1BC6A

7-fe ferredoxin from bacillus schlegelii, nmr, 20 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
AYVITEPCIGTKDASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7-FE FERREDOXIN
publication title Solution structure of the oxidized Fe7S8 ferredoxin from the thermophilic bacterium Bacillus schlegelii by 1H NMR spectroscopy.
pubmed doi rcsb
source organism Bacillus schlegelii
molecule tags Electron transport
total genus 23
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bc6A00
3MM7A 1BWEA 1FDBA 3MMCB 1H0HB 1Y5LB 2WB1D 2C3OA 1KQFB 1FCAA 2GMJA 2FD2A 1G3OA 2PDAA 4OMFG 4DHVA 5BYQA 1Q16B 4AYBD 1KEKA 5E7OB 3MMCA 2WSFC 1FRJA 1B0PA 2C3PA 1IQZA 1FRXA 1H98A 2VPXB 3MM6B 3OR1B 3MM9B 2GMHA 2Z8QA 3MM8B 1DURA 2C42A 1FDDA 1F5BA 2C3MA 2V2KA 4XDCA 1F2GA 2FJEB 4KT0C 1FXRA 5BYRA 3OR1A 3MM9A 3MM8A 2UZAA 1PC4A 1CLFA 1DAXA 1BD6A 2FJDB 1K0TA 2PMZD 1FRHA 1AXQA 1F5CA 2WSCC 2Y0SD 4ID8A 3MMAB 1B0TA 1FERA 2O01C 1HFEL 3MMBB 1R27B 2IVFB 1FRMA 1FEHA 3EXYA 1C4AA 2WSEC 1Y4ZB 3EGWB 2FGOA 1BLUA 2C3UA 1ROFA 1IR0A 2VPWB 3MMAA 2ZVSA 3IR5B 2FJAB 3MM6A 3MMBA 4RKUC 3IR7B 1PC5A 1XERA 1GT8A 1GTHA 4OV1A 5BYSA 3EUNA 1FD2A 1VJWA 3LW5C 2VPYB 1JNZB 2C3YA 7FD1A 1BQXA 5CH7B 3MM7B 3GYXB 2PA8D 1JB0C 6FD1A 5L8RC 3HKZD 3IR6B 5CHCB 1SIWB 1C4CA 2VKRA 3OR2B 4CI0B 4XK8C 1SJ1A 1JNRB 1D3WA 1GAOA 2V4JB 1FDAA 3MM5B 1Y5IB 2FDNA 1DFDA 1FRLA 2XSJB 1G6BA 4YDDB 1WTFA 1SIZA 3OR2A 2FJBB 2V4JA 2VPZB 1Y5NB 3MM5A 1GTEA 4L6V3 4XDDA 2XSJA 4Y28C 1FRIA 7FDRA 3C8YA 1FF2A 1FTCA 1H7XA 1FDNA 2WAQD 1H7WA 5FD1A 1A6LA 3PNIA 1FXDA 1FRKA 1B0VA 1BC6A 1KQGB 1RGVA 6FDRA
chains in the Genus database with same CATH superfamily
1JLGB 2BJ3A 2OTLS 4DR6J 1RA6A 2HMIA 2RQ4A 1B64A 1TK8A 2KRRA 4ZLPA 4HEA9 2GMHA 4A46A 4MTPA 1IN0A 1F2GA 4Z37A 3SV3A 3AHPA 1FWKA 2KB2A 5JVHQ 3KLVA 4CO1A 2XMWA 1KTVA 1XMOJ 5EDWA 1I51B 1UZDA 2YWFA 3P6YC 1VCTA 4RU2A 2YKNA 3DCAA 3CJRA 2MQ8A 1FNOA 1GXLA 2BABA 3ZFVA 2HAFA 4WTOB 2VQEJ 2ZBRA 1KFSA 2M2BA 2MKIA 2W8LA 2JLEA 1SC1B 2W2PP 2MZSA 4HTJA 3I0SB 1TV6A 4OJGA 2C2RA 5HQLA 4DV4J 3UCZP 3CJQA 4ZVQB 3EICA 3W64A 3IXQA 1SIZA 2V9WA 3Q24A 2Y1IA 4DPYA 4ANCA 1CSJA 1RT3B 3C3LA 7AT1B 2M4MA 2QC3A 4LRAA 1FTCA 3M2RA 3I4HX 1VHIA 4D3HA 4GKJJ 2CPIA 3PX6A 4B3SJ 3NL0A 4FYWB 3PV8A 3GONA 3DLKA 3ZTOA 2KFNA 2DRAA 4YB7A 5ETMA 3RB0A 1RKJA 4TYBA 3G82A 5K14A 2BEFA 3LAKA 1S77D 3D0IE 4CO2A 1YI2S 1D8ZA 1N52B 3H40A 1MN7A 3PG9A 1U1QA 2GS8A 1MLAA 2IMWP 4BC9A 1XC9A 3T1YJ 1B99A 2RHQB 3F0NA 3D6HB 4F36A 2UU9J 1RWOB 3CCLS 5IC4B 2CNKB 1HQ2A 1YHQS 1J5EJ 4LBHA 4Q2LA 3UDLA 1WKKA 2OFGX 2W8KA 2V67A 1GAOA 4XPEA 2RU9A 1WTFA 5DLGA 4GVBA 1CJVA 2APOA 3MEKA 1R6VA 1GXTA 4ES2A 2RUSA 4OHVA 4JI8J 1NH7A 4TVAB 2W01A 2J0XA 4XO0A 2NPIA 3PYEA 1PYTA 3W1YC 1C0TA 5LSOA 2B7BB 1RA7A 5KFFA 1A9NB 4RPFA 2HQDA 3NOCA 1YJWS 2YKMB 1B7YB 2Z8QA 1BQMA 3C16A 1ZA1B 2FJEB 5C5JA 4HDGA 3TVZA 3BYPA 1C1BA 1HNWJ 1S1TB 5IQQA 1S9EB 1KVIA 5EWFA 4QCLA 1X9MA 1DTTA 3M6UA 3OLAA 2B51A 1SQEA 3M9MB 1NEEA 4KKOA 4WP3A 4TU8A 4FDFA 5LMUF 4H4KA 2PI4A 1BHNA 1GTHA 5A8RB 2UXDJ 2FZGB 5K20B 3VALA 1C4CA 5KFVA 2DXEA 3JYTA 1Y5IB 4QPXA 2ZBCA 3T5HA 4L72B 3FCVA 3O5TB 4FPRA 1HPZA 1QAIA 1JLFB 1MU2B 1UZHA 3JSRA 1V9OA 3KLFA 2HK2A 2LCWA 3POTA 1VRQC 1GX5A 2LMIA 5D4LA 2C3PA 2UXBJ 3NLCA 1TKTA 2D3O1 1QAXA 1M5SA 3M8QB 4URGA 3RG6A 1DQ8A 2IYIA 4NXMF 5F41A 1P9YA 1K0TA 2PMZD 4JI5J 3Q2TC 4FNHA 3ETMA 5DQIA 1FK9A 5CXTA 5DDRC 2WBMA 1VJWA 2JFKA 3HULA 2AGOA 2FB0A 3I56S 1Y3KA 4KBIA 2HQIA 2ZH1A 3THTA 5KG1A 2L9DA 4P2MA 1DHMA 4DV7J 1D9FA 3HPOA 1S79A 2KT2A 4IDKA 2PEHA 4ZVOB 4F67A 2OPPB 4O3PA 2ZE2B 3HF5A 2DHSA 2GVZA 2PE8A 3PW2A 2A6MA 3JSYA 4RW9A 3L95X 1WI6A 3RB4A 3DLGA 1WG1A 5J2MB 1S7IA 1ZZNA 3IAM9 2GAGC 4IOCQ 1WC6A 1YJ9S 5KFMA 4XDCA 4DU8A 1X7VA 4F3MA 1RAAB 3GIRA 2BE9B 4WK1A 4NX9A 4ZMMA 3CJ4A 1LK5A 2YX7A 4TYAA 1YJTA 1JXEA 1U02A 2WSEC 1BLUA 2U1AA 3J7ZT 2AJ1A 2RRNA 1G4CA 4JP8A 2CNOB 2VBYA 1CPZA 2HS4A 4TY8B 1GMVA 4NPOA 1JNZB 3V6JA 2BE7D 2MZTA 1HYSA 1N5YB 3PZPA 1R0AB 5ETRA 4DF4A 1V5VA 2RDIA 4TU7A 5C7PA 2IM0A 5KFZA 3OV7A 2Y8YA 3GR1A 3QYYA 3RJMB 4WKYA 1HNVB 2HLTA 4H4OA 2UV8G 1FRIA 3Q8RB 4IOAQ 1FRKA 1KSPA 1RTJA 6FDRA 4TKTA 1UJ5A 5K8MA 5IV4A 4WFBQ 3MR2A 1BGXT 4OIXA 2OPQB 1SJ4P 1FCAA 3MUMP 3E2EA 3NNAA 3MM8B 4A8QA 2YKAA 1CBKA 2DCLA 1F9HA 1YIJS 5AXLA 3I9ZA 4AL7A 1YJ7A 5F3ZA 1HR0J 2VC1A 3EXYA 2J0WA 3MMAA 1U09A 2LEPA 2R7XA 4ZVTB 2V94A 1LWCB 4ZCLA 3SYZA 2ZH8A 2VFRA 5DDOC 4J9VA 1MROA 4I64A 3VAMA 1DBDA 4DL0C 3IR6B 4KR0B 1N33F 2YNHA 2OI2A 3HJVA 1CJUA 4HT7A 2VPZB 3MAAA 2IJNA 4KC5A 2Q1LA 2ZC4A 4RWXA 1OQ6A 4MKBA 2GMLA 2IRUA 3F73A 2ZC3A 4WP9A 4CP5A 4ZK7M 5I3PA 1S12A 2C2MB 4KHPF 1U1LA 3SCIE 5B0GA 5BYQA 4D3GA 2RDJA 4BWJA 1LW2B 1FHTA 5D3GA 3TJAA 1UW9A 4DWIA 4ZVEA 4MK9A 1O0PA 4ZN1A 2C2KB 4DV1J 1KLMA 2D3OR 3QRRA 2IM2A 4QR1A 3RW6A 4J9MA 3KHHA 3LGMA 3DRSA 4H54A 3TEGA 4I2PB 2DYAA 3QLHA 2RDDA 3HHDA 3EJMA 4RJVA 2NUHA 4IOBA 1XR7A 2OEJA 1K9MT 5L9NA 1QE1A 4R0JA 3DI6B 2XQCA 1TKXB 5A6PA 2HGLA 1NJZA 3GFYA 4ER8A 1FTRA 2VC0A 3H5XA 3I31A 3MPUB 2BJDA 3G96A 2W7PA 4JYAJ 4PUOA 3BREA 3Q89A 1WELA 3J81U 3LP1A 1FKPA 4FXVA 3K58A 3CWJA 3MCMA 1VLOA 4C8MA 1KBRA 4DX7A 5HLFA 2Y1JA 5ETTA 4QWEA 3KYLA 2VOPA 3A3PB 1DTQA 1XR5A 1U24A 4ZVFA 4ECTA 1FJCA 2D7SA 3G6YA 1TFYA 3AXKA 5BJRA 2O67A 1S0MA 2KTQA 1H72C 4QU6A 4PQUB 2EK1A 1OWXA 1WC0A 1P27B 2MQOA 2CJ9A 4LVOP 1UCNA 1J5OA 3FFIB 1WEZA 1DY3A 4FVCA 3UPFA 3IBWA 2KT3A 2JEFA 1H6KX 2F9DA 4G1IA 1X4EA 3LPEA 5D4NA 5LL6d 4RW8B 2FC9A 2Z0GA 5J1EA 1VOMA 1PIEA 4J9LA 1VBZA 5THWA 3DC2A 4N41A 3ZNJ1 3MCOA 4RUAA 4PG8A 3O44A 1RYRA 3QQCD 4NLTA 2CJXB 1VRTB 4YP3A 4Q8FA 4IG0B 2H5IB 3FDSA 4Y2CA 3FUYA 4K59A 3D68A 2W7AA 2IM3A 4YQWA 1RHKB 1HI8A 2DPIA 2V5HG 2V4QA 2L9WA 2RVJA 3TYTA 4RWWA 2OPRA 3D1HA 4PWDA 2RKIB 2HHUA 1GK8A 4DZDA 3BV8A 2ZOFA 3MCNA 2IBOA 2OPSA 2Q6CA 4LIWA 4IFYB 3U1LA 1B0PA 2IM1A 3A3OB 3PXGa 1JXLA 1VR6A 1UEVA 5JUMA 5GAGI 4OZ1A 1UVMA 3N4WA 3T3FA 3JAMU 2HYIB 4I2QB 5B0EA 4DV5F 1RT1B 1NO8A 3PW4A 2I0XA 3ZTRA 4X4OA 4R5PB 3KLIA 1K1SA 4O44A 2LKZA 5HROB 3AA9A 1JLCB 4EO6A 4ZP7A 1WHWA 4DFJA 2UUWA 3KFWX 2XCPA 5CA5A 2MZ1A 4M5HA 2GQCA 4LF5F 5HQ8A 3M6XA 2HBZB 2JL9A 1JJCB 3BBFA 3E8OA 2BMBA 4E2FB 3AH6A 5HANA 5DO2A 2K8GA 4H4MB 3ICLA 2KJWA 3M8SA 4IG3B 1OMSA 3MURP 4X4NA 2QV6A 1RISA 5HBMB 4Q43A 3LPYA 3BKFA 3GJRB 4DZ6A 2XSFA 3OVAA 2AJ2A 1JLAA 1Y5LB 1MWQA 2VQFJ 1NMEB 5HJYA 1TTHB 3L09A 1Q16B 2QIFA 4FPIA 1G7CB 4PPZA 3QFHA 2F8EX 3PYDA 3MPVA 3TJ8A 5T14A 5KT4A 1SJQA 5D0RA 5D6GA 1M5VC 2KFYA 2MQLA 2E7WA 5D4PA 3TP2A 3QRQA 3R27A 4ZDNA 1PO6A 1VIXA 4NLXA 4G1PA 2VODA 2C2DA 3BGRA 2J8SA 3SCKE 2J0SD 3A1YG 1CULA 3KK3A 2DK2A 1P1LA 1RWNB 5HVGA 2V9KA 3M30A 1NKBA 3VR1A 1T9WA 3H4DA 2YKPA 4XTTA 5DM6Q 4DR2J 4DV2J 3DOLB 3BDEA 2FQQB 1TAQA 3Q22A 5FD1A 3QGPA 1IKYB 2EEYA 3QWPA 3VQSA 3GYGA 4DCPB 2NCKL 1KWMA 3AD9C 4DR7J 3MEEA 4M5DB 2CJBA 3DDNA 2C2ZB 4OL8A 3KJFB 4DQPA 4X4SA 2HWTA 1OSDA 2VB6A 3QBCA 1XMQJ 4F0MA 3W5ZA 3TO8A 2B9YA 3M9OB 3HSJA 2KH9A 3LOUA 4O0NA 4LFCF 1HBOA 2HHHJ 3KLEB 5ADZA 3AA8A 5A8KB 1IR0A 3UD4P 1F5AA 1U0SA 3EM1A 3MR3A 1RU1A 3M2VB 3QFWA 3BR8A 3HFZB 1HKAA 3K57A 2BRLA 2FZKB 3LF0A 2DY9A 2DNLA 4TLQA 3K2YA 4DX8H 3AD8C 3DLEB 1W25A 2GO9A 2W24A 2CQPA 3NWRA 1V3SA 2IAJA 3MEDA 3ADAC 2YNFB 3CCJS 2P6SA 3HZGA 2VF3A 1FF2A 1HWIA 1H7XA 4KGVB 2MYFA 2D3ZA 1KONA 3OW2R 2AEJA 3TA1A 2Q66A 2OEKA 3PEJA 2HAIA 1RT2B 5J2NA 1LWEA 5KT6A 3BO2A 1YWXA 2O66A 3MMCA 3CEDA 4ED2A 4ECYA 4DSIA 3SCJE 2YX1A 1Y00A 4EZ9A 1WKLA 3DYAA 2FVRA 4OYMA 1RT4A 2XMVA 4X65F 2YNIA 3ISNC 2UUAF 2DNRA 2RE1A 1FRMA 2BJ8A 1M5HA 1LWXA 5MLCV 5J2QB 3FSXA 1DLOA 1LW0B 2H4YB 3MM6A 2OUGA 2Z2MA 3EYZA 1NLKL 4EGLA 4F4WA 2NXNA 4WFNQ 5KG6A 4J9PA 1KOOA 3CDUA 5IFMA 2LXUA 4CZCA 1RWXB 1RAIB 4CLKA 4X62F 1G6BA 3P45B 2BJ1A 1J27A 2UV8A 3I82A 4MMOA 4L6V3 3NGTA 4YB1P 4WFYA 3C6TA 6AT1B 2GA7A 5F8HA 3Q8PB 1Q7YT 2QLXA 2DEIA 4PABA 1D9DA 2J6UA 4LUBA 2JSXA 3FZ2A 3KUGA 4I0WA 4CTAB 2N7CA 3ONQA 2GMJA 1MW7A 1NM2A 5E3PA 1U1PA 4NCGA 2ZOGA 2DHGA 4U8YA 2DISA 1YZ7A 4UOHA 3HFKA 4C0OC 3U1NA 3WQPA 1B4SA 3CJSA 4EU0A 2LVWA 1F1BB 2FVQA 5CYMA 2KJVA 3OL8A 3SXLA 2VPWB 3TQ1A 1RTZA 3BF4A 4LSLB 4P7TA 2WVDA 5DETA 5ETLA 3TAMB 4G1QA 3TA0A 2F4FA 2XBPA 4DQQA 2G0JA 4C11A 5DM7Q 3ZO7A 4ZVGA 4ZITA 2BRKA 1L3KA 3IO1A 5C24A 1LWFB 3GQCA 4L74A 1JLBA 1QLNA 3W5YA 3W2VA 3CXCR 3VAHA 3QGIA 2M9KA 3OJSA 2W9AA 3DMJB 4MKVA 3RBDA 1SC3B 2LU2A 4TLRA 3V6KA 1JLGA 4NXNF 2QLWA 2GHVC 3UN3A 1FRXA 2DO0A 2VD3A 2R2RA 3RR8A 4B9UA 2DGQA 3PACA 3QGHA 1NUEA 3J7A1 2YQ0A 2WSCC 3KHRA 1UAWA 4ZHRB 1CQNA 1N8RT 4DUTA 1GMUA 4LMZA 4ITSA 2RB7A 1TP7A 4DI6A 3TZZA 5DQGA 4P2XA 2HWIA 2G2YA 3HCXA 4ICLB 2BOPA 4RW4B 2HMIB 2W25A 3UWTA 3MM5B 1XMBA 4U7CA 5CCLA 1NK7A 2AWZA 3I0SA 2AD9A 3B8HA 4P52A 1AT1B 2H5EA 3J81Y 5FJ4A 1RT3A 1RJJA 2IC3B 4MAKA 2V0NA 4AL6A 1NK8A 2JLGA 2ZH6A 2KXHA 1FVSA 1T3OA 1G2EA 2HGNA 4W98A 2HVEA 1WG4A 2LP4A 1EIYB 4OYZA 2ZBPA 1T8EA 4DR6F 1HWUA 3UN2A 4E98A 1RYSA 2HQ3A 2L9NA 3K8WA 4Y2IA 4ZPVR 2GO8A 3EZ5A 4X84A 1GMWA 1RBAA 2DPJA 5IWAF 2OP5A 2AX0A 5KFEA 2ACYA 1I3OB 3M2RB 2JDJA 3V81A 2E5IA 2ERRA 2I2YA 3OLBA 4MK8A 2EG1A 3QZ8A 4J9KA 4ATNA 1YJNS 3BM7A 1S59A 1UKUA 1I94F 5E3CA 5SZTA 2M5YA 3CDEA 1IKWB 2K3IA 4J9NA 5AT1B 5L1KA 1WEYA 2ZJPQ 5KFRA 3I6PA 4PG4A 1HWJA 3C46A 2ZHAA 1U0HB 2GHPA 3AJ2A 2HFSA 2HBRB 1FDBA 5KFYA 1R8CA 5HAOA 2MKJA 2FIUA 3F44A 3C6UB 2DR7A 2OSRA 5HI7A 1VK8A 5HN0A 3HHLD 3LO3A 3PJWA 1HD0A 2YKMA 2MLYA 4OI3A 4C97A 4ZVRB 5DGBA 4U95A 2E66A 1ICEB 1XN9A 2OAUA 4TQRA 3JAMY 2UUBF 3TARA 5HATA 2LA4A 1S1TA 3R6GB 1FEHA 5A2QU 2KU7A 1S9EA 2BKNA 4O4GB 4ZLJA 4EI2A 3HHEA 1XK8A 2QFIA 3PJ9A 3GMGA 2OEMA 2BJEA 5A8RA 3FBBA 4CLFA 3CMES 2EFGA 2B3TB 2MY8A 1H38A 4ALZA 3R5BA 2XYGB 3JQKA 4PAAA 2M8HA 3CJKB 4CCHA 4Y2AA 1QAYA 4JOUA 1H74A 3CCES 3N5FA 4NXMJ 3B78A 3PIOQ 2C1EB 1JLFA 4I4BA 2OD6A 2DHHA 2R9LA 3ETOA 2WSFC 1YBTA 2HFVA 3I9V9 2WBRA 4J90A 1UEKA 2R7WA 1X4BA 3LGHA 4ZA1A 2FVSA 3R2CJ 1TL5A 4LFAF 4O23A 2BM1A 3SDEB 3LH2S 4JI6F 4NA2A 2Y1LB 3KDOA 2IMOA 3UO0A 3NKYA 3S8SA 4BCAA 2R2UA 2GC8A 1VQ5S 3O3LA 2XY5A 1L5UA 4RBUA 1WEXA 1F0XA 3JSMA 3W8PA 4Z7YA 3KK2B 4OZ2A 3CCZA 5KT3A 3QPIA 4NLYA 2EI5A 3AFGA 3UDEA 4I56A 1AZSB 2V34A 2BJ7A 4TXSA 4Y28C 2HFZA 1VISA 3TUPA 2OPPA 2QT7A 5EHHA 1VI7A 2ZE2A 2V69A 3H98A 4ZP8A 4NWBA 2LDYA 4U7UK 3BSAA 4DBQA 4HT5A 2L41A 1PJ5A 1T3NA 2RNEA 3DLLQ 1Y7PA 5J2MA 2W4DA 1QTNB 1WC1A 2X3GA 2ZEJA 2E29A 4RNNA 4HKQA 3P8BB 2MKSA 2C42A 4UY85 3CJ0A 1VC5A 4DEZA 4ZJLA 2RHSB 4OJ3A 4JV0A 5EX0A 4FF4A 4UOFA 3G8TA 3G86A 3THVA 4QBUA 5KG0A 1S1WB 4QU7A 2DR8A 1RKIA 4OHZA 3KJNB 1RLDA 3KMSA 3BSOA 3OPKA 2NZ4A 2GVZB 1Q8BA 2H3EB 1RK8A 4TY8A 1S6PB 2PGCA 1FJEB 1ZA2B 1N5YA 4LBPA 1R0AA 1IBMF 2FJVA 4Q0BB 1DJ0A 2CQ2A 2AYGA 3Q0AA 4KH0B 2ZH2A 4R8UB 3A8IA 2WHOA 4NRTA 4H4KC 4DPXA 1TUGB 4C0HA 4PWWA 3CMAS 2JX2A 2F9JA 2F8HA 1Z2ZA 4OMFG 2Z2YB 4B9LA 2C2EA 3CD5A 5D77A 2OPQA 1RHQB 2V6AA 2DR5A 1Q8LA 3D28A 4CO4A 5K9FA 3K59A 4PYAA 2E1PA 3W2WB 3ZC4A 3ZZYA 3MM8A 1HYSB 1N33J 1M90T 2O1PA 2DH9A 3ULHA 4OHXA 1AFIA 1SUQB 4QIVA 2YVSA 4MYUA 3GIJA 1CJTB 2K3KA 4FNIA 3S1TA 4DR4J 3MF5A 4UZBA 1FEEA 4AFFA 1S6QB 2R42A 4JI3F 3LW5C 2D74B 1RTJB 1LOUA 4PXDA 1UETA 1LWCA 4KHPJ 1FFSB 5IV3A 4KGZB 2HBQB 1SCJB 1N56A 2NXJA 4B3OB 3W63A 2DITA 3O8WA 2DH8A 2EKYA 4NMXA 3PW0A 1RT5B 3R5DA 2B7CB 1KNZA 2C3OA 3B4MA 3CJ5A 2QSWA 2HHVA 2XZDB 3V4IB 1HBNB 4NLOA 4USTA 2QJ3A 1FNMA 2PIIA 2F5GA 4CH1A 2BZ2A 4ENOA 4WXWA 1LW2A 4RU9A 3PW5A 4CYUA 1GMWD 2HVDA 2XI2A 1DQ9A 2VASA 2CPYA 2HWHA 4HH1A 3MECB 5IQ6A 3AJDA 1TMJA 4C8OA 1M5PC 1XNRF 3MOJB 1PSDA 3MMBB 1ZPWX 5KFGA 1LFWA 2LLZA 3MGJA 1NK9A 2CDQA 1RQ0A 4FN5A 3MR5A 3HSDA 4FF3A 4TQSA 5GMEA 1KVJA 1N5QA 1BQXA 3CJ8A 5GMKa 2VKRA 4F26A 3DI6A 3V6HA 1TKXA 3SSRA 1LV5A 1VGYA 4C3KA 5ITHA 2N4DA 3IP0A 1R43A 2BQ3A 5BXIA 5IM0B 2AJFE 5DG7A 3M8PB 2NLWA 3PNIA 5I4MA 1LEOA 4ELTA 3R9LA 4J9UE 4WF9Q 2WOMB 4UF4A 1XNQF 2GV1A 4O3QA 4DL4A 1VBYA 3CB4A 3MFIA 1VYAA 2CPDA 2DGXA 3DOMB 2ZZTA 1QE1B 3UN5A 2AW0A 3DHWC 2H54B 1V3RA 2MTLA 1QM9A 1RAFB 3GIIA 1HBMB 4PQUA 1NH8A 5KFUA 3ZZUA 4Z2XA 3FFIA 3IS9B 3DU6A 1YJRA 3KUHA 2ASLA 5C2GA 4EYIB 2G1DA 5B0DA 4JV5F 1SV5B 2NSCA 1NNDA 1CG2A 1YJVA 3HD1A 4BDPA 4M5GA 3PW7A 1UFWA 3CD0A 3ENVA 4X4VA 1YG0A 4GRSA 2AGPA 5K8OA 4USUA 3R1HA 3H5YA 3CD7A 1VRTA 1ZH5A 4IG0A 3DRXA 1NK5A 1QAJA 3AOBA 4DV5J 1B0VA 5T41A 1QSLA 1UA0A 1H73A 3KOAA 1L3SA 1H0HB 2YBVA 4I6YA 2QMXA 3PFOA 2J9DE 2CPZA 3C14B 4JUZA 2RKIA 3DXBA 2DT9A 4G6VB 4LF5J 3MEGB 3VWSA 1FDDA 2QA4S 4IFYA 1YRTA 5F9LA 3DKDA 2FJWA 2HZAA 2R8HA 2AZ1A 1ZZFA 4DV6F 2NR0A 3NCQA 5L1JA 4I2QA 1SQGA 3TI0A 1HFEL 2WW4A 1RT1A 2KHDA 4V19X 2CJYB 1VHFA 1PAUB 4R5PA 2CQ3A 1NU4A 3MOZA 5HROA 5A76A 1JLCA 5GAHI 2VG6B 5DJBA 1XR6A 4WTYA 3BQ0A 4PWDB 3HVRA 8ATCB 1N5SA 4DPWA 1RT6B 3ZZRA 1WHVA 5EGYA 2JC0A 1I5OB 2EFOA 3RR7A 4H4MA 5KT5A 4DL7A 2LQBA 4IG3A 3RU0A 1NHUA 3GCXP 3IWLA 5HBMA 3OTCA 4HACB 3BO3A 3MTJA 1Y3JA 2BUNA 2MHEA 3FC9A 4ZPDA 1NJIT 3FCWA 2VG5B 4R25A 2EFNA 1MNEA 3U7JA 3W5XA 1YZ6A 3I0RB 3PDNA 2FVPA 4B3TF 4B3RF 2ZHBA 3WX4A 2ZFHA 1RAGB 4KV8B 2Y9HA 3L7UA 4WFXA 3IMQJ 1RSCA 1P8GA 3KKFA 3VAGA 3MPWA 3SV4A 2VBZA 3I5BA 4EZ6A 1T9UA 4IRCA 1XERA 5A2QY 1RI7A 2HQGA 2OJ3A 4DUYF 4UTGA 3LQVA 3D67A 3CCQS 2D3UA 3TEHB 1NB7A 1JKHB 3OXLA 2XULA 3IN5A 4DQRA 1UMJA 1HQUB 2YH1A 3FMWA 4LR7A 4QPTA 5HK4A 2K7KA 3FZBA 1L3VA 1R89A 3DOLA 4LFCJ 3IWXA 3B6BA 3EVMA 2WB1D 4OFZA 1IKYA 1IUJA 5D0HA 4QIFA 5HMXA 3QATA 2VQFF 4M5DA 3EGZA 1APSA 3RB6A 3K5PA 1TK5A 5DG8A 4ZLLA 2CWKA 1C2PA 3O1LA 5KFCA 1IKXA 4OX6A 4QJVA 5B08A 1UVLA 1PBUA 5H9EJ 2CQHA 3KLEA 4OYBA 5A8KA 2HHTA 4HTIA 2P9CA 2CPHA 4NZ0A 2RSQA 2XG8A 3M2VA 4AXJA 2AMCB 4DN0A 1S0NA 3MEEB 3NCRA 2HS3A 2Z2ZA 2PI5A 4UUWA 2DO4A 2HVIA 1RLCL 4DR2F 4OZ3A 4X65J 1C1CB 2YNFA 3DRRB 3HMJG 4DV0F 1S48A 2UUAJ 3BBBA 4NOHA 1HBOB 3E51A 1NZAA 4N5SA 8RUCA 1S6OA 2W2OP 3BQ2A 2JJ4D 4L3KA 4ID5B 1IR1A 1REVB 1R6YA 1RT2A 3UCUP 2J5AA 4J9OA 2V8VA 4F2SA 2N7YA 4HHHA 4QR2A 3OTEA 3LWMA 1V6HA 3TRGA 2IY5B 4ZOSA 3KUEA 2FJDB 4X62J 2O3DA 4MYTA 4JI1F 3FSIA 4FXDA 3WHIA 4ZP6A 2BBEA 2QA1A 3DOKB 2J0QD 1F3FA 2RF2B 5J2QA 4LJMA 4HHUA 1LW0A 4MKAA 2QA2A 2XLIA 2OGUA 2J6TA 2A2CA 4NLSA 3FVYA 1O5JA 2XB2D 3PR4A 3IRXB 2ASDA 4DR1J 3D0GE 2R7VA 2B4VA 2XO6A 1SKRA 2PMHA 1IBKF 5D0EA 4N8OA 3WBZA 5EWEA 2WAQD 1S9FA 4DSEA 2NXCA 3DYAB 1KQGB 4JBCA 2GW8A 1BWEA 2J9CA 2YNIB 2KM8C 2QN6B 1RE1B 4DL6A 3MM6B 3V6DB 4LBIA 4A8FA 1F5BA 4N47A 2YNGB 2DRBA 3W62A 5EWGA 4PXEA 2POKA 5FDLB 4OZNA 2WVEA 4USWA 1TFWA 4USKA 3CE8A 4YHHF 3CT9A 1VRUB 1UJ6A 1X60A 4WCEQ 1UFLA 1UL3A 3CDBA 3PR5B 2R7RA 3PTWA 2OELA 4NXNJ 4USHA 4OLOA 4LSLA 2Q43A 1XBWA 2A1BA 5HVHA 5AXMA 2C2OB 1D9AA 3TAMA 4DJBA 5D78A 4YFUA 4YS2A 2XTJP 4DPUA 3AJ1A 2JVRA 4CH0S 9RUBA 5I3QA 2B4UA 3GJSB 2IBKA 1TUWA 4ILMA 3HDSA 5F0WA 1SL0A 1RACB 3DMJA 2QLBB 1OY9A 1EARA 5F8LA 2HRYA 2J7UA 3MMJA 2PT0A 1X4GA 3VZHA 1PYSB 5KTQA 3T5JA 2K1RB 2ZNYA 5AE2A 2UZAA 4JB8B 4U8VA 3DLJA 2PO4A 4F7VA 4K0KF 2I5JB 2ATCB 5MAOA 1U7LA 4EK2A 3RBEA 4ZHRA 1EKRA 2MJNA 4ED6A 2FGCA 1OPZA 2EVZA 2RUGA 3HKZD 2NXEA 4K7QA 2YWKA 3GFXA 4CRJA 4CWBA 3KJQB 4ICLA 2P2CB 4A8WA 4RW4A 2X1GA 1W7WA 3MM5A 3BJYA 3MWBA 2R7OA 4G65A 4MFBB 2F7VA 2XC9A 4LF4F 4LSNB 1NJWA 2CQ0A 4IRDA 4Y65A 4C7QA 3Q8VA 4F2RA 4DLEA 2IC3A 5IWAJ 4OI6A 1IJFB 4RW7B 1T03B 2HNDB 3H2UB 1NSKL 1CEZA 2DVIA 3AB4B 4KGKA 4ED5A 4WFZA 4MK7A 4W4MA 2XYHB 2WONB 3PHTA 4O3RA 3CCRS 4F02A 5KG7A 1I94J 4OHYA 1TZ0A 2R7SA 2VDIA 3QT6A 4A47A 1ZETA 3NAHA 3DLBA 3M6VA 2H65B 3N6MA 1U1NA 3M2UB 4IH6A 1HNZF 5B7WA 2WW8A 3P4UB 2OH2A 4KQZA 4C3MA 3ISND 1FE0A 4CLZA 3BQ1A 3X1LB 5IZHA 4ECRA 3M32A 5KFBA 4IO9Q 4FYVB 2ZDPA 3CVKA 2YX4A 2V4JB 2XI3A 3PRBA 4IR1A 2HG4A 3HO1A 4WIQA 1XWLA 4J37A 2CWXA 3UNGC 1L3TA 4XPCA 1IKWA 1CVJA 1K44A 3IBFB 4QW9A 1KS2A 2NPFA 3A8JA 2UUBJ 2MQNA 1T95A 3M6WA 1U0HA 1N88A 3AOCA 1WTBA 1O8BA 3GSDA 2F8MA 1WJ9A 5E3RA 1WI8A 1YSJA 2GFFA 1Q95G 3V81B 2QSFA 4CLSA 2FHKA 2E5LF 3NS6A 1IJEB 4NLWA 3C6UA 5BYRA 1YBUA 3DM2B 5GAHU 2QMWA 1CC7A 2XMMA 4QWDA 4ETZA 2JOQA 4OI1A 3V2UC 2KZZA 1FVQA 3G9CA 3EGWB 5KFIA 3Q8YA 1QSYA 2HHWA 3N28A 4X4PA 3NGKA 4O4GA 3R3TA 3K8VA 3RGIA 5DLFA 3FEXB 2BACA 4ZJQA 4DLGA 1KQKA 2MKHA 2E7VA 1A0OB 4Y2MA 3OQ2A 4ZPTR 2FJBB 3FQLA 1XJWB 4A8MP 4XDDA 4KYZA 4LFAJ 2BV3A 3ENWA 4JI6J 1YTYA 3CJKA 2UUCF 2BM0A 1MWZA 1RT7B 3MFHA 1OY8A 5KFOA 1WDTA 3H0PA 2QL7B 1VMBA 4CO3A 4QIWD 4X64F 3HT0A 3H4BA 3ZXWA 4IH7A 5F8IA 4KPYA 1QSSA 2CYYA 4M5MA 4L75A 2FLPA 4EFAC 3CGIA 1CLFA 5ETSA 2P9EA 1GXUA 3BPSP 3VTIA 5LMNF 5CYJA 4BHQA 4Y6IA 4ZN3A 3M9NB 1FO1A 3LAMA 1H2VZ 4OJ1A 1FX4A 3SDEA 3PX0A 1ZS6A 2PFDA 3KLHB 2PEBA 1UVKA 2K7JA 3T9ZA 2DIVA 1VS3A 2ZKTA 2YXLA 6FD1A 1R8PA 3FRZA 3MR7A 4KJIA 3FKBA 4A8KA 1FDAA 1DFDA 1ACMB 3KK2A 1OSCA 4JI2F 3Q8SB 4BS2A 4EBDA 2IVYA 2BW2A 2XGQA 2MY7A 2VDHA 4DS4A 5DDPC 2CPJA 1ZM9A 4ELVA 2EFQA 2NYHA 1AZSA 3B82A 5H9EK 3BH7B 2CKWA 1RTHB 1X8DA 2R4FA 4PZVA 3CUNA 3QAUA 1PJ7A 3TUZC 2OHDA 3VGSA 4A4JA 2BX6A 4ZKAA 4UT4A 4UUXA 4Y00A 2F40A 2HRTA 4OZ0A 3JSMB 4LRFA 1Q7LB 4O3OA 5AXNA 3N0VA 1IM6A 1FFGB 3EZUA 4WJBA 1IBMJ 3KMQA 4C8ZA 2HRUA 2G4BA 4PG7A 1KHVA 2ZZNA 1S1WA 1Q8KA 4KGMA 2RT3A 3TZWA 2CG4A 4K8RA 2ADBA 5D15A 2BANB 2VG7B 1X4HA 2VBXA 1IXKA 5AJ3F 3OR2B 2V8HA 1VQYA 2XSJB 4DV3F 2A0FB 4EBCA 2G1HA 2YPZA 1S6PA 1ELOA 2AU0A 1T7PA 2Z30B 2XWXA 4Q0BA 1H7WA 2CQ4A 3HVAA 1X5SA 1BWVA 1NZ8A 2XNRA 3HX9A 2LDIA 3QJJA 4R8UA 4CNZA 3RTVA 2QE5A 5B09A 1KP6A 3RW7A 1RBOB 4F3OA 1NPKA 2BJ9A 5ETPA 1HI0P 4JI3J 3VAFA 2ABYA 4NYOA 4ZPAA 2CJQA 2XLJA 4HVZA 5F9NA 1PC4A 4CO5A 3NMAA 1BD6A 1LQ9A 3OFHA 3GG1A 2ZUAA 2HHSA 3W2WA 2GGPB 5A0YB 2ASYA 1NDPA 4AXIA 1K0VA 1SUQA 2ILYA 2C22A 2HHPA 3K5MA 1CJTA 1HL6A 1X5OA 3GV7B 5C42B 2KKHA 4AUKA 2IRXA 3UI3A 4F4KA 1S6QA 1AA1B 2QGFB 1EB0A 4CQ1A 2IDEA 2BA9A 1OYEA 2DGOA 1QUPA 1E6YB 2V8GA 2ZOMA 3OHAA 5IS2A 4YB6A 3PRVA 1EQMA 4B3OA 4N56A 2OTJS 3IGVA 2MZJA 2JC1A 1XNRJ 4JV2A 1RT5A 3IRWP 2M3DA 3TA2A 2CG8A 3IAS9 5GADU 4WP8A 1JJ2R 3Q8UA 3BGLA 3V4IA 1T0TV 3GSIA 3LP2B 4ZVPB 1HBNA 2GIRA 4M95A 4YB5A 1SPBP 3KJVB 1D0EA 2L3MA 3ELHA 2A2DA 3CCUS 4DSFA 4Q2MA 1TKZB 2ACMA 1ZBTA 4NA3A 2HFOA 4NLUA 5KOXA 3BEGB 2ROGA 1RHUB 3MECA 1ULRA 3C66A 3MMBA 3M05A 1BXNA 1U6BA 3Q86A 1XNQJ 3SBMA 2PC6A 4DQIA 3CIZA 4AE5A 1RHRB 4DR4F 4GMKA 4NLPA 1D3WA 4DR3F 3KDNA 2ZM6F 1FXLA 4OLPA 2SXLA 1Z2LA 3OTDA 1SJ3P 2LXIA 4CYUB 5IM0A 1BC6A 1NXIA 4NLRA 3GJQB 1Q5YA 3M8PA 3BN7A 2YKQA 2I9SA 2WOMA 1HW9A 2F3JA 4FKYA 4JV5J 3MM9B 2R7TA 3K5LA 3TNVA 3T6BA 1WHYA 1BQNB 1U8WA 4F4AA 3CSKA 3DOMA 1WSVA 5E3AA 1URRA 3ZTQA 2H48B 4YR0A 3W66A 4OX8A 2YH0A 1HBMA 1KD1T 3QRPA 1N0UA 2AX1A 1S4FA 4QYRA 2XS2A 3UD5A 2FY1A 3BBCA 3NS5A 2AYBA 4RKUC 2E5HA 3IS9A 9ATCB 2QL9B 3IG1B 3GWCA 2ILZA 2YWHA 4LIRA 4JI0F 1K1QA 1SV5A 4CLLA 5L8RC 5A6WA 4HL9A 3OVSA 1FJGF 3DFEA 3NOGA 2JRSA 3SQOP 2EKNA 2PA3A 4W92B 4CO0A 2G0IA 4DR5J 2X51A 4M8LA 3GV5B 4ZCKA 4DS5A 2EG2A 5EX3A 2DCUB 4K5SA 4DV6J 2CRLA 4RNHA 1WOSA 3R7NB 4K4SA 4UZCA 2E1MC 3BS9A 1RWUA 3GR0A 1QTMA 2PDAA 3JTOA 2R8JA 1H3DA 3EGVA 4NCAA 1NCLA 3C14A 2CDRB 3HM9A 1V5IB 3MEGA 1TL3B 2OLWA 1V3ZA 4NI2A 4EBEA 2FHJA 3BN4A 3EE3A 2ZH9A 2E5GA 2DY1A 1M5OC 2B6AB 3HHLB 5CYQB 3GPAA 3F41A 3FBFA 4NEZA 2VG6A 2EC2A 4DOZA 4LVNP 2IA6A 1U2CA 4KB7A 4B3TJ 4B3RJ 1RTIA 1VLYA 1U49A 1VBKA 1RT6A 5KG3A 4FZVA 3OUYB 1X5TA 2KDOA 2B9XA 4P72A 2KYZA 3D1OA 2PD1A 1IVZA 4KTQA 4ES1A 4HACA 2K06A 3TZXA 5L1IA 2K2PA 2NS1B 2X1FA 2JZ5A 2VG5A 4QYZJ 1OIAA 4ZPWR 3D66A 4DCOB 3I0RA 3HLUA 4DUYJ 1N34J 4C4WA 1DAXA 1WC3A 2EXUA 4NZ6A 3ET6B 2XEXA 3NBPA 1KKHA 4KV8A 4MIBA 4O0IA 1C4AA 2RAQA 1GH8A 4DFPA 4LF9F 5KG5A 1VQ9S 3NCPA 3TQEA 1HIYA 2E1CA 2BE2B 3IM9A 1YITS 2V2ZA 4CLYA 4Q44A 4OZLA 2GIFA 3J7AN 1Q81T 4ED1A 3VVTA 1U8SA 3OTBA 4JI4F 5DGAA 3DGPB 3ENQA 4PEOA 3D6FB 3KTQA 2MGZB 1JKHA 1S5ZA 1RGVA 1HQUA 2C2NA 2Z4PA 1F9EB 3FBEA 1JLEB 2GVDB 1KVKA 3CULA 2V8DA 2XY7A 1UW4A 1NKEA 5HP1B 4KY3A 1FRJA 1T9VA 2GHWA 1IQZA 4RR5A 3CMQA 1W2BR 1IR2A 4KGXB 3AODA 4NEYA 3K0JA 4DPTA 4OX9F 1IBCB 5D8HB 1Q4RA 3Q8QB 4B9TA 2AEFA 1L3UA 2BOAA 5AE3A 2ZJQQ 1UFKA 1F60B 4V19J 4DV0J 2E5JA 3OL6A 4Y34A 3MCSA 4DF8A 1UTAA 3TAQA 4X4TA 1IQTA 2AT1B 4L76A 2DH7A 1JNRB 1O6XA 3HSGA 1SJFA 1F6TA 4ZIWA 5EN1A 4FP9A 2MMYA 2CQGA 3VGTA 4JI1J 3ZZTA 1NPRA 1ZPVA 5LJ5Y 2MSTA 4M5LA 4URSA 3FK4A 1C1CA 4UOCA 1IKXB 3DRRA 2HFNA 4M5KA 2MQMA 1S4EA 3KXDA 2LQJA 1Z1ZA 3MXHP 5J2PB 3EDRB 3P3DA 1GX6A 3NEKA 1DURA 3PKMA 4ID5A 4ECWA 2HNZB 1AYEA 1ZAWA 3AY0A 4NMLA 1REVA 2W2NP 1BY9A 3HHNB 2CPXA 1YLXA 3HVWA 2JFDA 1SC4B 2MEWA 4B02A 3QGGA 1S0OA 1RHMB 2KN4A 1IBKJ 2MLXA 1RADB 2FPHX 4YR2A 2V63A 2KVQE 1NRKA 2ZKUA 2A10A 5H9FJ 3DOKA 2RF2A 2I1RA 2FLLA 3SFUA 3NGUA 3EMTA 1HHTP 4A8YA 2FLOA 3VAIA 1FX2A 3QO9A 1C0UB 3QT5A 3R8YA 4OX7A 3IRXA 4MIWA 3WC2A 2AZ3A 4NRUA 2MSSA 1PBAA 4FS2A 1B7FA 4C48A 4YHHJ 3I5AA 1WD6A 1P9QC 5JXSA 3OSPA 4NYPA 4ERDA 1NKCA 2AV5A 1WKJA 3V6DA 3NRBA 4MKYA 2HURA 4N76A 2YNGA 5KOWA 1RDRA 1Q0NA 2EWHA 5FDLA 4CLPA 4I7FB 4OZJA 1J2VA 2DKOB 1HLWA 5CZXA 1VRUA 4IR9A 2FLNA 2ZD1B 1QJHA 2JLFA 4USMA 3S01A 3HVTB 3CIMA 2IRYA 2MZRA 3A12A 2EFPA 2AJ0A 4IQXA 5KAKA 3G2XA 4K0KJ 2RILA 3H90A 4DR1F 3KNGA 2OFHX 1RHJB 2DJWA 4ILLA 4BLGA 3EPIA 3SQGB 4WYLA 1RUSA 4QQBA 3GIMA 1EZZB 2F4VF 2KG1A 1FKAF 3H59A 3OD2A 1YQHA 2FHJD 5LT5A 3HKWA 2K1RA 1SL1A 3ZZ0A 3BKTA 2I5JA 5HJXA 1TKDA 3L9ZA 3ISZA 4PCQA 4LF4J 1LKZA 3WIUA 5C25B 1S1XB 7FD1A 3QWUA 2HIQA 1NSPA 2DNZA 4NA1A 3OSNA 4DSKA 3CC4S 1TQLA 3V5RA 4DDFA 2BKPA 2NQPA 4FYDA 1U26A 4IO1A 2HEKA 5C2CA 1IKVB 4PRFA 1JJ4A 1GEHA 1D8YA 5IOLA 4USJC 2MB0B 4LF7F 4NLQA 4RBVA 4EO8A 1S99A 3H8YA 1OPIA 2J7WA 4X66F 4F8RA 4MFBA 2XMUA 4LSNA 1HQEB 2QTWA 4YMEA 1HNZJ 3HZEA 1RTDB 4NE9C 4Y3CA 1H98A 4RW7A 4NASA 4B3MF 2JHEA 1T03A 4AQYF 4DL3A 4WU3A 1LNQA 1KOHA 2C3MA 4ZPCA 2HNDA 5B0FA 2VA3A 1LK7A 2BVZA 2WONA 1VQ7S 1P1TA 5LSLA 5CD4H 1DARA 5F8NA 4ZVSB 4LF8F 2GCFA 1EETB 3M2UA 2DR6A 4OV6A 4HHJA 4P74A 3E3XA 1ZOTA 2FHOB 4NLGA 3LUYA 3TX0A 1SJ1A 4O3NA 3MPYA 1NJYA 5F8JA 2E5LJ 1KFDA 1IBLF 2V4JA 3EX7B 3PM9A 7FDRA 3A8KA 4S0MA 3QMQA 4RUHA 3IC1A 2ZVIA 1N32F 1TVRB 3OJUA 1BE4A 4QWBA 3QJLA 3I55S 2NYIA 3CCMS 2J8AA 1U2RA 1NDLA 2DNMA 5J1NA 4KFBB 2XS7A 3PO4A 3D54A 2F1FA 1U45A 4K4WA 5B0AA 4ED3A 3PEHA 3M32B 3H2VE 2HNYB 5A8WB 1S6UA 3DM2A 4IFVA 4ID8A 3GYNA 1M1GA 3MHYA 4QOTA 1S49A 2MLZA 2JH3A 5B0BA 5KFXA 3M8RA 1QD1A 2Q79A 4RNOA 2UUCJ 3D6TB 1S76D 4RNMA 3CCWA 5KFKA 2VUGA 3M8YA 1YK9A 4LSZB 2XMJA 4QYZK 3ZTPA 3N9UC 2PA8D 2QLJB 1HA1A 4A8XA 2A3JA 4X64J 3A8EA 1K73T 1WACA 3SMZA 4CNYA 2P5VA 2H5JB 4LF6F 1UPMB 5LMNJ 5KG2A 4K4VA 5LM7E 2LEBA 2M0GB 1FJ7A 2M8DB 1B3TA 4HLBA 2DR9A 4N7TA 3U1MA 1RT7A 4B9MA 3H25A 1SH0A 1VQPS 4DL5A 1UWBB 1RAJA 5KG4A 1CS4B 1NHKL 3CTRA 1Y10A 4UOGA 1SKSA 4M63A 3JTNA 2BW7A 3WC0A 4NCBA 4JI2J 5HQMA 1REGX 3S7RA 4B17A 4L3NA 2ZZMA 4B9NA 3GE9A 1I1GA 3EVWA 4Q7AA 1U1KA 3KLHA 5CQGA 1KQSR 3GV8B 2V50A 4WFAQ 4I1TA 1VJQA 1XTZA 1EHWA 3THPA 3W9IA 3VAJA 1H2UX 5IT9U 4CI0B 3RBZA 2NUUG 5T7LB 2D69A 2QRRA 3TJ9A 4WE1B 4UY8T 4G3IA 4GO7X 3J7Z5 5L1LA 2YKOA 3LANA 3D4JA 2UXCJ 3LWLA 1EQ0A 2J7KA 2RS2A 3MM7A 1Z4UA 4EYHB 1SBRA 1G3OA 1RTHA 4KAIA 3Q2SC 1TELA 4AYBD 5M2PA 3KHLA 4RX6A 1Q79A 2I38A 4GKKF 2XS5A 3O6QA 4C8YA 5IT4A 3TZYA 5AJ3J 2WTFA 4K4XA 2COLA 1WSRA 4DV3J 1S9GA 2B4OA 4UQGA 3IGNA 3WIVA 4CIOA 1QUVA 2WVCA 2FGOA 3KWMA 4C98A 3VGVA 2H4WB 2R3VA 2RRAA 4WZMA 2H9ZA 2ZH3A 1E6VB 3AAWB 2Q6BA 3KG1A 5B0CA 5HO4A 1VQKS 4M94A 2CQ1A 3NWGA 3F56A 2BANA 2VG7A 2Z2LA 3CO9A 4KHRA 4LR8A 1SJRA 3OR2A 1Q8IA 5L39A 4ECQA 2YPYA 1NSAA 2XSJA 3UVJB 4PXCA 1AROP 3VQTA 2AP6A 2GAHC 2V4RA 2XGPA 1HWLA 1Y0HA 4DG1B 4PR6A 3U02A 2ZDOA 3M8ZA 4RW6B 4U6PA 1NK0A 5H9FK 2VZ9A 1RWPB 3R5CA 4IUFA 2KI2A 3UCGA 2QX0A 4PXBA 4CM2A 2A18A 3ITHB 3OT9A 2BR0A 2LQ5A 5ETVA 1MN9A 3KHGA 2QO3A 2R2TA 1T11A 4J91A 1HNXJ 3CPWR 2YY3A 4IH5A 3TAPA 4C0BA 2ROEA 4HYKA 2GGPA 4KO0B 5A0YA 2FY8A 3L3CA 4P71A 3KG0A 5U47A 1XQIA 1N48A 4RBTA 1AW0A 4WYWA 1VC6A 3K17A 3R7BB 4P6QA 4C2MA 1FKOB 5C42A 2EPIA 2EFVA 5KFNA 1NJXA 4F0KA 2R8IA 4LREA 5KFQA 4Q45A 1EAYC 2EK6A 1S1VB 1YKWA 3H20A 5DDQC 3OFFA 1E6YA 1T05A 1JLQB 5F0UA 4USVA 3DNCA 4FS1A 1HWKA 4AD6A 2DNGA 1R0BG 4PPDA 3I87A 1VQNS 2VFSA 4USIA 2B5JB 2O5DA 1JIHA 2DHXA 4YDXA 2QZ8A 3GZ7A 4B9VA 1NBEB 4F4ZA 4DR3J 2DGVA 3D1QA 3FEZA 3LP2A 2ZM6J 4GC7A 3KJVA 2RU3A 5HSPA 2HIYA 4ED4A 2FZCB 1TKZA 1UA1A 3BZQA 3PHEA 2FJAB 5KFWA 1S97A 2FC8A 4L73A 4C6AA 3JS9A 1BMQB 3IA0A 3HJFA 2HQCA 1GT8A 3P5BP 1WORA 1QVFR 1HHSA 3KLGA 4P9SA 2HBYB 2CXEA 3OBIA 2CUYA 4N77A 3A4TA 4RUCA 2W9CA 4GO5X 1FRLA 3IWNC 3LGNA 3LALA 2VOOA 2VIHA 1S7HA 3PJXA 3MAHA 2N4CA 2E7XA 5EUHA 2NXUA 2QMUB 3NMRA 1DQAA 1FWPA 1SKWA 3PO5A 3ZZOA 4LRCA 3JTPA 3GG0A 3DN9A 3T1AA 1JWWA 3RRGA 2KG0A 1KEKA 5I3UA 1HNIB 4ED7A 2YQ3A 4HDHA 3BGFA 4N8NA 3MR6A 2HQFA 3H42A 3GTYX 4U9RA 1VIOA 4PG6A 2PFFB 4JI0J 3Q83A 3MM9A 1FFWB 1WDDA 1QVGR 1FJGJ 2JNJA 3JQMA 1BQNA 1PCAA 4CLUA 1Q78A 2EBGA 3H2LA 2Y0SD 3NGDA 3GFZA 5G0RB 1B70B 4ECUA 4URQU 2IVFB 4NYZA 4FXWA 1N36F 1NSQA 4W90B 2ASJA 2EW9A 1YX2A 2BDPA 2WZ1A 1RBLA 3T1HF 4OV1A 4KE5A 5DS7A 1VC0A 2VPYB 1TL1B 3EGNA 1UVNA 3DHXA 2QEXS 2LEAA 3L7OA 3IG1A 4XK8C 2CJKA 1YRXA 5K5MA 4AT1B 3OTOF 5DRKA 2AIRB 1T9YA 1SVDA 4QWCA 4EEYA 2B43A 2GZOA 4Y2KA 3S6EA 3PVXA 3FGVA 3CDAA 1ITPA 3UFCX 4ZJOA 2B4PA 1WOPA 1M5KC 4ECXA 1I6JA 2R7UA 5D0GA 3T19A 4A48A 1TUVA 4K4UA 4DQSA 2CPFA 1ZAXA 1S0VA 1R8HA 3IFEA 2CA9A 2M88A 1VDHA 1IM4A 3T5KA 2XY6A 3QIPA 4ZP9A 2C28A 2MJUA 1CJKA 3DU5A 3VZIA 1PG5B 2R8GA 2IHR1 2CADA 2W9BB 1TL3A 3C15B 1T9XA 2KZMA 3H5SA 4KPCA 3TUJC 3UR0A 3QT8A 3OHBA 3EWGA 3P5TL 4R0EA 2B6AA 3HHLA 5CYQA 3H5UA 4LR9A 3OL9A 2H51B 1RWKB 3CCSS 3LP0B 2IJFA 3KK1B 3E01A 2LU1A 2WVFA 3I96A 3AB2B 4P10A 4MT1A 1PKUA 5KFTA 2HGMA 2V2VA 3FRYA 5F8MA 3UE2A 2B8QA 2KO1A 4DSJA 1WG5A 3QSIA 1OYDA 4C9DA 1FXDA 5ETQA 4ECZA 3DRPB 3PKYA 4NI2B 4DR5F 1YBAA 1Q5VA 3OUYA 2DTJA 3VAKA 3K89A 3EDQB 3DDIA 3N6NA 4LF9J 1HMVB 3OR1B 4O4RA 1ZTWA 2DGWA 4WBFA 1G1XA 1BUXA 4KT0C 2J76E 2LQ8A 3GLJA 4RUBA 2GX8A 4YY3F 5JMNA 4QR0A 2VHGA 1FRHA 4JI4J 1EP4B 1R27B 3ET6A 1RTIB 1WHXA 2UVUA 2AJ4A 3MDFA 1M0SA 1SQFA 1N6QB 4QIEA 1KHWA 3QJPA 2HHXA 3CCTA 5CD4A 4F50A 5E5NA 2BE2A 3J80U 4ZVHA 1Y5NB 3JB9k 3D3BJ 1ZTTA 3MUVP 4CT9A 1FDNA 3DGPA 4RO0A 4OX9J 4P7VA 2MGZA 1WC4A 2WVBA 3NBPB 2AEMA 5G4DA 2UP1A 2EC0A 2H1YA 2G2OA 3JQJA 4EMDA 2AKWB 2DBBA 2R7QA 4RZRA 1JLEA 5JJBA 1GNKA 2GVDA 5DG9A 5HP1A 3UDVA 2MDAA 3CC2S 1RABB 5K8PA 2CQDA 4PKDB 3M1VB 5I42B 3PYFA 1P6TA 1AXQA 3K5OA 4IRKA 1XIQA 1LXNA 2DB1A 3NNCA 1FI4A 1N34F 1K8AT 1R0CB 1TL7B 2DIUA 3PIPQ 1RAOA 4OYIA 2D9OA 2WK4A 3EUNA 1S1UB 2V8PA 1UVJA 4X4QA 2QYCA 1MWYA 5IXUA 5IT9Y 3MTKA 1URNA 4JI7F 3FSYA 4AL5A 2VONA 1U1MA 2NZCA 4WWSA 4UQTA 2CVIA 2Y1RI 3GFHA 3MD1A 3QT7A 4I6WA 4DXLA 2N3OA 2CQBA 5BR8F 1N5TA 3GB0A 4IYQA 4UW2A 3RRHA 1NK4A 4K4YA 3G87A 2VH7A 2XYPB 3HFVA 5H1SV 2YWEA 1TAUA 5J2PA 1JK9B 2CFXA 2HNZA 2D1CA 4MH8A 1U4BA 2CPEA 3GJTB 3DLHA 1SH2A 4LFBF 3IBCB 2O01C 2E9ZA 2Z57B 3FMBA 5AXKA 1EKSA 4M5NA 2KFZA 3TANA 2ZVSA 2DHAA 2CJAA 1F2HA 1NK6A 2RS8A 2HZVA 1OO0B 4FBTA 1HBUB 2VU5A 1ZM2A 1HHQA 4U96A 4DUZF 2X3DA 2HZCA 2DXDA 2FDNA 3TOQA 2ADCA 3CNQP 1PYOB 4IKAA 2D9PA 2PMWA 5AE1A 2N82B 2DRDA 3C8YA 2VFTA 4OQJA 3BKUA 1C0UA 2OMLA 1A6LA 2KVIA 3N79A 4TN2A 3RZAA 3CC7S 2BQUA 3AXMA 4BWMA 4V1Ak 1UPPA 2B0GA 4DHVA 1U6FA 4ETXA 4RLEA 1T9TA 1YJUA 1MMLA 4X4UA 2R8KA 4DMZA 3OL7A 2ZBQA 4J5OA 3TWZA 1FXRA 4OI0A 1PILA 3W9JA 1NDCA 3HD2A 2YKNB 3HHKA 1EX8A 4M1KA 4Q8EA 2XHCA 3HK2A 4XAKA 3QO9B 4P75A 4EUVA 3TW0A 3IR7B 5FLXU 5BYSA 4I7FA 2E1AA 1TV6B 2C3YA 3CJ2A 5E2QA 5KT2A 2W4PA 2UVWA 2FJXA 4NLDA 4C8NA 1XMOF 2ZD1A 2F4VJ 4YDDB 1ZM4A 2NSBA 3AQOA 4OYOA 4ELUA 3VGUA 3HVTA 3RRKA 1WF0A 4TY9A 2VQEF 5CAAA 1WC5A 1TMMA 3DLKB 1N4LA 3NGSA 3ENAA 3G82B 1RWMB 2CVEA 5K14B 4M5IA 4DV4F 1X4FA 4M5JA 3ILLA 2BQRA 1M1KT 2MZQA 3SQGA 5GADI 5GAGU 3TUIC 1FE4A 5GAEI 3M7VA 4GKJF 4B3SF 5HL7Q 1U25A 1N54B 5LMUJ 2JEIA 1HARA 1D09B 5F3TA 4J7CA 1KR4A 2ZWOA 3D0HE 4LF7J 2W2QP 4C3LA 5KFHA 3VF0B 1VQSA 4X66J 1VFJA 4ED8A 3R1LA 4Q5VA 1DRZA 2L08A 2KXNB 2DNNA 2ZBIA 5CH7B 5KFAA 1WUUA 2DNYA 3O2IA 4YUDA 2OKQA 5C25A 1S1XA 2AHOB 4GVBB 4O3SA 2G13A 1CJVB 4B3MJ 2F65A 3N01A 4AQYJ 4ZLNA 1PJ6A 1IWGA 4YOEA 3T1YF 3R5AA 1A7GE 4X4RA 4BC7A 2V2QA 2CIMA 2GJ2A 2UU9F 1IKVA 1N5VA 1R3NA 1UVIA 1C0TB 1J5EF 5IT0A 2VL1A 2VKZG 2DXFA 3G6XA 2UVVA 3BPDA 4WZQA 1FNXH 3MUTP 3VHQA 4F4XA 2VFVA 1BQMB 1X4DA 3C16B 5E7OB 4LF8J 2Z56B 1ZM3A 3ILJA 1HQEA 3I32A 3D2WA 2FTRA 2OMOA 5FIIA 1RTDA 2CNNB 4HH0A 1C1BB 2QLFB 1MU2A 1DTTB 4JI8F 3HT3A 4KKOB 2AF6A 1IBLJ 1ROFA 1VQMS 1KRPA 1N32J 4LRDA 2AQ4A 2BKOA 1N0VC 3FBCA 1JJHA 3JYTB 4DFKA 3M8QA 1EETA 3AOAA 4CM0A 4K50A 3OFGA 1ZYQA 4J9RA 1HNWF 2X1AA 2Y3YA 1HPZB 1VQ8S 4LF2A 1JMTA 2IIHA 3KG4A 3PYGA 2QG9B 3NGRA 2ATLA 3KLFB 3BH6B 3POTB 3X3UA 1Q1KA 2VJUA 2RH3A 4Z7CA 2UXDF 2M70A 5E0OA 4K4TA 3SSQA 1TVRA 5CCMA 3V4MA 1YVFA 2AYEA 2RRBA 1TKTB 1VBXA 1AFJA 5D4OA 1S57A 3W61A 3HP6A 3SIPB 3EZOA 4OYXA 4KFBA 2LYVA 1RWWB 4CT8A 3WX8A 1FK9B 2UUTA 3K5NA 5HVFA 2HNYA 3C19A 2KXFA 5A8WA 2MPUA 1FWLA 4I67A 4DX6A 4LF6J 2XMKA 2HVHA 2HPUA 4YEAA 2UXBF 1F3VA 4DN9A 2Y8WA 1AB8A 1JQGA 3UQSA 4QZVB 4IDKB 3T5LA 2GJIA 3NS7B 3ZNUA 2MKKA 2VBWA 3CDWA 2XMAA 4ECVA 2XO7A 3D7SB 4ZPBA 2XZTB 3M8WA 4JI5F 4X2BA 1SH3A 3CJ3A 4RW9B 1Y9OA 1AUDA 3DLGB 1NAQA 2HHQA 1VQOS 4IFVB 2UVRA 1X31C 2GQ2A 1KQFB 1QDUB 1OQ3A 1R31A 3QSYB 4HI2A 2MKYA 5ETKA 3G6ES 4DV7F 1HI1A 1EJ7L 3DXSX 2IA0A 1X4AA 1RWVB 5DZ6A 2ZH4A 2NREA 1HNVA 2XNQA 1UWBA 1YGYA 2HW3A 4WXOA 2XLKA 3UR3C 1RAEB 1CS4A 5ETNA 1WNEA 2OSQA 3RYLA 2CQCA 2EBEA 2E9TA 5M2UA 3SI8A 2LA6A 4KRWA 4YR3A 2R2SA 3C2PA 1U48A 4FF1A 4MIAA 4GVLA 2ZH5A 2IDLA 2AGQA 3LTOA 1Q53A 2B56A 4H4OB 1VQ6S 4LRBA 3ILIA 4GKKJ 2G9OA 3T41A 5T7LA 1KC8T 5LJ3Y 3PX4A 3J80Y 3BSCA 1QY7A 4WE1A 1FESA 3R5GA 4DU7A 4BBYA 2HFUA 2WB4A 4ZCMA 3QAEA 1U47A 3CD6S 3GP9A 2I8EA 1OY6A 4OZ5A 4FKXA 5L9XA 3PCOB 3CF5Q 4IQMA 3R7SB 3H7HB 4E8UA 4FYYB 3RAMA 1UP1A 3AD7C 1YRUA 4DFMA 3FJ2A 3MMAB 3SEOA 1TU0B 3NG8A 2A6OA 4OYAA 2KL8A 3LA0A 2LFVA 3OXFA 1MROB 1VQ4S 3TVYA 1FD2A 1WOOA 5DQHA 3NY0A 3QZ7A 3P96A 3MM7B 3I5CA 3VCDA 2P6TA 2YNHB 4FF2A 1SKUB 2ZITA 4CH7A 1SXLA 2CZ4A 3R6LB 4QW8A 1CJUB 1E6VA 1JX4A 3MAAB 2D41A 1X0FA 4LF1A 2XCAA 3FCHA 2CAJA 2X1BA 2PSZA 4F4YA 5LSRA 1HR0F 1GTEA 4I2PA 3W60A 1X0PA 4OHWA 2HLUA 5IC6B 2DNOA 4F25A 1VK3A 3N6LA 2ZHOA 3J7YI 2W4CA 3UVJA 3NP5A 1S9GB 2AJQA 1X9SA 3BO4A 2UXCF 4DG1A 4ILRA 3SFGA 5D3GB 4RW6A 2VPXB 1U2FA 4XIUA 8AT1B 2V2KA 5KT7A 4DPOA 1KLMB 1JXVA 1Q86T 3CCVS 4PWUA 3AT1B 3DRSB 3ITHA 3CO0P 2BXJA 4P73A 3QLHB 3ZZPA 3UDCA 4B08A 1Q82T 2ROPA 2MXYA 2VA2A 2IPOB 2BYCA 3G4SS 2W7OA 4P2FA 3W3SA 4KO0A 3D5MA 1H2TZ 4PUOB 3IM8A 1XEZA 2GQQA 3LP1B 5M2RA 1FKPB 4U67Q 2CQIA 4DV1F 4K4ZA 3L7PA 2IVMA 1SC6A 4I6AA 1FKOA 3R5JB 3HSZA 2ZH7A 2HKEA 3WDOA 4RW8A 2V68A 2CZ9A 4ZIVA 5HLFB 5K8NA 1DTQB 4ZCIA 1S1VA 1R7IA 1X4CA 2VICA 1KDNA 4C8LA 1JLQA 2YTCA 2DD8S 2GIQA 5KFLA 2HS0A 1Y11A 2XM3A 4JYAF 3T6JA 4DL2A 2E9RX 5LXRA 1J5OB 5J1PA 4F04B 2KYXA 2ZNZA 1K47A 4OYPA 3DDKA 3RB3A 2G2ZA 4DX5A 2B5JA 1AUSL 3RBXA 3SCLE 1SL2A 4ANDA 5SUHA 4YN3B 1UJ4A 3W9HA 5J1EB 4F0HA 2XMTA 1VQLS 4ZVUB 4QIGA 1NDKA 1T05B 1RB0A 4B9SA 1X5PA 1HNXF 1ZAVA 3GYXB 3QIDA 5FLXY 2B8PA 5CHCB 4DCJB 3KNAA 1NPPA 4HI1A 4I68A 1HW8A 5KFJA 2CZVC 2YQ1A 3ILOA 1DZ5A 2OPRB 4J9SA 4WKRA 5GAEU 5LXYA 4P2SA 1O51A 2RQKA 3NAIA 1HD1A 2DGUA 2OPSB 3W8GA 1N36J 1M1HA 3QNWB 3T1HJ 4OI4A 3WZ0A 2MHNA 1KLNA 1HNIA 5GVQA 2J9EA 1U1RA 3BGUA 3KLGB 3GCWP 3KLIB 4NL5A 4O44B 2QL5B 4RNFA 2W2MP 4ANEA 2PN6A 2YWWA 4NLVA 3OTOJ 1F5CA 2W9CB 3BSNA 1B0TA 3CJTA 3VVUA 1RXOB 2RJZA 3RAXA 5JVGQ 4KIAA 1UWAA 3GU0A 5G0RA 1FD8A 3JSBA 2B9WA 2OD4A 1SI9A 3A13A 4K5RA 3G71S 4QWAA 1TL1A 3EXCX 2HK3A 2KHCA 5I3UB 1S10A 4DSLA 1RCOB 5KFPA 1W2IA 2OO4A 2XWYA 2HVZA 5RUBA 2VFUA 2MQQA 3ZZZA 1JLAB 4PYDA 1W26A 5HMWA 4CDIA 5ETOA 3MD3A 2MKCA 3MPDA 2FHMA 2X7IA 2DNQA 3NXZA 5HMZA 1MMDA 1OS5A 3MAQA 1PGZA 2QFJA 1OJ4A 3DGVA 2RIJA 2DNKA 3MI7X 4ECSA 2ZWPA 4ED0A 2P8IA 4FYXB 1MSWD 3BGRB 2GNKA 1T94A 2YWGA 1CULB 3KK3B 2W9BA 3C15A 3D9BA 3EVOA 3GILA 2KM8B 3NNHA 3M30B 3I4PA 4J9QA 3B54A 3TR5A 2LXFA 3D6MB 4PG5A 4OYWA 1YDLA 1FT8A 4WPAA 4OI2A 2FUG9 3LP0A 2E1RA 5DZ7A 1U6ZA 3KK1A 3PFEA 3TVKA 3P49B 2B9EA 3QIPB 5E3QA 3BGOP 4YY3J 2XHWA 1CJKB 3UNYA 2J6SA 1T02A 3DRPA 1RAHB 3DLEA 4U7UD 1SB6A 3D3CJ 3A3NB 3W65A 5E41A 1HMVA 3M4XA 3OR1A 4DV2F 1S72S 3J81j 5GMDA 2JEJA 3G6VA 1WWHA 3E01B 1RP5A 4EWTA 2RMLA 4F3QA 1WF2A 4KHMA 5L46A 2C3UA 3IR5B 4DR7F 5CABA 2VJVA 1EP4A 3RUBL 1PC5A 2DNPA 3SZ2A 2ALZA 1MMNA 3GIKA 4TNOA 3OXGA 1CC8A 2ZUGA 4KH1B 4GC6A 2DEJA 1XMQF 1JB0C 1R8BA 1LXJA 1N6QA 4JV1A 4LQ3A 1IWAA 2IAJB 3MEDB 2IJRA 3SSSA 2J9DA 4LQ9A 4PQAA 2HHHF 2GJFA 1RU2A 1LFPA 3BR9A 1X9WA 4LT6A 2IFXA 1PAEX 5J2NB 1LWEB 1KTQA 2G0CA 3MMCB 2WRMA 3UW1A 2M7SA 2QA4G 3BDPA 3T9NA 2Z58B 1MG7A 3FNNA 1TL4A 2LECA 3ZTSA 4RL1A 1D1UA 1RT4B 2RQCA 1TR0A 2RQMA 4TU9A 4E0DA 4ZS6A 2Y0BB 4CTAA 4Y0FA 1DLOB 5F8GA 3M1VA 5I42A 1KN6A 4CLWA 3R2DJ 4JI7J 4FBUA 2HSEB 1GFWB 3AQPA 2E44A 4KSEB 2OIHA 2AYMA 5KFDA 1TL7A 3TX8A 2U2FA 3JXOA 2WCXA 4I69A 5KFSA 1NB2A 5BR8J 3PY8A 1S1UA 2DGTA 2XZWA 4WIIA 2KRBA 4HR2A 3OFEA 2FYXA 2Q3PA 3FQKA 3C6TB 4WK3A 2N3LA 2ALYB 2M52A 4NZ7A 2CNLB 2F63A 3G8SA 1NHVA 4K2JA 3HXMA 1U1OA 2IYGA 3R97A 2JEGA 3VV2B 3DRYA 4LFBJ 4ES3A 4NCGB 3HHLC 4WU2A 2ZJRQ 4A8OA 3CW2C 5L38A 2FD2A 3W7BA 3Q23A 1F9FA 3PRDA 4CLTA 3BYRA 3MZIA 5HMYA 1WF1A 3K7RA 3U27A 1FA0A 2DNHA 2JWNA 1LWFA 4A8SA 5E33A 3HI9A 4DUZJ 3L4BC 5CYMB 3UD3P 2KT5A 2QYGA 3FEYB 3OVBA 4FVMA 1FERA 4K2XA 3BB5A 2LQ9A 1Y4ZB 3US5A 3N5BA 2P9GA 2RD5C 2W1BA 2L48A 4G1QB 1R8AA 2VV5A 5LOQA 1RZMA 1CQMA 3J7YU 2JVOA 4C11B 1SIWB 1HBUA 2FVCA 2I6WA 1RCXB 1UEUA 3G8QA 4MJKA 2MQPA 5C24B 4C8KA 3EPGA 1TK0A 5CZVA 1JLBB 2DGSA 3B4DA 3W2VB 4OJHA 3RAQA 1GQEA
chains in the Genus database with same CATH topology
2JC1A 1JLGB 3DRPB 3PKYA 4DR5F 1JLFA 1YBAA 3OUYA 2OTLS 1RA6A 2DTJA 2HMIA 4JV2A 4I4BA 1RT5A 3VAKA 3IRWP 2OD6A 2M3DA 2R9LA 3N6NA 3TA2A 3ETOA 2WSFC 2RQ4A 1B64A 1TK8A 2KRRA 1HMVB 3I9V9 4ZLPA 3OR1B 3IAS9 4HEA9 2GMHA 5GADU 2WBRA 4A46A 4O4RA 1ZTWA 4MTPA 1JJ2R 2R7WA 2DGWA 3BGLA 1G1XA 1IN0A 3V4IA 1X4BA 1F2GA 4Z37A 4ZA1A 3LP2B 4KT0C 1HBNA 2GIRA 2FVSA 3SV3A 4M95A 3AHPA 4YB5A 2J76E 3KJVB 1D0EA 2L3MA 2KB2A 2A2DA 1TL5A 4LFAF 4O23A 2BM1A 5JVHQ 3KLVA 2GX8A 3SDEB 3LH2S 4YY3F 4JI6F 4CO1A 3CCUS 4DSFA 2XMWA 1KTVA 4Q2MA 4QR0A 5EDWA 1TKZB 1ZBTA 4NA2A 1FRHA 4NA3A 2YWFA 2HFOA 4NLUA 3P6YC 2IMOA 3NKYA 5KOXA 3S8SA 1EP4B 3BEGB 4RU2A 2YKNA 3DCAA 1R27B 2ROGA 1RTIB 4BCAA 3MECA 1FNOA 1ULRA 1GXLA 1WHXA 3C66A 2BABA 2R2UA 2GC8A 1VQ5S 3O3LA 3MMBA 2UVUA 3ZFVA 3M05A 2AJ4A 3MDFA 2XY5A 1M0SA 1L5UA 4RBUA 1KFSA 2M2BA 1U6BA 1N6QB 1WEXA 2MKIA 2PC6A 1F0XA 3JSMA 4QIEA 4DQIA 3CIZA 4AE5A 2W8LA 4DR4F 4GMKA 4NLPA 2JLEA 1KHWA 4HTJA 3KK2B 2MZSA 3I0SB 3QJPA 1TV6A 2HHXA 4OJGA 3CCTA 2C2RA 1D3WA 3UCZP 4DR3F 4F50A 5E5NA 2BE2A 2ZM6F 3CCZA 5KT3A 4ZVHA 3IXQA 1SIZA 3QPIA 4NLYA 1FXLA 4OLPA 2EI5A 2V9WA 2SXLA 3Q24A 2Y1IA 1Z2LA 1CSJA 1RT3B 3C3LA 1Y5NB 3OTDA 4I56A 3JB9k 2M4MA 4TXSA 2HFZA 4Y28C 1ZTTA 3MUVP 1SJ3P 1FTCA 3M2RA 3I4HX 4CT9A 2LXIA 1FDNA 4D3HA 2OPPA 3DGPA 2CPIA 2QT7A 3PX6A 5IM0A 1BC6A 4NLRA 1VI7A 5EHHA 2ZE2A 4P7VA 3NL0A 3H98A 2MGZA 4ZP8A 4NWBA 3M8PA 2LDYA 3BN7A 3NBPB 2YKQA 4U7UK 2I9SA 3BSAA 4DBQA 5G4DA 2UP1A 2EC0A 4HT5A 2WOMA 2L41A 2DBBA 2R7QA 2RNEA 4RZRA 3PV8A 3DLKA 1HW9A 1T3NA 3DLLQ 2F3JA 2KFNA 2DRAA 1JLEA 4YB7A 5JJBA 1GNKA 3RB0A 1RKJA 3MM9B 4TYBA 2R7TA 3K5LA 3TNVA 1Y7PA 3T6BA 5DG9A 5J2MA 2W4DA 2X3GA 5HP1A 2E29A 5K14A 1WHYA 2MDAA 4RNNA 4HKQA 1BQNB 2MKSA 3CC2S 2C42A 4UY85 3CJ0A 1VC5A 4DEZA 4OJ3A 4JV0A 3CSKA 3LAKA 1S77D 5K8PA 3DOMA 2CQDA 3D0IE 4CO2A 5EX0A 4FF4A 5E3AA 1YI2S 1D8ZA 4PKDB 1URRA 1N52B 3G8TA 3M1VB 5I42B 3H40A 1U1QA 3G86A 3THVA 4QBUA 1P6TA 1AXQA 5KG0A 4YR0A 2IMWP 3K5OA 4OX8A 2YH0A 1HBMA 4BC9A 1S1WB 1KD1T 1N0UA 4IRKA 2AX1A 1S4FA 1XC9A 2DR8A 4QU7A 1LXNA 1RKIA 2DB1A 4QYRA 4OHZA 3NNCA 2XS2A 3KMSA 1N34F 3BSOA 1K8AT 2DIUA 2FY1A 3NS5A 2AYBA 3PIPQ 4RKUC 3CCLS 2E5HA 3OPKA 2D9OA 3IS9A 1YHQS 2NZ4A 2WK4A 3EUNA 3IG1B 4Q2LA 1Q8BA 1S1UB 3GWCA 2ILZA 3UDLA 2YWHA 4LIRA 1UVJA 4JI0F 2OFGX 1K1QA 1SV5A 4X4QA 5L8RC 2QYCA 1RK8A 5A6WA 4HL9A 4TY8A 3OVSA 2W8KA 1FJGF 1S6PB 3DFEA 1MWYA 1GAOA 2PGCA 2JRSA 4XPEA 1FJEB 1N5YA 2RU9A 1WTFA 1R0AA 1IBMF 2FJVA 2PA3A 5IXUA 5DLGA 5IT9Y 4Q0BB 3MTKA 4W92B 1DJ0A 2CQ2A 2AYGA 3Q0AA 1URNA 4CO0A 4JI7F 2ZH2A 3FSYA 4AL5A 2APOA 3MEKA 1GXTA 2X51A 4M8LA 3GV5B 2VONA 4ZCKA 4R8UB 1U1MA 4DS5A 2EG2A 4ES2A 2WHOA 4NRTA 4OHVA 5EX3A 4H4KC 4UQTA 2CVIA 2DCUB 1NH7A 4K5SA 2Y1RI 2CRLA 3GFHA 2J0XA 4RNHA 4C0HA 4XO0A 4K4SA 3CMAS 2NPIA 2JX2A 3MD1A 2E1MC 3BS9A 4I6WA 1RWUA 2N3OA 1C0TA 2CQBA 5LSOA 5BR8F 1N5TA 3GR0A 1QTMA 2B7BB 1RA7A 2F9JA 2F8HA 2PDAA 3GB0A 5KFFA 1Z2ZA 3JTOA 4OMFG 2R8JA 4IYQA 4B9LA 2C2EA 3CD5A 4UW2A 3RRHA 1NK4A 5D77A 4K4YA 1H3DA 1YJWS 2OPQA 2VH7A 2YKMB 2DR5A 2Z8QA 1Q8LA 5H1SV 2YWEA 3D28A 1BQMA 4CO4A 4NCAA 5K9FA 3K59A 2FJEB 1TAUA 5C5JA 3HM9A 5J2PA 3W2WB 4HDGA 3ZC4A 1JK9B 3MM8A 3ZZYA 1HYSB 1M90T 3TVZA 2O1PA 2DH9A 1C1BA 3ULHA 2CFXA 3MEGA 2HNZA 1TL3B 2OLWA 4OHXA 1V3ZA 2D1CA 4MH8A 1S1TB 5IQQA 2CPEA 1U4BA 1AFIA 3DLHA 1S9EB 1KVIA 5EWFA 1SUQB 1SH2A 4QCLA 4QIVA 4LFBF 4EBEA 1X9MA 1DTTA 2O01C 3M6UA 2E9ZA 3OLAA 3FMBA 2YVSA 5AXKA 4MYUA 2B51A 3GIJA 2FHJA 3BN4A 1SQEA 2K3KA 3M9MB 2ZH9A 2E5GA 2KFZA 4FNIA 3S1TA 2ZVSA 3TANA 1M5OC 2DHAA 3MF5A 1NEEA 4KKOA 2B6AB 3HHLB 5CYQB 1FEEA 2CJAA 4TU8A 4H4KA 5LMUF 4AFFA 1NK6A 1S6QB 2PI4A 2RS8A 1GTHA 3F41A 5A8RB 1OO0B 4JI3F 3LW5C 2D74B 4FBTA 1RTJB 1HBUB 1LOUA 4PXDA 1UETA 1ZM2A 1LWCA 3VALA 1C4CA 2VG6A 4DUZF 5KFVA 2HZCA 3JYTA 4DOZA 1Y5IB 2FDNA 4QPXA 1N56A 3TOQA 2ADCA 4LVNP 2ZBCA 2IA6A 3T5HA 4IKAA 4KB7A 1RTIA 2D9PA 4L72B 4B3OB 1VLYA 5AE1A 1U49A 3O5TB 2N82B 4FPRA 1HPZA 1RT6A 3C8YA 1QAIA 2VFTA 4OQJA 2DITA 3O8WA 2DH8A 1C0UA 1JLFB 2OMLA 2EKYA 5KG3A 4FZVA 1A6LA 1MU2B 1X5TA 2KVIA 3OUYB 3JSRA 3PW0A 1RT5B 1V9OA 3N79A 4TN2A 3RZAA 2KDOA 3KLFA 3CC7S 3R5DA 2B9XA 2BQUA 2LCWA 3POTA 2B7CB 1KNZA 2KYZA 4BWMA 2C3OA 3B4MA 3D1OA 2PD1A 1GX5A 3CJ5A 2LMIA 4KTQA 2B0GA 4ES1A 2QSWA 2HHVA 4DHVA 1U6FA 5D4LA 3V4IB 4ETXA 5L1IA 4RLEA 1HBNB 2C3PA 2K2PA 1YJUA 2NS1B 2X1FA 2JZ5A 3NLCA 2VG5A 4NLOA 1MMLA 4QYZJ 1OIAA 4ZPWR 1FNMA 4X4UA 2PIIA 2R8KA 4DMZA 3OL7A 4J5OA 4CH1A 1TKTA 1FXRA 2BZ2A 4OI0A 1QAXA 4WXWA 1PILA 1M5SA 3M8QB 1LW2A 3I0RA 4URGA 3HLUA 1DQ8A 4RU9A 3PW5A 2IYIA 4C4WA 4NXMF 1DAXA 5F41A 2YKNB 4NZ6A 2XI2A 1DQ9A 1K0TA 2VASA 2CPYA 2HWHA 2XEXA 3MECB 4HH1A 5IQ6A 3HHKA 2PMZD 4M1KA 3NBPA 4C8OA 4Q8EA 4KV8A 1M5PC 4MIBA 1XNRF 1PSDA 3MOJB 4O0IA 3MMBB 1ZPWX 3HK2A 4XAKA 5KFGA 1LFWA 3QO9B 3Q2TC 4FNHA 1C4AA 4EUVA 2LLZA 5DQIA 3MGJA 1FK9A 1NK9A 1GH8A 5CXTA 4DFPA 3TW0A 3IR7B 2CDQA 1RQ0A 4FN5A 3MR5A 4LF9F 5KG5A 5DDRC 1VQ9S 2WBMA 5BYSA 4FF3A 4TQSA 4I7FA 2E1AA 3NCPA 1VJWA 1TV6B 1KVJA 2JFKA 2C3YA 3CJ2A 1N5QA 5E2QA 1BQXA 5KT2A 2E1CA 2AGOA 2BE2B 2FB0A 2W4PA 3I56S 1YITS 5GMKa 1Y3KA 2VKRA 4KBIA 4F26A 2HQIA 3DI6A 2ZH1A 1TKXA 3V6HA 3THTA 5KG1A 3SSRA 1LV5A 1VGYA 2L9DA 4C3KA 1DHMA 2FJXA 4Q44A 4OZLA 4NLDA 5ITHA 4C8NA 1D9FA 2N4DA 3HPOA 1XMOF 2ZD1A 1S79A 4YDDB 1R43A 2KT2A 1Q81T 4ED1A 1ZM4A 2NSBA 2PEHA 3AQOA 4IDKA 2BQ3A 1U8SA 3OTBA 4F67A 4JI4F 5DGAA 2OPPB 4ELUA 3ENQA 4O3PA 5IM0B 3HVTA 3RRKA 2ZE2B 1WF0A 3HF5A 3KTQA 2MGZB 1JKHA 2AJFE 5DG7A 4TY9A 3M8PB 2DHSA 2NLWA 3PNIA 5I4MA 2PE8A 3PW2A 3JSYA 4ELTA 1RGVA 2VQEF 1HQUA 4RW9A 3L95X 4WF9Q 2Z4PA 2WOMB 1XNQF 3DLKB 1N4LA 1WI6A 3RB4A 1JLEB 2GV1A 3CULA 4O3QA 2V8DA 3DLGA 4DL4A 1WG1A 2XY7A 1UW4A 5J2MB 1VBYA 5HP1B 1NKEA 1ZZNA 2CVEA 5K14B 3CB4A 3MFIA 1FRJA 4DV4F 1X4FA 3IAM9 2GHWA 1IQZA 4IOCQ 2CPDA 2DGXA 2BQRA 1M1KT 2MZQA 3SQGA 1YJ9S 5GADI 1W2BR 1QE1B 5KFMA 5GAGU 2AW0A 3DHWC 4XDCA 1V3RA 1X7VA 3TUIC 1QM9A 4F3MA 3GIIA 1FE4A 5GAEI 3K0JA 1HBMB 4PQUA 1NH8A 5KFUA 4OX9F 4GKJF 4B3SF 5D8HB 1Q4RA 4WK1A 4NX9A 4ZMMA 3CJ4A 1U25A 5HL7Q 1N54B 3Q8QB 4B9TA 2JEIA 1HARA 3ZZUA 1LK5A 2YX7A 4TYAA 4Z2XA 3FFIA 1YJTA 1L3UA 1JXEA 5F3TA 1KR4A 3IS9B 3D0HE 2WSEC 5AE3A 1BLUA 2U1AA 3DU6A 1YJRA 4C3LA 3J7ZT 2AJ1A 5KFHA 2ZJQQ 2ASLA 2RRNA 3VF0B 1VQSA 4EYIB 1F60B 1VFJA 2G1DA 4ED8A 5B0DA 2VBYA 3R1LA 1SV5B 4V19J 2HS4A 2NSCA 4Q5VA 4JV5F 1DRZA 2E5JA 2L08A 2KXNB 4TY8B 4NPOA 3OL6A 2DNNA 1JNZB 4Y34A 3V6JA 3MCSA 4DF8A 1NNDA 2MZTA 1CG2A 1YJVA 2ZBIA 5CH7B 1HYSA 1N5YB 5KFAA 3TAQA 4X4TA 1IQTA 4BDPA 2DNYA 3O2IA 3PZPA 3PW7A 1R0AB 1UFWA 4YUDA 2OKQA 3CD0A 3ENVA 5C25A 4DF4A 1S1XA 2DH7A 2RDIA 4TU7A 4X4VA 1YG0A 1JNRB 2IM0A 2AGPA 5KFZA 3OV7A 4O3SA 2G13A 5K8OA 3N01A 3R1HA 3GR1A 3H5YA 3QYYA 3CD7A 4WKYA 1HNVB 4YOEA 1VRTA 3T1YF 1SJFA 2HLTA 3R5AA 1A7GE 1ZH5A 4IG0A 4X4RA 4H4OA 4BC7A 2UV8G 3DRXA 1FRIA 1NK5A 2CIMA 2GJ2A 2UU9F 1IKVA 5EN1A 3Q8RB 1QAJA 1N5VA 4IOAQ 1R3NA 4FP9A 2MMYA 2CQGA 1UVIA 1FRKA 1B0VA 1C0TB 1J5EF 1KSPA 1RTJA 5IT0A 2VL1A 5T41A 4TKTA 1UJ5A 2VKZG 3ZZTA 6FDRA 5K8MA 1UA0A 1QSLA 1ZPVA 4WFBQ 3KOAA 5LJ5Y 2MSTA 3MR2A 1L3SA 3G6XA 1BGXT 1H0HB 4OIXA 2UVVA 2OPQB 4URSA 1SJ4P 1FCAA 1C1CA 3MUMP 4WZQA 4UOCA 1IKXB 1FNXH 4I6YA 3DRRA 3MUTP 4F4XA 2VFVA 2HFNA 1BQMB 1X4DA 2MQMA 2QMXA 3PFOA 5E7OB 3E2EA 2J9DE 2CPZA 3NNAA 2LQJA 4JUZA 1Z1ZA 1ZM3A 5J2PB 3MXHP 1HQEA 2RKIA 3I32A 2FTRA 3DXBA 3D2WA 3MM8B 4A8QA 2OMOA 3P3DA 2DT9A 4G6VB 1GX6A 2YKAA 5FIIA 1DURA 1RTDA 3PKMA 4HH0A 1C1BB 4ID5A 3MEGB 4ECWA 2DCLA 1FDDA 2HNZB 3VWSA 2QA4S 4IFYA 1YIJS 1YRTA 5AXLA 5F9LA 1ZAWA 3AY0A 3I9ZA 4NMLA 1REVA 1BY9A 1MU2A 1DTTB 3HHNB 2FJWA 2CPXA 4JI8F 3HT3A 4AL7A 2R8HA 5F3ZA 1ZZFA 4DV6F 3HVWA 2NR0A 2JFDA 3NCQA 5L1JA 4I2QA 4B02A 1HFEL 4KKOB 2AF6A 3TI0A 1RT1A 2KHDA 3QGGA