A 4NX9A 4RW6A 9RUBA 2C42A 4MKAA 3UD3P 2M0GB 3P8BB 1U09A 1Y3JA 1NSPA 4ZPVR 2R8JA 2CFXA 4PEOA 5E3CA 2BANB 4K4TA 2BJEA 4KGXB 2WBMA 2ILZA 2AF6A 1HMVB 2UXCJ 2B4OA 1HQEA 3HHLB 3M6VA 2DNGA 4LF2A 2CIMA 5KT2A 5IWAF 3L7PA 4CLYA 1KQKA 1QE1B 5LXYA 3I96A 2R7VA 5KOWA 2OPPA 2N3OA 4A8YA 1WKLA 4JI8J 4W92B 2Z56B 4LRBA 4ZVPB 3J81Y 4G3IA 1NZ8A 5ETRA 4ZJOA 2PMWA 3W64A 2IC3B 4ZHRA 2WCXA 5J2NA 4USWA 1TKZA 2XCAA 4P73A 3G4SS 1NJWA 4X66J 5KFJA 1TUVA 5HQMA 1C1BB 4WKRA 3IM9A 4UOCA 1X5OA 2HBYB 5THWA 3IXQA 4WFNQ 4KH0B 2QGFB 4UTGA 2RKIA 2YKPA 4ED7A 2G2OA 3HO1A 1KOHA 1T9UA 4LFCF 4L6V3 3DLGB 4I2QA 4E8UA 3VAGA 3GE9A 4TNOA 4DR6F 1RGVA 1RT2B 1RXOB 5L38A 3U7JA 4OI6A 2W4PA 4ZVOB 1XMOF 3EM1A 1IBMF 3OPKA 1IQZA 4DV3J 4K4XA 1T0TV 4M5KA 2FVSA 1T95A 3DLJA 3GIMA 3AJDA 2I5JB 3H25A 1KRPA 3M7VA 2OEJA 3L09A 5ETOA 2GMJA 4B3TF 1X0PA 1I6JA 3TYTA 4KRWA 2AJ2A 1TP7A 2PDAA 4O3OA 2GQ2A 3GCXP 3IGNA 4I1TA 5AXLA 2J9EA 2AEMA 4RNMA 4NA3A 1GXTA 1ZTTA 2W24A 4C4WA 2HZAA 1HNZF 4K0KF 1BWVA 3HDSA 3TEGA 4OJ1A 4NEYA 2JEJA 1NKEA 3CWJA 3F56A 1X4CA 4J9SA 4J90A 3D3CJ 2NXNA 4LF9F 1KQFB 1MWYA 2XHCA 2H5JB 3NOGA 3DRRA 2YKQA 1R7IA 1FWPA 1GAOA 1S9GB 4DL0C 2BZ2A 4KFBA 1RWMB 3GJQB 4M94A 3HCXA 5HROB 5KG1A 2V2VA 2B5JB 4G6VB 1HBMB 2RSQA 1I94J 4KHPJ 2VQFJ 1WC5A 3OSNA 4JBCA 5KFTA 4WYLA 4DL4A 1VHIA 4PQUA 3UCGA 4GMKA 1KP6A 1ZM2A 2EKNA 3GR0A 3ONQA 3G2XA 4A8SA 3HT3A 1I51B 2BM1A 1URNA 4NE9C 3DU6A 2AW0A 2ZM6J 1MMDA 5HBMB 2LLZA 2QL5B 3AQOA 3SCJE 4E98A 2KFZA 2GQCA 4RWXA 3BS9A 3OL8A 3A4TA 3LF0A 4KV8A 2CJ9A 1PC5A 4NLTA 3CJ2A 3MMJA 2WK4A 2XLJA 1N36J 3OV7A 3CIZA 2JJ4D 2RH3A 6FD1A 2UVVA 3H0PA 1OJ4A 1RT7A 2VBWA 4NEZA 3IRXB 2KZZA 1S0OA 2EK1A 3CDWA 4B17A 1T9WA 3H7HB 2PMZD 3TUIC 4O3RA 1S0NA 1BQXA 3KG1A 1MNEA 4IR9A 1EKSA 2VDIA 1VQ5S 4DPTA 4IOBA 3B82A 4LFAF 1E6VB 2NXJA 3T6JA 4P7TA 1XMBA 1X31C 1SV5A 1L3VA 4UUXA 2YNGB 1VLYA 1LW2B 1SVDA 1UVJA 3S6EA 5HLFA 3MM9A 3T5KA 4NA2A 3UR3C 5CH7B 2A1BA 2ATCB 2DHXA 5DLGA 2UXDF 2FIUA 4P6QA 1T9XA 3TRGA 4BCAA 3UDLA 1SC6A 3C15A 2VC0A 1SBRA 4QYZK 2MQPA 4AYBD 4C0BA 2WONB 4Z7CA 1BXNA 1IBLF 2OPQA 1HBOB 1M5HA 1AXQA 2A6OA 2XHWA 1KFDA 2BANA 1NKCA 2VKZG 4E2FB 4HDHA 2IBOA 1TFYA 5ETLA 1HMVA 4P2FA 5DM7Q 1BMQB 2MHEA 3HHLA 1JB0C 4ICLA 4CO5A 2YQ0A 4NZ0A 4B3RF 4JP8A 3JTNA 2EFOA 1RK8A 1NH8A 7FDRA 2FHJD 2DCUB 2DPIA 3DMJB 4YDXA 3TO8A 2X3DA 2XTJP 3NL0A 5D3GA 1QAXA 2KTQA 2E44A 4QR0A 4OYZA 3PM9A 1KBRA 4JI0J 4R8UB 4HH1A 3AH6A 4DDFA 5A0YB 3RR7A 4QYZJ 1PBUA 2MQMA 4YR2A 1JLFB 1Q8LA 3BPSP 4O3PA 2OH2A 2HWIA 1C1BA 1S97A 1MN7A 1Z2LA 1JK9B 4DCPB 2XM3A 3SCIE 1FWKA 4DV7F 3NGDA 1KTVA 2YPZA 2F4FA 3DGPB 1S72S 3PDNA 4IOAQ 4OZ0A 2EG2A 3OTBA 4F26A 1M0SA 3IC1A 1Q8BA 2LA6A 2JLFA 1RT2A 2E1RA 4UT4A 2DNNA 5HO4A 5AXNA 2O67A 4KC5A 1ZBTA 1R0AA 1Q16B 4G1QA 3K57A 1RHJB 3OR1A 4H4KC 1PYTA 3O2IA 3UCZP 4K2XA 3R5BA 3L3CA 3KG4A 3MUTP 3OTDA 1GMUA 1FO1A 1P6TA 1CJUB 1WF2A 3QLHA 2DEJA 1RAGB 3M1VB 4N5SA 1XIQA 1U45A 1F5BA 3NMRA 3NOCA 1JJCB 4RW9A 2W7PA 2HZVA 5HQLA 1T9VA 2DRBA 3RRGA 1U1PA 3UN5A 4PG5A 2NUUG 4I7FB 3KNGA 3LGNA 4EBCA 2OD6A 2P5VA 1S9GA 3VZIA 2MKYA 2Y1IA 3KLGA 3FUYA 5ETPA 1L3TA 4QCLA 3GLJA 4O3NA 4DR1F 1N32J 5C24A 1HBMA 2HQ3A 4J9UE 3MZIA 1CJKA 2GNKA 2JLGA 2ZBIA 3T5HA 4ZIWA 3PR5B 4HYKA 3PFEA 2Y3YA 2ZC4A 4RW8B 3PVXA 4OX9J 3GONA 3DOLA 2G1HA 3C6UA 1H73A 3KJFB 3A8IA 3MPVA 2C2MB 3SMZA 2BQUA 2JVOA 3Q2SC 1X5SA 1B0VA 4WFZA 4FNHA 3OHAA 2HQDA 2BRKA 3EGZA 1RA7A 3H2LA 1QSSA 2VPWB 1EB0A 3NKYA 2W4DA 3ZTQA 2YQ1A 2HMIA 1G6BA 3LGMA 3DRSA 1QVFR 1YX2A 3HXMA 2G0JA 4CO3A 1X4GA 6FDRA 2A0FB 3R5AA 3DKDA 3G87A 4YB1P 3MR2A 2C28A 3CJQA 2VFVA 4OI2A 1NBEB 2L48A 4S0MA 2EPIA 3VAIA 1KEKA 2DCLA 2FJVA 2QE5A 3U1LA 1GT8A 4DV1J 3MPDA 2MZSA 1N48A 3DM2A 1Q8IA 3SFGA 2HSEB 2BOAA 4DUTA 2ZH3A 1Y5NB 3BSAA 3MR3A 4B3SJ 5ETMA 3MEKA 4X62J 1U0HB 2AGOA 4X4PA 4NLRA 2VF3A 1J27A 1SL2A 4MIWA 4RW4B 3CJ5A 4CO4A 1FX2A 3CDBA 1HHSA 2G13A 2NREA 2CZ9A 1I3OB 4ZLLA 1LW2A 2UV8G 2BEFA 1CJVB 2R7WA 2YH1A 3MM7A 2MY8A 4URSA 3FMBA 3S7RA 2FYXA 1UZDA 4M5IA 5KFPA 3MURP 2IRUA 2GIRA 4WP8A 1UWBB 2WONA 4ID5A 3J7ZT 3CNQP 3PEHA 1RZMA 4NCGA 5I4MA 2UVUA 3ZZPA 4EU0A 3GSIA 1HWUA 5F3TA 1LK5A 3MECA 1RU1A 1OY8A 4CYUB 2FHMA 3LWMA 1CJTA 4WK1A 4BHQA 3QRQA 2M7SA 1SIZA 4OFZA 3NG8A 1RT1B 2YNIB 3SQGB 2HAFA 3PHTA 3K5NA 2CPJA 3HHDA 1N5QA 2MKIA 1KVJA 3CE8A 1ZM4A 4R8UA 1FCAA 1U25A 1JLGA 4DL5A 2VOPA 2YNHB 1T9YA 2PN6A 4JI6F 1VLOA 4R0JA 4C6AA 4YP3A 2XG8A 3DXBA 2C3YA 2UUCF 4IOCQ 2RRAA 1VRQC 2HKEA 3LO3A 4UOGA 3DGPA 1F3FA 1W7WA 3HSDA 2HHQA 4LBHA 2NPIA 1IJEB 3IP0A 2JNJA 4LR8A 3FEYB 3CCES 3ZNJ1 3Q89A 2H5EA 5KTQA 3N0VA 3DLKB 1FXRA 2ZHOA 4MK8A 5AXKA 2M3DA 5B09A 1NJZA 4NCBA 2OEKA 5KFWA 1AA1B 4B3MJ 4IG0B 4DZDA 1VBYA 4MT1A 1RLDA 4ZJLA 3B8HA 3A8EA 8ATCB 4Q45A 3J7A1 2ERRA 1QTNB 3O6QA 2ZH9A 1JXEA 2O1PA 2W2NP 4JI1F 3ZZOA 2D74B 2QLBB 1I5OB 5AE2A 1UAWA 4XPEA 4Z7YA 3DLEA 3PNIA 2MQLA 3IBFB 3ELHA 4ZVGA 4WYWA 2W2PP 5LMUF 1U7LA 3HVWA 3LALA 2W9CA 2P6TA 3CCSS 5EN1A 2QLXA 3MM5A 3AOCA 4K4UA 3TAMB 2HNZA 1VK3A 1VRUB 1RBAA 1YWXA 4IH7A 1F0XA 1UTAA 1GXLA 3VWSA 3NGRA 3VVUA 1XNRJ 1DLOB 5DM6Q 3NNHA 2XEXA 2E5GA 1T7PA 1Q5VA 3TARA 4C0OC 5KG2A 1F1BB 2V8DA 1SIWB 4Y2AA 2RQKA 3UD5A 1KLMA 3VR1A 2V5HG 1JKHA 3DGVA 1PGZA 4V19X 3QIPA 2GGPA 2ZBPA 2GJFA 4L73A 3BBFA 3KK1A 3I82A 3OSPA 1HR0J 3SV4A 1EKRA 3LP0B 2H9ZA 4LSZB 4QQBA 3EYZA 3K8VA 4OJ3A 2NSBA 2E1CA 4H54A 4UOHA 2VZ9A 3D1HA 9ATCB 5CA5A 1WDTA 2QJ3A 4Y2CA 3O3LA 3E51A 1RWXB 1GTHA 4KH1B 3UCUP 2AU0A 2ILYA 3K5PA 2D69A 4EBEA 3CCVS 2OPSA 3EZ5A 2UUBF 1DQAA 4QIVA 3B4MA 3TOQA 3P6YC 2V2KA 1G3OA 4DV4F 1TAQA 1CC7A 2FB0A 2DBBA 3CCLS 1TTHB 3VVTA 1R8AA 2EG1A 2EFGA 3NMAA 3ULHA 3W5XA 1Q79A 2LP4A 2OJ3A 5KFRA 5I3PA 2DIUA 2DNZA 2Z0GA 3G9CA 3CCWA 4DPUA 4ZVSB 5GMDA 4LJMA 2OSRA 1OY9A 3D1OA 5KFZA 1Q8KA 2BQ3A 2XO7A 3OUYB 4IQXA 3BO4A 2IYGA 2DGSA 2G4BA 3M2UA 2I38A 3CCZA 4B02A 2W7AA 2VOOA 1O51A 4B9NA 1SPBP 4DL6A 1N33F 1NK5A 5GAEI 4DUZF 2RHQB 3TZXA 1RT5B 4N8OA 5B0FA 2XS7A 1FJEB 2MLXA 5L1IA 1N5VA 4M5NA 3TNVA 5CD4H 4LRCA 2V4QA 2DNLA 3T5JA 1IWGA 4YMEA 3QPIA 2V0NA 3FCVA 2Q1LA 1Y7PA 1CLFA 4I4BA 3SQGA 1N0VC 4JI7J 4M95A 2E1MC 3W1YC 5LJ3Y 3R27A 3H5SA 1AYEA 5E3RA 3MF5A 3CPWR 1UETA 1WG5A 4F3MA 2YH0A 3KHRA 4U7UK 1NLKL 2V4JA 5CCLA 3EICA 2EXUA 1FRHA 1M90T 3K7RA 4F7VA 2QO3A 3LTOA 4YR3A 1QAYA 1X60A 3GZ7A 1T11A 5CYMA 4LIWA 1C0TB 2FVRA 1N56A 1GH8A 2HLTA 4BWJA 3TUPA 2LECA 4MKYA 3AB2B 2JC0A 2K3IA 3LW5C 3DOKB 4KT0C 1RI7A 1WI8A 3DLKA 5IM0B 2FC8A 4ZN1A 2XMMA 1RWKB 2J8SA 3NGTA 1RWOB 3GIJA 4HEA9 3C66A 2B9XA 1X4FA 3KK2B 3GFZA 4Z2XA 1HBNA 4J9RA 4PYAA 2QLWA 4ZVUB 2J76E 2BOPA 2SXLA 2CNLB 5FDLA 3EVWA 3MMAB 3AA9A 3OTOJ 1SKSA 4NZ7A 4O0NA 1IR2A 2PA8D 3KUEA 4X4TA 2ZZMA 3RR8A 2HHXA 5BYQA 3EWGA 1M5KC 2VQEJ 2VFUA 2KVQE 1IR1A 4LBIA 2ALYB 1UW9A 2AZ1A 3FVYA 4P2XA 3CMQA 4IDKB 4DR5F 2C22A 1TL3A 2Z2LA 2XI3A 2GFFA 5HATA 4ITSA 2VFSA 5IQQA 5KT7A 4AUKA 3OTCA 3N5BA 5KFBA 4WK3A 3GQCA 3HX9A 4LFCJ 3D9BA 4JI2J 4ED2A 2LFVA 5B08A 4P74A 3M30B 2GVDA 3NLCA 3Q23A 4MKBA 4C7QA 2YWEA 4B9MA 2ACYA 3EX7B 3LANA 2MJNA 1ZAWA 3BR8A 4ECTA 4ALZA 3LQVA 3EXCX 4DR3J 1YQHA 4EZ9A 2EI5A 1QD1A 3Q8PB 1UJ4A 1XN9A 3PX4A 1D9AA 4DHVA 2FUG9 2RIJA 4USMA 3PRVA 2OO4A 5CXTA 2G0CA 3I55S 1DQ8A 3QRPA 4YR0A 1SH0A 3BN4A 3V6JA 3RZAA 4DF4A 3PY8A 1Q0NA 4KPYA 4CDIA 2W2MP 5GAHU 1A0OB 2APOA 4ETZA 2DGVA 3R3TA 2ZDPA 5E5NA 2IJFA 2LXIA 1DFDA 4RBTA 3DDKA 2DO4A 1KHWA 3I5AA 3JSMB 3WBZA 4M63A 1S77D 4Q7AA 3SSSA 3DOMB 5K14A 3DYAA 1BLUA 4DR4F 4OIXA 1T94A 1S1TB 3CGIA 2UVRA 2EK6A 1Y4ZB 1KKHA 4G1PA 2QA1A 4DR7J 2HGMA 4HTIA 4OYWA 2KKHA 3RJMB 4TLQA 3UWTA 3H20A 1VQOS 3FBCA 3R5CA 4ED1A 1MROB 5GADU 4YHHF 1NU4A 3NGKA 5A6PA 5E3AA 4YDDB 5IT9Y 5EX0A 1NSKL 1S1XB 5KFOA 4I6AA 4LSLB 2RT3A 4RR5A 2MPUA 1U47A 2HWTA 2I1RA 2DTJA 1H2TZ 3NGSA 3KLEB 2NLWA 1N5SA 2MSTA 2HK2A 2P6SA 2U1AA 3FSYA 4NLGA 4DG1B 1U02A 3UDVA 1REGX 4P7VA 2D3O1 2PD1A 1SC3B 3OXLA 4B9SA 1VIXA 5B0GA 3C16A 4C8YA 1QVGR 2B51A 3M9MB 2MKCA 1PO6A 5H1SV 4I56A 1WC6A 3B6BA 3V4IA 1WHWA 2KB2A 3QNWB 1RAAB 3V5RA 1U1MA 2DRAA 1NHVA 4ZA1A 1R0BG 1FK9A 3CD6S 2M4MA 5HQ8A 3O1LA 4EK2A 5KFDA 4ED6A 2X1GA 3TAPA 1GMWA 3UI3A 3DDIA 4V1Ak 3Q24A 1C0TA 1LK7A 2CVIA 2A6MA 2YWFA 1X5TA 2UXDJ 3DOKA 2WVEA 1VQ4S 2E9TA 1IBKF 5A8WB 4TVAB 5A6WA 1RP5A 2CNKB 2H3EB 3QSYB 5F8GA 1NMEB 3MM6B 1TQLA 1SH2A 4YS2A 3OXFA 3Q83A 2NSCA 4TY8B 2ZC3A 2LQBA 2EBEA 4ENOA 5JJBA 3PO5A 4B3RJ 4DOZA 2HS0A 1ELOA 3C14A 3DI6B 4JI5J 2K06A 2YWKA 2YWGA 3QATA 2P9EA 2BXJA 1N6QB 1ZM9A 1NH7A 3W61A 2VU5A 2DNMA 4UZCA 4A8XA 1M1GA 3BR9A 3NWRA 2NYIA 4DBQA 2CJYB 4RL1A 1SKUB 5L1LA 2K1RA 1R27B 4ZLPA 3HKWA 4IDKA 4LFBF 3MAHA 1UEVA 3MTJA 2RF2A 2BKPA 2ZVIA 3FCWA 3VAJA 2ZD1A 5GMKa 2CDRB 1UVIA 1SC1B 2HVIA 2V94A 2HFUA 3FQLA 3JAMU 3AQPA 5A8RB 2EFVA 1B70B 5G0RB 5T7LB 3C46A 4HVZA 1DURA 3FNNA 2ZE2A 4RPFA 2DPJA 4KO0A 3BDEA 3PW5A 1VC0A 4JV0A 4TU9A 1ROFA 4U8VA 3T6BA 3V6DB 2AYEA 2DGTA 3CUNA 2GO9A 1O5JA 3IR5B 1K8AT 1WTBA 1RABB 3GU0A 2RNEA 3N6MA 2UUWA 5AJ3J 4OI3A 2BJ7A 4F04B 1H6KX 3W2VB 4KGVB 1B3TA 1HHTP 5C2GA 2M52A 4ZP7A 3S8SA 4C8OA 4A8MP 1SUQB 1T3NA 3CCMS 2YKMB 3KK3B 3BO2A 4OZNA 2KRBA 1FKOA 3TX0A 1S0MA 3OL7A 1UCNA 2UV8A 1S9EA 1K0VA 4M8LA 1MLAA 2BX6A 1S6PA 2NYHA 4LSNA 4JI3J 4C8LA 3ILOA 2HNYA 4M1KA 2PI4A 3HD2A 2FLLA 3M2RB 1N54B 3ICLA 3SXLA 1ZYQA 3H5UA 1VGYA 4X64F 1TVRB 3NS5A 4F4YA 2UU9J 3K17A 5GVQA 1WD6A 2PFFB 2Z2ZA 1JNRB 4ES3A 4OYPA 4FXVA 2VJUA 2P2CB 3QAUA 2XS2A 4WIIA 4WCEQ 3I6PA 3W3SA 2WOMB 4DSJA 2XWYA 2ASJA 1FJGJ 3MTKA 2Q6BA 4UQTA 2P9CA 1S7IA 4GO7X 1S1TA 1N8RT 4YN3B 4X4UA 1U1NA 1ZM3A 1M5VC 5T41A 2VHGA 2XI2A 4ZVFA 2NXEA 3FSXA 4ECWA 4DL7A 4P2SA 3EPGA 2DVIA 3LPYA 2ZNYA 3MPYA 2BW2A 5BJRA 1JMTA 1HNIB 2M2BA 3W66A 4EUVA 2P8IA 3Q8RB 1S1XA 1FFGB 2JX2A 1ZZNA 4LF1A 3OLAA 3IBCB 2BYCA 4LSLA 2ASLA 1VQSA 5K8OA 2CQ1A 4X4QA 1XR5A 3DRPB 2N82B 4JI4F 1YZ6A 3QJLA 1HBUB 2COLA 5HP1A 1IKXA 2PMHA 1S49A 4DG1A 1X4EA 1RAJA 1FERA 2V8PA 5HVHA 5D4PA 2ZEJA 1VQYA 1OYDA 4NI2A 1JLQB 2OP5A 2ZDOA 3MCNA 3SBMA 2W2OP 3G82A 1QJHA 4DV2J 2V8VA 3BSNA 5FLXY 1QAJA 1DAXA 5KT3A 4TU8A 1JJHA 3G6VA 2CQHA 4LF8J 1D1UA 5EX3A 3KG0A 1MMNA 4DX5A 3GYXB 1G2EA 3KJQB 2EVZA 2DD8S 1RUSA 2V2QA 4M5HA 1SJRA 1XERA 2V68A 3PFOA 2G0IA 1Z4UA 2KM8B 1PJ5A 2X51A 2FGCA 3AHPA 4F2SA 4FF3A 2GO8A 1KS2A 5IT4A 5K8NA 3DHXA 3QFWA 3BBBA 1HPZA 3W9JA 4F4ZA 4PYDA 4BDPA 5C25B 4B9TA 2DISA 2NZCA 2WHOA 3CJ4A 2MGZA 3SFUA 5E7OB 5D4LA 2RQ4A 4LF6J 1Y0HA 3MM6A 3J7Z5 2W9BA 2IA0A 1FXLA 4FF4A 2IY5B 1FWLA 2OUGA 1S48A 1A6LA 2AJ4A 3BQ2A 3PJWA 5MAOA 1UW4A 4K2JA 3IS9B 5CCMA 4QW8A 1RBLA 3MR6A 4X4VA 1F9HA 1R8HA 4IRKA 1ZPVA 4I2PA 1S76D 3FQKA 2F9JA 2DGQA 4NCAA 4QWCA 1SCJB 3KLIA 3QQCD 5J2MB 4O23A 2LQ8A 3CCRS 4FPRA 3R1LA 4BLGA 4PXBA 1VISA 3TJ9A 3HPOA 3UN3A 2OTJS 2N4CA 5K8PA 2VKRA 4NZ6A 2D3OR 2Q6CA 2X1AA 1FDAA 4X2BA 2KXNB 5J1EB 2DNRA 3MOJB 1BC6A 3PCOB 2IAJB 3AY0A 3NAHA 2RE1A 5F8MA 2MKSA 3LP2A 4P2MA 3IO1A 5T7LA 4ZCKA 1VQ9S 4OZ3A 1HQUB 3KJVA 3HFVA 3K5LA 2Y1LB 3PV8A 1HQ2A 3TAQA 4FBTA 2MEWA 3T5LA 2RVJA 1FRIA 3MEEB 1VC6A 3QGHA 3TZZA 4A8WA 5C5JA 1LXJA 4A4JA 4WE1B 3EDQB 4FDFA 1K1QA 1NNDA 3FEZA 2AEJA 1CG2A 1VYAA 3MCMA 3OD2A 3L7OA 2H1YA 4DUYJ 4TQSA 5EWEA 2ZH2A 4MIAA 4A8QA 2CJXB 3KUGA 4PG8A 4AXJA 2D1CA 5KFYA 4U6PA 4N76A 4I6YA 3WX8A 4RW6B 5KFVA 5JMNA 2OELA 2ZUGA 3EXYA 2CPHA 4KGMA 2PA3A 4OZJA 5BYSA 3P49B 1YKWA 1X8DA 2DHHA 1SQEA 2JEFA 4HKQA 1M1HA 1XNQF 2HS4A 1AUSL 5B0AA 3PYDA 3H5XA 3D6MB 3H59A 4C3KA 1HQEB 4C9DA 4K4ZA 2WW4A 2XSJA 1KQSR 3ILJA 2A2DA 4K5RA 4AFFA 1VJWA 1TFWA 1VIOA 2VBYA 3BH7B 4PWDA 4NWBA 5IFMA 1RWVB 2DXEA 3IAS9 3WC0A 4LVNP 2OPPB 4RW7A 4DN0A 3CCJS 4ZITA 1N34J 4DV0F 1UP1A 1XMQJ 3ZXWA 2O66A 3DCAA 5KFCA 4KY3A 2RDIA 2C2DA 4ECQA 5I42A 3UVJA 4ZHRB 2M8DB 1X4HA 2V8GA 3MHYA 4CCHA 1TKZB 3UFCX 5KFMA 1YBTA 2JFDA 2HQFA 2A18A 2XYGB 2HQIA 5KFIA 3T1YJ 4F3QA 1UFWA 1K73T 4J9OA 2RKIB 5FJ4A 2JSXA 4MH8A 2VBXA 1HNIA 2FZGB 1KVIA 1RTJA 2POKA 3GJTB 2IM0A 3X1LB 4I2QB 5KG0A 1YJ7A 1AB8A 2Z58B 3OXGA 3GV5B 1ACMB 2IMWP 1ZA1B 4NLSA 4EZ6A 4FBUA 2VASA 3DRPA 4I68A 2E1AA 1B4SA 1WKKA 2PO4A 2B4PA 2F8MA 5L39A 3A3OB 4EYHB 4DXLA 2KZMA 1H2VZ 2CADA 2CWKA 2DXFA 3D67A 2UXCF 4CH7A 4NLQA 1UEUA 2RUSA 2YWHA 3SI8A 2PGCA 5HVFA 3RRHA 3G6YA 1VQMS 4M5LA 1WF1A 1NXIA 3CCQS 1IKWA 4KGKA 1RWPB 5LT5A 4JI8F 4ECZA 3WDOA 2AGQA 3Q8UA 2QFIA 2CG8A 2W8KA 3T3FA 2RD5C 1S4EA
chains in the Genus database with same CATH topology
2YNHB 4F3OA 1X4DA 2MXYA 3OL6A 2PN6A 3JTPA 4O44A 1VQ7S 1T05A 5KFHA 4JI6F 1Q7LB 1S79A 4R0JA 4Y65A 1NJXA 2V8HA 1SJQA 4YP3A 2XG8A 1URRA 2C3YA 3DXBA 2LQJA 2UUCF 4IOCQ 1WNEA 4UQGA 2U2FA 3SZ2A 2RRAA 1AFJA 4NYPA 2V9KA 1ULRA 3M2VA 2ZFHA 3PJXA 4EFAC 2ZE2B 1HYSA 2CYYA 2R8IA 2O5DA 3VTIA 3HK2A 3LO3A 4NYZA 4X66F 1FNXH 4FNIA 4KO0B 4ZPBA 3QGIA 4X4OA 2UXBF 3CDAA 3DGPA 4QJVA 3KLFA 4LF4F 5J2QA 1JLAA 1VS3A 1QSLA 2F8HA 2HHQA 3NS6A 3TUJC 2NPIA 2Z8QA 3EGNA 3M6XA 4KFBB 1GX5A 1IJEB 3M8RA 3OR2B 1SL0A 3NNAA 2WRMA 2B43A 4PRFA 3FEYB 4HDGA 3MEGA 3CCES 1MROA 1KN6A 4G1IA 2DNPA 2ZZNA 2H5EA 5C25A 5KTQA 5F0WA 3N0VA 2FHOB 3G8QA 3IWNC 3DLKB 4PR6A 1FXRA 4PXEA 2ZHOA 4MK8A 1RT6B 5AXKA 2M3DA 4K4WA 5B09A 3O8WA 4IRDA 2ZNZA 2VA2A 1NJZA 1QSYA 4NCBA 2CQ2A 4XIUA 5KFWA 3CIMA 1MU2B 2O01C 2BABA 5J1NA 4DQPA 2ZJRQ 3OFGA 2VPZB 4EYIB 2KM8C 3M32A 4IG0B 1IKVA 4OHXA 3OFHA 1VBYA 2IM3A 1QUVA 2E9ZA 3OW2R 2QA2A 3HHNB 3B8HA 3IN5A 1A7GE 3A8EA 3KHGA 4DFKA 3KLEA 5KG3A 2MY7A 3BGFA 4Q8EA 3QAEA 3K58A 1Q82T 1FKOB 2L9DA 4Q45A 3KMSA 3F41A 2ERRA 1YHQS 2JOQA 3O6QA 2ZH9A 3RBEA 3J7A1 1JXEA 2HYIB 2O1PA 2M9KA 4JI1F 1VC5A 3BGRB 4PG7A 3K5OA 4FP9A 4K59A 4DR2F 1S9EB 4B9VA 1U6BA 3HF5A 4AL5A 3I0SA 5CZXA 3ZZOA 2D74B 2XNQA 4E0DA 1LOUA 2PIIA 5D78A 2OFGX 5AE2A 2AYBA 1S6PB 3N6LA 1UAWA 4JI5F 4LSNB 4XPEA 2OD4A 4KV8B 2E7WA 2N4DA 5F0UA 2M70A 4R25A 1QE1A 4ECSA 2E5LF 2HNYB 3DLEA 3PNIA 2BVZA 1F2GA 1N5TA 3M8QA 2MQLA 2LEAA 2VG6B 4CH0S 5ITHA 1S4FA 5KT6A 3A1YG 4ZVGA 4WYWA 5LMUF 1U7LA 4ZCLA 1RTHA 3HVWA 3LALA 2W9CA 2P6TA 3CCSS 2RJZA 2XBPA 5EN1A 2QLXA 3MM5A 3QO9B 4K4UA 2I0XA 1R89A 3PX6A 4IO1A 3IRWP 3TAMB 2HNZA 2DNKA 3VAKA 1SB6A 1VK3A 3MDFA 1KR4A 2QIFA 4AL7A 4NRUA 3IGVA 1VRUB 2CQBA 3DRXA 4JV2A 2KH9A 3E2EA 5J1EA 2W9AA 1YWXA 2CQ4A 2IC3A 3IR6B 4TYBA 4IH7A 3SSRA 3FMWA 1F0XA 2J5AA 2DNHA 4I69A 1GXLA 1L3SA 5I3UA 2FDNA 3I32A 3FZ2A 2VPYB 3VWSA 1X5PA 2KN4A 4TU7A 2QSFA 3ZZ0A 4ZPWR 2GIQA 2KFYA 3H4DA 1DLOB 4Q43A 2XS5A 1MSWD 3CD5A 7FD1A 1JIHA 3H40A 4DV1F 2AYGA 3I5BA 5DM6Q 3NNHA 3NWGA 5JVHQ 2XEXA 2E5GA 3IA0A 3UNGC 3WX4A 5B0DA 2A3JA 1Y9OA 2VBZA 1T7PA 3OVSA 4ZP9A 4C11B 2LQ9A 3EGWB 1O0PA 1U8SA 3TARA 1NK6A 4C0OC 4MAKA 2QA4S 2J0SD 3BEGB 1JLCB 5KG2A 3JSRA 2V8DA 3B78A 2DHSA 3JTOA 1SIWB 1AFIA 4Y2AA 2RQKA 2HHTA 2QMXA 4WFYA 2KT3A 3V4MA 1KLMA 1H38A 4RKUC 4C0HA 3VR1A 1JX4A 4QWEA 3HVRA 1GXUA 1OSDA 2V5HG 5KFUA 2PI5A 1JKHA 3I4PA 4H4KA 4N47A 1DQ9A 2JC1A 1PGZA 4V19X 3MD3A 3DLGA 4ZOSA 3PKYA 1SV5B 5A8WA 5DETA 2XMUA 3KHLA 3QIPA 4WE1A 2GGPA 1S0VA 3RRKA 2ABYA 3TI0A 3MXHP 2AJQA 3KK1A 2HIQA 4BC9A 2DNQA 3I82A 3OSPA 4X4NA 4RUHA 5HLFB 3MM9B 1HWLA 2OMLA 4N56A 2JH3A 1KQGB 1OO0B 3NRBA 4MMOA 4ZS6A 5IT0A 5AJ3F 5LMNF 3SV4A 2FLPA 2NPFA 2JEIA 2XB2D 1QUPA 5DO2A 4KKOA 1SXLA 1I94F 4IO9Q 4KHPF 2VQFF 3LP0B 4RWWA 2CKWA 1H98A 2H9ZA 4QYRA 3SYZA 1HNXF 1AUDA 4MFBA 3V81B 3GILA 4JV5F 1HI8A 4QQBA 3EYZA 2ZH6A 1LV5A 2DGUA 3K8VA 4OJ3A 1LXNA 2NSBA 4H54A 4LVOP 3D2WA 2VZ9A 2E1CA 2XSFA 4TY8A 2JWNA 2ZOFA 5CHCB 1M5SA 2I5JA 3E01B 2HW3A 2YVSA 1N0UA 3D1HA 4F4WA 2FVPA 1JWWA 1VRTA 4YY3F 3GYNA 1Y5IB 3MM8A 4X84A 3K5MA 3I56S 5CA5A 3NBPB 4NMLA 1C4AA 1IUJA 1FA0A 1X0FA 4C8ZA 2ZM6F 3ISNC 3DI6A 4CZCA 4OHWA 4Y2CA 1X4BA 5KFKA 3O3LA 2KO1A 3MMCA 2OPQB 3E51A 4TLRA 4KB7A 1GTHA 2J6SA 2EKYA 1BQNA 5DJBA 3UCUP 2AU0A 1N6QA 4YQWA 3C2PA 3Q2TC 3V6HA 2LQ5A 4U67Q 2ILYA 2KFNA 2CJKA 3K5PA 2L9NA 5HP1B 4Y2IA 3T9NA 1EETA 4Q44A 5CYQB 4JI3F 1IKXB 3DC2A 5KT5A 4EBEA 2LDIA 1DBDA 4DLEA 1YG0A 3CCVS 4PUOB 3UPFA 3LAKA 1N36F 1SKRA 1UJ6A 2B6AA 4FF2A 4ICLB 3TA0A 3GIKA 2OPSA 3EZ5A 5D8HB 1JLEB 1R31A 4O0IA 1VBZA 2UUBF 2R8HA 1NK9A 1DQAA 3M6UA 4QIVA 3B4MA 3FEXB 3TOQA 4R5PB 1TAUA 2J0WA 3P6YC 2V2KA 2GHVC 2FLNA 1G3OA 4DV4F 5HL7Q 3CJ0A 1TAQA 3ZZZA 2R7XA 5F9LA 3TP2A 1KONA 5KFFA 5IQ6A 1CC7A 3BJYA 2FB0A 1FDBA 3G96A 2UU9F 2XULA 1RA6A 4ILLA 1S9FA 2DBBA 3CCLS 2EFNA 4Y2KA 3K59A 1P9QC 4DSKA 1R8AA 2EG1A 1WWHA 2EFGA 1NZAA 3NMAA 5SZTA 2WAQD 2XNRA 3VAHA 5K8MA 4WFAQ 4LQ9A 1S1UA 4XK8C 3ULHA 1Q79A 5A8RA 3U1NA 4GC7A 4MYUA 1JNZB 5D3GB 4A47A 1FD8A 3KFWX 5G0RA 1C1CA 1GX6A 3QZ8A 4ECYA 3NP5A 1YSJA 2HAIA 4FZVA 2KT2A 2OJ3A 4CTAB 3FJ2A 5KFRA 5I3PA 1U1RA 1QM9A 3CJ3A 4W90B 2GHPA 2DIUA 2DNZA 1HWIA 4NXMF 2Z0GA 1UA0A 1FE4A 1REVB 5HMWA 1NK7A 1FKPA 3BB5A 1U2RA 2GMLA 4C8MA 2R2SA 3G9CA 3CCWA 4RNNA 3PACA 1B7FA 3QJJA 1FJGF 3CTRA 4LJMA 2OSRA 1RTIB 2CZVC 3OFEA 2OAUA 3V6DA 3D1OA 2VFRA 5KFZA 5D6GA 4FXDA 4I67A 1LWEA 2GCFA 5HROA 3N01A 1F5CA 1OIAA 2BQ3A 2XO7A 2B5JA 3KHHA 3OUYB 5BYRA 4IQXA 3BO4A 4QPTA 3CXCR 1RWUA 2B7BB 1D9FA 4Y6IA 1PILA 2IYGA 1YITS 2FJAB 2DGSA 4OJHA 3SDEB 2G4BA 2DGOA 1KSPA 2HG4A 2I8EA 3M2UA 3W2VA 4MK7A 4TKTA 5IS2A 2I38A 3CCZA 4OHYA 4B02A 4WU3A 3UQSA 1UA1A 5L8RC 1SUQA 3U27A 2W7AA 5LSLA 2OPRB 5E33A 2VOOA 1O51A 2YKMA 4NOHA 3KK3A 1LWCB 3KOAA 4B9NA 4ILRA 4NRTA 5K9FA 5M2PA 4DL6A 3SCLE 2LVWA 4RUAA 1FRMA 5KG6A 5HMZA 1N33F 4B3OA 1HPZB 3N4WA 2NUHA 3DNCA 1NK5A 5GAEI 2CJAA 5HBMA 5F8JA 4DUZF 4QR1A 3HZEA 2VPXB 2DH8A 2L9WA 2RDJA 2MGZB 3CF5Q 4DS4A 2Q3PA 4OV1A 1U6ZA 5C42B 2XMWA 1RT5B 5KOXA 3JYTA 3GFYA 2CVEA 4OI4A 3FDSA 2W9BB 1R0AB 3W7BA 3WC2A 4ZPDA 4N8OA 1FEEA 5KAKA 4RNHA 1QLNA 5B0FA 5LXRA 2XS7A 1FJEB 1SJFA 4G1QB 3CMES 3GIIA 4DJBA 5L1IA 2YX7A 1N5VA 1OQ6A 1H7WA 1ZETA 1D9DA 3TNVA 3OR1B 3M2RA 4F02A 2R4FA 4BC7A 2VG7A 2YX4A 3CDEA 5EWGA 4QIFA 3EPIA 1K9MT 5CD4H 5E3PA 1HI0P 4ELUA 4RU2A 3PRDA 5D4OA 2CG4A 2VFTA 3H2VE 3E8OA 4I2PB 2AGPA 4TYAA 2V4QA 2DNLA 2QRRA 3T5JA 3ZZRA 3G6XA 1P27B 3HZGA 3IRXA 4HI1A 4YMEA 1TVRA 3QPIA 3T1HF 1U1KA 2CPZA 2V0NA 3AA8A 3PKMA 2YKAA 2Q1LA 1Y7PA 1CLFA 4I4BA 1IXKA 1U26A 1W25A 3QWUA 3KLIB 3SQGA 2QFJA 1S99A 1HWKA 1N0VC 4M95A 2FJBB 5DGBA 5EDWA 4QIEA 1N5YA 4DV2F 2E1MC 2CQGA 3Q22A 3QLHB 4LF5F 3QWPA 1WHXA 4UY85 5LJ3Y 4WXWA 2B9YA 3R27A 3CDUA 3H5SA 4F2RA 1TK5A 5E3RA 3MF5A 3CPWR 1WEZA 2O3DA 2JEGA 2JHEA 1UETA 1WG5A 1VFJA 2M8HA 2YH0A 4F3MA 4WJBA 2IM1A 2YKNA 4RW9B 3RAMA 2WOMA 2CJQA 3KHRA 3CT9A 4LF8F 1K0TA 4U7UK 3Q8SB 4IFVB 4TQRA 2CPEA 2V4JA 5CCLA 1E6VA 5M2UA 3IAM9 5KFAA 3IG1B 4HH0A 4OQJA 1FXDA 5DDRC 1LWFA 1FRHA 2KYXA 1M1KT 1M90T 4IYQA 2IRYA 3IWXA 5DDPC 3K7RA 2DR9A 4JI0F 2MZRA 2HHVA 2QO3A 1RT4A 2UUTA 1C0UB 4KE5A 2HRUA 3THPA 4YR3A 5J2NB 1RTDB 1QAYA 1WHYA 2EBGA 4C3MA 4ZP6A 1J5OB 2HWHA 3GZ7A 3LP2B 1QTMA 2YNGA 5CYMA 1FRXA 4LIWA 1KC8T 1C0TB 3KJVB 2F7VA 2FVRA 2E5JA 1N56A 2D9OA 2R7OA 3KLVA 1GH8A 2OFHX 2X3GA 2HLTA 4BWJA 4Z37A 2LECA 2FJWA 5HMYA 4QOTA 2XY7A 5DQIA 1HD1A 3KLGB 1LW0B 4MKYA 4O4RA 3AB2B 2JC0A 2K3IA 3LW5C 3OR2A 3DOKB 4KT0C 1FVQA 2DT9A 4CO1A 3AAWB 4YB6A 1RI7A 3PW0A 2QA4G 4DFMA 2LU1A 4ZVHA 3Q8QB 1WI8A 3DLKA 4EWTA 1M5OC 5IM0B 4C8NA 2FC8A 5C24B 2ZOGA 2CRLA 5KG7A 4FVCA 1MU2A 2MDAA 2XMMA 4CT9A 4B9LA 2C3MA 1LFPA 1S1VB 3GIJA 4ECVA 4HEA9 2XMJA 2IRXA 1XWLA 3C66A 3W2WB 2B9XA 3HLUA 2CPXA 2KT5A 2LEBA 1X4FA 3KK2B 1HBOA 4YEAA 4U9RA 2R7TA 4PXDA 4M5DB 3GFZA 1QY7A 4OLOA 1R8CA 4LF6F 4Z2XA 3M9OB 3DOLB 4OJGA 4O3QA 1YTYA 1V9OA 1FF2A 1HBNA 2XCPA 3C6UB 3K0JA 4J9RA 1HBUA 3VCDA 2QLWA 2R2UA 1SJ3P 2J76E 3BGRA 2BOPA 1OPZA 2OMOA 4PCQA 1CQMA 2BJDA 2F40A 2SXLA 5HMXA 1YJVA 1Q4RA 3J7YU 4H4MB 3V2UC 4DN9A 5FDLA 2B4VA 1WG4A 3RB3A 2HVHA 4MK9A 2K2PA 2YNFB 1D0EA 2E5IA 3MMAB 2G1DA 1JLQA 3MGJA 3AA9A 5J1PA 3PIPQ 1SKSA 4NZ7A 3D54A 5FD1A 3RYLA 2J6TA 2D3UA 1HI1A 3GFHA 4ATNA 3PHEA 3CMAS 2PA8D 3DFEA 2HMIB 1H2UX 4X4TA 2ZZMA 3MFIA 3HJFA 3OJSA 3DMJA 3RR8A 3ZZUA 3DRSB 5EWFA 4DQIA 4HL9A 2HHXA 4PPZA 3QJPA 3LWLA 1E6YB 3KMQA 2F8EX 1FEHA 3MOZA 5BYQA 1UFLA 3TVZA 2IHR1 3ZC4A 3RW7A 1ZOTA 1M5KC 2VFUA 1IJFB 4ZVEA 2MZ1A 2DNOA 1TV6A 2EFQA 2XSJB 5KFXA 2LMIA 3ETOA 5JVGQ 3T19A 2J9DE 4RBUA 5F9NA 1Y3KA 3FVYA 1CEZA 2GC8A 2MZTA 1HNVB 4IDKB 2ATLA 2AV5A 2EC0A 4IFYB 1AW0A 3I0RB 4DR5F 5KT4A 4PWDB 2C2RA 3SEOA 4EO6A 2C22A 1TL3A 4D3GA 1XTZA