1BC6A

7-fe ferredoxin from bacillus schlegelii, nmr, 20 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
AYVITEPCIGTKDASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the oxidized Fe7S8 ferredoxin from the thermophilic bacterium Bacillus schlegelii by 1H NMR spectroscopy.
pubmed doi rcsb
source organism Bacillus schlegelii
molecule tags Electron transport
molecule keywords 7-FE FERREDOXIN
total genus 23
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bc6A00
1B0VA 4XDCA 1FF2A 1AXQA 2WSFC 2GMHA 5CHCB 1BC6A 2WB1D 1FDAA 2UZAA 2XSJA 1PC5A 1KQGB 2FD2A 3MMBA 1JB0C 1SIZA 3EGWB 1GT8A 3LW5C 2Z8QA 1H0HB 1FRMA 6FDRA 1FRXA 1FRKA 1C4AA 2VPXB 3OR1A 3IR5B 2FJAB 4XDDA 5CH7B 1SIWB 2VPYB 1F5BA 2FJBB 1FD2A 4ID8A 3MMAA 1WTFA 5FD1A 2C3MA 1IQZA 4KT0C 1BWEA 1CLFA 5BYRA 2FJEB 1FXRA 4Y28C 1H7WA 2FJDB 1FRLA 7FD1A 3MM7B 3MM9A 1KEKA 3OR1B 5BYSA 1BLUA 2C3UA 3MM6B 2C3YA 3MM8A 2VPZB 5BYQA 4YDDB 2C42A 3OR2A 2PMZD 7FDRA 1FDDA 2C3PA 1FDNA 2Y0SD 1FTCA 1VJWA 1Y5LB 2WSCC 2IVFB 1KQFB 1D3WA 1Q16B 2ZVSA 3GYXB 4L6V3 3C8YA 1R27B 3MMBB 1RGVA 1GTEA 3MM7A 2V4JA 4DHVA 1BD6A 2C3OA 2O01C 2V2KA 4RKUC 4CI0B 1JNRB 1H98A 4AYBD 3MM5B 3EUNA 1IR0A 2VPWB 3MMAB 3EXYA 2FGOA 2VKRA 3HKZD 1G6BA 1FXDA 2GMJA 1H7XA 1PC4A 3IR6B 4OV1A 1DURA 3MM9B 3PNIA 3OR2B 1GAOA 1C4CA 2WAQD 1A6LA 6FD1A 1GTHA 3MM5A 1Y5NB 1SJ1A 4OMFG 2WSEC 1FEHA 2PDAA 1B0TA 3MM6A 1B0PA 1Y4ZB 1HFEL 1XERA 1FRIA 2XSJB 1FRJA 5E7OB 1BQXA 2PA8D 5L8RC 1FRHA 1Y5IB 3MM8B 1DAXA 4XK8C 3MMCB 2V4JB 1G3OA 1F5CA 1FDBA 2FDNA 1FERA 3MMCA 1F2GA 1ROFA 1FCAA 1JNZB 1K0TA 3IR7B 1DFDA
chains in the Genus database with same CATH superfamily
2ZBRA 4K59A 1JLFA 4L75A 2M7SA 2BEFA 3IG1A 5HVFA 3ZZ0A 3PW4A 4OFZA 1X0FA 4HTJA 1CULA 1QAXA 4HVZA 4OZ3A 2MDAA 3C14A 2B6AA 2FB0A 2RKIA 1EQMA 2DB1A 2V8GA 3UDVA 4XO0A 4DV3F 3FBCA 2MZSA 5IV4A 2W2NP 1RT5A 4LF4F 1F60B 2P2CB 2IM0A 1YJRA 2CWKA 4DSIA 1AT1B 1OSDA 1UP1A 4JUZA 1U26A 2D1CA 3FEXB 3PW2A 3SXLA 3AQOA 1IBKF 4F3QA 1MNEA 1NJXA 3KNAA 1FRXA 2VIHA 1ZYQA 4B9TA 1RP5A 1SC3B 2CNKB 4IG0A 5KFRA 4DL2A 1S6UA 1EARA 1NPKA 2YTCA 4XDDA 3DLGA 2DNGA 4HACB 2XO7A 3THVA 3BR8A 5HVGA 1UPMB 2AU0A 2XS7A 3BBFA 2A18A 2WOMA 3WC0A 3DLLQ 3W66A 1PCAA 2H54B 4BWMA 2BE9B 1TKXB 1N0VC 2FJEB 2LYVA 3C14B 2RNEA 4PEOA 2AF6A 3H5SA 4URQU 4O23A 3BO2A 1SI9A 4ZVQB 1ZOTA 1TL4A 1ZTWA 4Y2CA 2ZH8A 3AD8C 1WSRA 3POTB 4B9NA 5HMZA 2V68A 2DEIA 1E6YB 2VPZB 2W4PA 3KLFA 2G0CA 1FA0A 1FO1A 1RAEB 2G2ZA 2PMZD 2LECA 4KHPJ 3BGFA 2Q66A 3ZXWA 4LF7F 2CG4A 4X4SA 4DV5J 4MIAA 2KTQA 2JEIA 2Y0SD 3R2DJ 3W9HA 2J0QD 3HFZB 4NA2A 5HQMA 5LJ5Y 1UAWA 4OZNA 2NR0A 2ZE2B 4B9SA 2DHAA 2Q79A 3BO3A 4NLSA 4ZCMA 3NAIA 1SJQA 1T7PA 5FLXY 1VGYA 3UDCA 2MQMA 3MR5A 1U1MA 3Q22A 2YXLA 2UUTA 4CLWA 3F41A 3M30A 3MM5B 3QAUA 4WKYA 2V2QA 2EK6A 2V8PA 1QTMA 4JI7J 4ZKAA 3KOAA 2M9KA 3D6FB 1PIEA 2IIHA 3QMQA 2CQ4A 3OVBA 4ICLA 2BJDA 5HP1B 1EZZB 3ZFVA 1FNMA 1FWPA 1BY9A 2CJYB 2RQKA 5GAGI 1QSLA 4DQIA 3QRRA 4RNFA 2JFKA 3OTBA 4N47A 4NCGA 1D09B 3C19A 4CO0A 2WVBA 4B9MA 1L5UA 3KNGA 2QLWA 1KBRA 1S76D 3IAS9 1NB2A 5DQHA 2KU7A 3IO1A 1VQ4S 1MW7A 2HFOA 3T5LA 4PR6A 2J9DE 1IKYB 4X84A 5HANA 4ELUA 5J2PB 3IGVA 1XERA 3FGVA 4DV1J 3B8HA 2LXIA 2M8HA 4FXWA 4K4ZA 3PM9A 4U7CA 1R0AB 2N3LA 1U8WA 1RT7B 3HHNB 3TR5A 2VFSA 1W26A 4EWTA 3VGSA 3DGVA 5FDLA 4K4XA 4C98A 5F8IA 2H3EB 3M30B 3HVWA 4FPRA 3CCQS 4PG5A 3BPDA 3R9LA 2HNYA 1NK0A 2IBKA 1TKTA 5AJ3F 4NLDA 4YQWA 4WZQA 3M1VA 2JZ5A 1Q1KA 1NXIA 2E44A 3LA0A 1ZAVA 4NEZA 2UXDF 2BJ7A 5I42B 3OTEA 1U2CA 4PKDB 4F2SA 4KV8B 1JLEB 3UR3C 1B0VA 3S8SA 4Y2MA 2VOOA 2KFZA 1ZZFA 3MF5A 3EXCX 4I4BA 4B3TJ 4A47A 1JKHA 2OO4A 3KTQA 1AUDA 5BR8J 1VISA 3G6ES 3VAFA 2DNHA 2HQ3A 1EIYB 4DG1B 3MEDB 1ZS6A 4A8QA 1C1CB 2RD5C 1YRXA 2H5EA 4F7VA 3CJ5A 2RU3A 1WUUA 2GVZB 4IDKA 1QDUB 2N4CA 3I4PA 1ZM2A 2VFVA 2MLXA 3HSJA 4P2XA 4RW8A 3HPOA 1IBMF 1YJUA 4LF8F 5LXRA 3EE3A 4WJBA 4FS1A 1P1LA 2WZ1A 4ZIVA 1A9NB 4X64F 1WHWA 2RJZA 2XCPA 4HDHA 1RCOB 1VQLS 5B0EA 1IWAA 2HBZB 5AXKA 5KOWA 2W9BA 3JQKA 5ITHA 1T94A 3NS6A 4ANCA 4DL4A 1X9SA 3RU0A 5HROA 1HQ2A 2ZBQA 1VS3A 3DM2A 3GU0A 3TO8A 3J7A1 5HMWA 2RRNA 4OYPA 1KN6A 1WKLA 9RUBA 1UJ5A 2XLJA 3CPWR 2XI3A 3AXKA 3L7OA 1S99A 5DS7A 3CW2C 3LF0A 3VAKA 3O1LA 4WZMA 2CZVC 2JHEA 4CLPA 2C42A 2HEKA 1YK9A 1IQTA 4FF1A 1GFWB 3FDSA 2R7OA 3ILJA 3NGSA 2VQEJ 4JI5F 1LEOA 3SCJE 1OYEA 1TVRA 5MAOA 2KJWA 1EB0A 2CPIA 2ZOGA 1K44A 2GX8A 3H7HB 5C42A 1ZTTA 1HLWA 3LP0B 4USUA 1BQMA 3TRGA 4A8SA 4ZOSA 3HSDA 3BBBA 3CD6S 2MKCA 3E01B 3OQ2A 4OX8A 4DCJB 1LW0B 4DV0J 4EO6A 2IJNA 3QYYA 4JI4F 2XY7A 3KMQA 3PZPA 4A8OA 4IRCA 3K58A 1SXLA 2FLPA 2VD3A 3BKTA 1JLFB 5IWAJ 4LRFA 1RT2B 3ZZUA 5J2MB 3MWBA 2DRAA 2E7WA 4O3PA 1KOHA 3I87A 4F67A 4ECSA 1FWKA 1SH0A 4ZMMA 3BM7A 2DEJA 2CJQA 3WBZA 3QAEA 2ZDOA 5IOLA 1RTZA 5EGYA 3RZAA 2XY5A 2KXFA 3IR6B 1KFSA 3LO3A 2GC8A 2YQ0A 3HSGA 4M63A 4PAAA 1CJKB 2UXCF 4ECWA 5ETVA 2E7VA 3FC9A 1R8AA 5LT5A 4ZA1A 2V9KA 3NWRA 4BC7A 5LXYA 2HHXA 1MN7A 4DF8A 5D0EA 4KB7A 1F1BB 2HKEA 1BHNA 1GMVA 2FVCA 2J7WA 2ZC4A 2LA4A 3CD5A 3ZZTA 3W9JA 2PEBA 2HHTA 5KAKA 2DY1A 3KLGB 3HP6A 1BQMB 5DG9A 1UA0A 3P49B 2JRSA 1FKPA 5DG8A 2XB2D 2K2PA 4RW7B 2EBGA 2BOAA 3TVZA 1SL1A 4O3OA 2NQPA 4YEAA 3MCMA 4B9LA 5CYMB 1DAXA 1RA7A 2OPRB 3T1HF 1QAJA 1B70B 5KFCA 3EICA 4IR9A 1XQIA 2P9EA 1N48A 4LF6F 2UVWA 3N6LA 4QIWD 3V81A 3PX4A 2HHWA 2CZ4A 4HYKA 2HFSA 3KJFB 4ZVPB 1YZ7A 3DKDA 3QJJA 1GXUA 1UJ4A 5A76A 5LSLA 4V19J 3T1AA 1IBLJ 4JI8J 4Z7YA 4LUBA 4P75A 3HSZA 2CVIA 4FYVB 3UQSA 3V2UC 2Y8YA 3B4DA 5IT9Y 3AJDA 4RO0A 5CHCB 5DLGA 1NB7A 2XG8A 5JVHQ 3CDUA 3VV2B 4LF6J 5IT9U 4B08A 4ITSA 2N7YA 3T1YF 1WELA 3KLGA 3MR6A 1RTJB 2ABYA 4ZPWR 3NNAA 3N01A 2VG6A 3QRQA 1JIHA 2DGSA 1UW4A 1JLBB 2IDEA 3W60A 3OTOJ 1NPRA 5DZ7A 2HQGA 3K17A 1KVIA 2EXUA 1C4AA 2FHMA 4FNHA 3PEJA 4FVMA 3SI8A 1WG1A 2MY8A 1Z1ZA 1OPZA 1U2FA 3TUJC 1SJRA 4LR9A 3CO0P 2V8VA 2QL9B 3OJUA 2JLGA 1SKWA 2MXYA 4P52A 3W5XA 2IVMA 1F2HA 4X62J 2RU9A 3CJTA 5ETTA 5FJ4A 4UQGA 2UXCJ 4NL5A 2NREA 2B4VA 2VJUA 1M5KC 1T0TV 3BDEA 4O3RA 2X3GA 2IRYA 3RR7A 4O3QA 4NZ6A 1KR4A 1IJFB 4IR1A 1MMNA 4Y65A 2Z2MA 4X66J 2QL5B 2RMLA 3GTYX 4X65J 3T5JA 1FD8A 1NK9A 2XMVA 2VV5A 2CAJA 4ZCKA 3AB2B 3TWZA 1TP7A 3RGIA 4DL3A 1LWXA 1ZM9A 1N5QA 4DV7J 1RSCA 3DFEA 4P2MA 4C2MA 1VQ5S 3NOGA 2ZJQQ 2UXBJ 1HR0J 1CJUB 1H2UX 1UZDA 3KYLA 4WFYA 2WSCC 2A6OA 1X4CA 2VKZG 2K7JA 2BZ2A 1SPBP 4CYUA 3EGNA 3IS9A 3H5YA 5C5JA 1VC6A 3W2WB 4KYZA 2R7XA 2BJ3A 1S0OA 1YJ7A 3HVTA 3IRWP 4K4YA 4L6V3 5HK4A 4MK9A 4J9RA 2GFFA 3J7Z5 3TARA 3CCLS 3TVYA 2NCKL 4RBVA 3WQPA 2UXBF 1N0UA 4K0KF 3ISZA 3ET6A 4AYBD 5I3UB 3G4SS 2O66A 2FJVA 2RHSB 4DV2F 3CIZA 4CLSA 4HH1A 3HKZD 4HHJA 5A6PA 4DQQA 1YGYA 3A12A 1WOSA 3W7BA 4RW9A 3HZGA 1T9WA 4KH0B 4I2QA 2NPIA 4ZPTR 3TEGA 2CQ3A 2IJRA 3FQKA 4RBTA 4F8RA 5KFYA 4LIWA 3C16A 3M8PB 4EEYA 3VHQA 3CCUS 4ECTA 4UOCA 5KFEA 3Q86A 5CD4A 5I4MA 1LV5A 5KFXA 4B9UA 7AT1B 4QU6A 2A0FB 4DOZA 3DOMA 3PRVA 4TYBA 1BQNA 1H72C 1RABB 1QM9A 1R8CA 1XJWB 4OMFG 3W1YC 2DHGA 2J0WA 2DO0A 3O44A 2D3ZA 4ZDNA 5DLFA 5KT6A 2OTJS 2OPSB 1FVSA 5SZTA 3KUEA 1P1TA 4EK2A 1MWQA 2GAHC 3W64A 2UU9J 5B0GA 1DJ0A 4LF5F 2IMWP 2E29A 2YX4A 4NRUA 4RU9A 2JNJA 1HW8A 1HBUA 3TAMA 5H1SV 2MQPA 3J80U 5DGAA 3MAQA 4ZP6A 2E1CA 4P73A 3D0IE 3CJ4A 4OX6A 3B54A 2V34A 3BDPA 2Z30B 3UN2A 1R89A 1NSAA 3H8YA 3R27A 3MD1A 5KTQA 4X4TA 4YR2A 1PJ7A 2Y1IA 4FPIA 1FJGF 1KP6A 2UUWA 1HI8A 1DTQB 1GK8A 3R97A 4FNIA 4Z7CA 3JQMA 3BO4A 2YKNB 2QA4S 1AB8A 2MZ1A 4GVBB 1GMWD 4KFBA 1S4FA 1VC5A 1BUXA 5GMDA 3ZZPA 2QYCA 2R7RA 2HHHF 4OI0A 2I0XA 1YRTA 2IM2A 4ZPCA 1R8PA 2WB1D 2MKYA 4NYOA 2AX0A 4TQRA 2KJVA 4CO2A 2WVDA 1FVQA 1H6KX 2F5GA 1VQ9S 4B3RF 1NJIT 4OL8A 4TU8A 4F2RA 1HQEA 4CIOA 1YBTA 4DPUA 3KK2A 1TL3B 2YWWA 2EW9A 4U8VA 3LGMA 3N0VA 2PI4A 2ZBCA 5L9NA 2YX1A 4UOHA 2H4WB 3CJQA 3R6LB 3BH6B 5KG6A 1WKKA 1J5OA 1FRMA 4DXLA 3I5CA 5KFSA 3PKMA 2DHXA 3AOBA 3KFWX 4GC7A 4J37A 3SSRA 2FJAB 4BC9A 4K4WA 3R2CJ 4U9RA 4GKJJ 1H73A 2LVWA 2W4CA 1R0CB 3QSYB 3RAQA 1VQ7S 4JYAJ 1XBWA 3UI3A 3AOAA 3Q8YA 5AE2A 5KG5A 2LU1A 2CPYA 1RWKB 1VI7A 2DNKA 1CLFA 1SL2A 4G1PA 2ZUAA 3GG0A 3PX6A 5LSOA 2W2MP 3HX9A 4KAIA 2Z2LA 4HEA9 4N76A 4YB7A 5T14A 2OD6A 4DR1F 3UDLA 4RW4B 3UNGC 2CA9A 5GADI 3Q8QB 4KFBB 3G8SA 2QLJB 1BLUA 3MM8A 2C3YA 4JI0J 1FXLA 3O8WA 4LFAF 1F6TA 4MH8A 2KM8B 1FHTA 2DPJA 2GGPB 2MLZA 2OELA 1JLAA 3NG8A 4KQZA 3AH6A 1RT1B 4EMDA 5IT0A 3GIMA 2C3PA 1PILA 3Q89A 1WC4A 2PMHA 5IWAF 3LGNA 1REGX 3JSMA 2IC3A 3C2PA 1JLGB 5HO4A 3VAHA 1U47A 1BGXT 3PYGA 3PFEA 4C48A 4ZN3A 2ROGA 4YR3A 4NA3A 3AD7C 2OLWA 2ZVSA 2JEFA 1CSJA 2Y0BB 1VBZA 3SV3A 4IRKA 2LQ5A 5CA5A 5A8KA 3ZNUA 5KFHA 3GSDA 2HGMA 4DUZF 3PCOB 4HACA 1I94J 4KKOA 1SKRA 2G2OA 4Y0FA 4DZ6A 4ZP8A 2MKHA 3EMTA 1WACA 2DTJA 1M5VC 1D8YA 4JI6J 5H9EJ 4LRCA 1FJGJ 2HRUA 2KYXA 2XMMA 3U02A 5EDWA 2HYIB 4TQSA 3PO4A 4C8OA 2GMJA 4BBYA 4DPYA 1YI2S 3BN4A 5LM7E 5LMUF 1X4FA 4K5SA 2RQMA 1SC4B 3VTIA 3DOLA 1U09A 5HMYA 3NGDA 1S57A 4EBEA 4KGMA 1RTDB 3OBIA 4GKKF 4ID5B 2J0SD 2HNZB 4ZS6A 1GMWA 4UZBA 2LFVA 1LW2B 1WOOA 2IRXA 3OLAA 2OAUA 2DR9A 4IRDA 3OL6A 3GJQB 1XC9A 3MM6A 3DLKA 1HW9A 2F4VJ 4PXCA 1NNDA 5H9EK 3D3CJ 3HFKA 4WXWA 4DU7A 5F8LA 2MKIA 3LALA 1V3RA 4ILRA 4X4PA 2HQCA 2ZJPQ 3KK1B 2EG2A 2HURA 3K8WA 3CCZA 3PW7A 4MMOA 1EETB 1R8BA 1S1XB 3DC2A 5HBMB 3UR0A 2ERRA 1KSPA 2W8LA 2R7QA 2WVCA 2CQ1A 3MMCB 3JSRA 1F3FA 3U27A 3LP2B 1G4CA 3GLJA 3OVSA 4DUYJ 4Y00A 4ECUA 2V4QA 2M88A 2E66A 5E3RA 4B3TF 4C0OC 3L9ZA 2AYBA 3EZOA 3LQVA 2HIYA 3FBBA 3MCNA 4LJMA 4DV2J 2BOPA 2MJUA 1QSSA 2C2KB 2GJFA 2V63A 1RLDA 2AV5A 2YWFA 3RRHA 1S0MA 1R7IA 5KG1A 3OLBA 4CLFA 2FZGB 1U25A 1YJTA 2P8IA 1E6VA 2XM3A 2VQFJ 1W2BR 3WC2A 4NOHA 2I9SA 1SV5A 3Q8SB 4ID5A 4LR8A 3QJLA 3W62A 2VC0A 2MQQA 4FKYA 4Q2LA 2D69A 4ZVGA 2WONB 5E3PA 1WF1A 3GJRB 3ISND 4PWWA 3TEHB 3GIRA 3C66A 1U0HA 4Q44A 3RTVA 2XS2A 4NLVA 5KFTA 3RAXA 4K4TA 3D67A 3CWJA 3TZXA 4C6AA 1QSYA 5FDLB 1M1KT 1KONA 2J6SA 3CC7S 2KN4A 4DI6A 2XZDB 4IFVB 2FYXA 4RWXA 3CUNA 2RS2A 4X66F 4JI2F 2DNLA 5CH7B 2NPFA 4DN9A 2BRLA 2AT1B 3RJMB 3MMAA 2DNZA 3A13A 5KG4A 1Y7PA 1FX4A 2CG8A 2MLYA 3CIMA 3IBFB 2QT7A 3V4IA 1S77D 4YDXA 1RWOB 2JH3A 1NHKL 4H4KA 3H40A 1EJ7L 3CVKA 5D3GB 2NZ4A 4FBTA 1X5TA 3BGOP 5A8RA 2YKPA 2XC9A 3A8KA 4QOTA 3GV7B 4ZLLA 1TKTB 2LQBA 1NKBA 2HHUA 3HHEA 3CJ2A 1VJQA 5H9FJ 2CKWA 1X5OA 1JLQB 2GIQA 2M4MA 2YWEA 3D5MA 3ILLA 4ER8A 4JI2J 1NCLA 1HBNA 2RQ4A 2QMXA 1IM6A 2B7CB 2X51A 3E8OA 1YG0A 2CPDA 1UEVA 2RS8A 3HJVA 4OYIA 4FXDA 2VL1A 4DUZJ 1RUSA 2DH9A 3KLIA 4YR0A 5D4NA 5CXTA 3KG0A 4J9SA 3KLVA 5F3ZA 4N8OA 4B02A 3BGRB 4OJHA 3W5ZA 4X4VA 3Q8UA 1Q16B 4IKAA 2F7VA 3JTNA 2K1RB 5CZXA 5LJ3Y 4Q8FA 1DTQA 1NMEB 1JJ2R 4YMEA 3K0JA 4IYQA 3X1LB 5F8NA 4ZPVR 4OLOA 4DF4A 4Q5VA 3OSNA 1S9GB 1UVIA 2V4JA 1LFPA 4JI8F 4M5MA 3TW0A 3UWTA 3E51A 3R7SB 5B0CA 1YBUA 1IBLF 1T8EA 1MROB 2F9DA 4H4OA 3I56S 3THPA 1HNVA 1Q79A 3TJAA 2VA3A 1IN0A 3R5CA 4OIXA 4F02A 2JDJA 2H4YB 2B51A 2HFZA 2OPRA 2YPYA 3DI6A 3QBCA 4F4XA 2HMIB 2KDOA 2QG9B 4IH5A 1LKZA 4PRFA 1PC4A 4J5OA 4PQAA 1PKUA 2DR6A 1FKOA 3L4BC 4AT1B 2XQCA 1RKIA 3EDRB 2LQJA 2DR7A 1S0VA 1MU2A 1UVKA 2YKOA 4RNOA 1N33J 2VZ9A 2CADA 2WCXA 2Y9HA 3AODA 2K1RA 1N34F 2DNNA 3FCWA 3Q2SC 3QLHB 2HHQA 5C42B 4PG6A 1IKXA 1KKHA 5EX3A 3DYAA 1NJYA 4RR5A 3CF5Q 2DCUB 2XSJB 3CCMS 3T6JA 3ZTRA 1HA1A 1FRJA 3PX0A 3D1QA 2QN6B 4L72B 4ZITA 5KFOA 5DGBA 2FVPA 2MSTA 2E5LJ 1UWAA 2K8GA 1FKAF 2NXUA 4NZ0A 4N56A 4OJ3A 4MKAA 3RB4A 3BB5A 1RT2A 4F36A 3L3CA 3MAAB 2ZH6A 2FIUA 4N7TA 4O3NA 2W1BA 1Y11A 4QIFA 4DV3J 1JNZB 4D3HA 1HNZF 4CLUA 1VRQC 2J7UA 4USIA 3E3XA 3JS9A 4XIUA 4DFPA 3P6YC 1O6XA 1PAEX 1TKXA 4DR2J 3FBFA 4M5DB 4AL6A 3QGPA 1M5SA 1VQPS 4OI6A 1XMQJ 1I6JA 1T95A 1JK9B 3TAMB 3BQ0A 2R4FA 3PYFA 3OTOF 1M1GA 4J9MA 2D9PA 4LF2A 2A2DA 2EEYA 3MUTP 1MWYA 1QTNB 2HG4A 2QTWA 5B0AA 2H51B 2PEHA 2PFDA 2XSJA 3CJSA 1UMJA 2BKPA 3RG6A 5D6GA 5A8WB 4F4AA 3P3DA 2BM1A 3H5UA 5KFKA 4ED2A 4J9OA 1SH3A 2FLLA 2DNYA 2XYHB 3T9NA 4J9VA 1KLMA 1DRZA 3Q8VA 1FFGB 3LGHA 3QGGA 4M94A 1PYSB 3NCQA 1RDRA 4DSEA 5DDQC 4F25A 1ZM3A 2QSWA 5E2QA 1J5EJ 2EFGA 4I6YA 1VRUA 5E33A 3VQTA 4R5PB 1HBMA 4P7VA 3UN5A 2R8HA 4KJIA 3W65A 3AY0A 3S1TA 4DJBA 3A3PB 1M0SA 2V0NA 3VZIA 2ASDA 1RT3A 3ICLA 1LWFA 3PHTA 1GMUA 1WC5A 1YZ6A 2ZEJA 5KFLA 2KHCA 3CC4S 4KT0C 2MSSA 1RYSA 4CT8A 2I5JA 3T1HJ 4HT5A 2HNZA 4CQ1A 1RU2A 2MQOA 5KFUA 1KC8T 3KDOA 4FYXB 4IG3B 2XTJP 3LH2S 4C8YA 2RUSA 1TKZB 2EWHA 4M5DA 5J2QB 1YBAA 4YDDB 2FLNA 3SCKE 1RWUA 1JJCB 1F5AA 3VVUA 4CT9A 4UOGA 3O3LA 1R0AA 5HBMA 3CJRA 3QGHA 4JI3J 3Q2TC 2W01A 3U1NA 1OPIA 4OZ2A 1WKJA 2FQQB 4FYYB 4CH1A 4KGZB 2EC2A 1R31A 3NXZA 4M5LA 1RHMB 4RJVA 1RWPB 1S10A 2AGQA 3NBPB 3GIJA 2PC6A 4C8NA 4DL5A 1HBOA 2AMCB 2QX0A 1JLGA 2HBRB 1N4LA 4F3MA 1S9EA 5D4LA 2XLKA 1RBOB 3ENAA 3NGTA 5HQLA 4PABA 4UZCA 3DGPB 2I5JB 1RWNB 2C3OA 3JYTB 3M1VB 3DOKA 4M5IA 1H74A 2L08A 1U8SA 3DDNA 1XNQJ 1KNZA 1Q95G 2HNYB 2XS5A 2UXDJ 1FXDA 1FKOB 2HHVA 1Q8BA 1EKRA 2CQHA 3DU6A 3LWLA 3H4DA 3DRPB 1S48A 4DV0F 1YIJS 1VR6A 1NSQA 1RT4A 4CNYA 2W2OP 3M4XA 2Z0GA 4NLQA 1HNIB 3Q0AA 4O3SA 5DM6Q 3I55S 4K2XA 1XN9A 2DCLA 1X4BA 2FLOA 4JB8B 2B43A 3OR2B 1K1QA 1VLYA 4BWJA 3SBMA 5KG3A 2K3IA 3BF4A 4P10A 3SQGB 3SSQA 3W63A 1U24A 5KT2A 2ASJA 2QLXA 3MM5A 4Z2XA 5GAEI 2C2DA 4LF5J 2KL8A 4AL7A 2ZZMA 3A8IA 1FEHA 3AJ2A 4NLPA 4UQTA 5M2RA 3VR1A 2IRUA 1RAOA 3I6PA 4E8UA 3Q23A 3EJMA 1WC3A 3D28A 3FCHA 1FRIA 2W4DA 2RB7A 1S1TA 1TR0A 2RAQA 2JVRA 4WWSA 3M6WA 4UOFA 1U6BA 1BQXA 2R3VA 2ZZTA 3TA1A 1T05B 4QYRA 3IWNC 3LP1A 4JI1F 4ZN1A 3DOKB 3MOJB 1NZ8A 4YOEA 5C24A 4CYUB 1RHRB 4E98A 2F3JA 4LQ9A 4IO9Q 4O0NA 2W8KA 5CAAA 1JLQA 2LEBA 1SKUB 2GHWA 4KRWA 4USVA 2CYYA 4F0MA 4DR6F 1K0TA 2AKWB 4QWCA 4DZDA 1ZBTA 3D6HB 4WIQA 2V9WA 3HD2A 5D77A 3GFYA 3HHDA 3UDEA 4DL0C 2ROPA 4CCHA 4NXNJ 5KFQA 2XMWA 2GQ2A 3RB6A 4ECYA 4ED5A 1DQAA 4MKBA 2R2SA 2DRBA 5B7WA 1SH2A 2M3DA 2GW8A 1TL1A 2ADBA 1KQGB 1LNQA 1N5TA 3IMQJ 3G86A 4MIBA 3V4MA 3ONQA 1WC6A 4RW6A 1OIAA 4TY8B 4U95A 2ATLA 2VG7A 3GWCA 1HBUB 2ZC3A 1PJ5A 3MTJA 5HMXA 3OL8A 1VK8A 4EGLA 3Q8RB 4R8UA 2IDLA 1DQ9A 1SQEA 2R2RA 2HMIA 3GFZA 3SIPB 3JSMB 5IQ6A 1SIWB 3DI6B 5C2CA 4B3SF 3KUGA 5DJBA 1V6HA 4H4OB 4ZCIA 1P8GA 1P9QC 3TP2A 3V6KA 1JLAB 2WONA 2MKKA 2HVDA 2ZNYA 5AXLA 5DDRC 3OTCA 1HYSA 2BKNA 1VDHA 4ALZA 3QFWA 1QAIA 1X4EA 2MQNA 3T41A 3EPGA 1SQFA 3I0SB 1R6YA 2X1BA 3NNCA 2MZJA 4MFBB 4QW9A 3V6JA 2A1BA 2HNDB 2RRBA 4LSNA 3CD7A 2XWXA 4RW8B 3UCGA 5L1IA 2AJQA 2Y1JA 1TV6A 3I5AA 2V4RA 1NO8A 2ZJRQ 1AA1B 4DV6F 3TQ1A 1RT6A 3NRBA 1TAUA 3CDBA 3K89A 1HI1A 1RADB 4L76A 4FN5A 4NASA 2CQPA 2OSQA 4K8RA 4TY8A 2ZKUA 2IYIA 5K9FA 3WX4A 5L9XA 2FC8A 3TA0A 4DPXA 5D4PA 4DCOB 1LQ9A 4CM2A 1WSVA 1PG5B 1UZHA 2G4BA 1N32F 3DM2B 1CG2A 1FTCA 1S5ZA 3VGTA 4HTIA 3ZTPA 1LK7A 1LXJA 2DT9A 4OI3A 4UY8T 2R2TA 4O44A 2R2UA 1UL3A 4X2BA 3T9ZA 4DR3F 2ZZNA 2QZ8A 2POKA 2P9GA 2M5YA 2ADCA 4UY85 4OZ0A 2HHPA 3H98A 4PWDB 1DQ8A 5F8HA 4I6AA 4Q0BA 1FTRA 1WC1A 1X4GA 2HFVA 4P74A 1ULRA 2B4UA 2OJ3A 2J5AA 4CI0B 3NL0A 3JB9k 2GVDB 4I6WA 4ED4A 3QT6A 4I64A 4ATNA 1GEHA 8RUCA 2VODA 4CWBA 3EXYA 1TL7B 2BE2A 3FJ2A 3M2VA 1VIXA 1YTYA 3VQSA 2B0GA 3BGRA 5DQGA 2HVHA 4JV1A 2RHQB 3CB4A 5ETPA 3EGZA 1URRA 3GG1A 3BGUA 4OZLA 2VJVA 2CQ2A 5J2NA 5IS2A 2WK4A 2MJNA 3MM9B 1CC7A 4RBUA 3GB0A 5CYQA 2GIFA 2YX7A 1QY7A 3RBEA 1VQ8S 2X7IA 4LFCF 4NCBA 1TMJA 4ED6A 2HK2A 1RTJA 4XPCA 2A6MA 3TZZA 4IO1A 1ZAWA 2IC3B 1XMBA 3FMWA 1B0PA 3O2IA 4F3OA 2BACA 4QZVB 3UD4P 2CQ0A 5KFGA 2JL9A 2UV8G 1CJVA 4A8MP 2QMWA 3LAMA 1Q8KA 3J7YU 2VB6A 1TL7A 2BE2B 2J9DA 1FRHA 4CLLA 2XNRA 2D41A 2HWTA 3HHLD 5KT7A 4Q43A 3M8RA 1YVFA 2QSFA 3FZ2A 2VG5B 1Q81T 3GCWP 2RIJA 1FFWB 4M1KA 3TX0A 4ANEA 2BDPA 3PV8A 1M5PC 2GQQA 1ELOA 2DR8A 1HKAA 1AW0A 1HHSA 2G1DA 2XZTB 2NXJA 4WU2A 2V5HG 4G1QB 2IVYA 4YY3F 2ZM6F 5IC4B 5A8KB 1B7FA 2UVUA 3CJ8A 4DPOA 4OZ5A 3SSSA 3DLEB 5CCLA 3VWSA 4QW8A 1FF2A 2WSFC 2VF3A 1SVDA 4AQYF 1N36J 2KZMA 1NK6A 3QO9B 4GMKA 3US5A 3ENWA 2J6UA 3HVRA 1SJ4P 4OJGA 2DRDA 2DYAA 3M8YA 1RLCL 2KYZA 3MZIA 2AJ1A 2V69A 5DQIA 3UVJB 2AYGA 3H2VE 3MPWA 2DNOA 1YDLA 1VBYA 1H0HB 4EYIB 5GVQA 1FFSB 1OYDA 2OKQA 1NK7A 3E2EA 2HSEB 2MPUA 3CSKA 1FRKA 4NCGB 3KK1A 3UCZP 3CXCR 1X5SA 1FEEA 3WDOA 2VBWA 3BSOA 1FJCA 1F5BA 2ILZA 1CVJA 5D0HA 4I2QB 4Q7AA 4P71A 5ETKA 2CVEA 2WW4A 2O67A 3CCWA 2CNOB 1LWCB 4PPZA 3M8ZA 2EC0A 3M2RA 2CRLA 1NBEB 5I3UA 3TOQA 3UE2A 4HL9A 4PXBA 3CULA 1A0OB 3KLHA 3NKYA 2FPHX 4XAKA 2FHJD 5C25B 1XMOF 1TK0A 4R5PA 1JXLA 1HD1A 5MLCV 3PTWA 5AE1A 1MSWD 3OFFA 1PBUA 3AD9C 2FJWA 2EK1A 5IV3A 5LSRA 5B0DA 2XMTA 1CBKA 2DHHA 3A4TA 1H38A 4O44B 5D78A 1GXLA 4EZ6A 2HVZA 5IM0B 4QIGA 1K47A 2I38A 1IUJA 1QUPA 2W25A 4WXOA 2DISA 2W9CA 2QEXS 1BQNB 2NZCA 3OJSA 3AQPA 2M0GB 1KQFB 2I2YA 4YB6A 3FMBA 2XGQA 1HHQA 4AD6A 5KT3A 4DV4J 3TYTA 1RWWB 1UTAA 1RJJA 4A48A 1XK8A 2XEXA 4ECQA 1B99A 3KK3A 1RZMA 1O5JA 1WWHA 1N6QA 4JI7F 2F40A 1X7VA 2CUYA 1F9EB 4JOUA 5DO2A 4DBQA 5BXIA 3D4JA 1SL0A 2LQ8A 5HI7A 1T02A 1VFJA 1I1GA 3I0RB 3L95X 5E3CA 4URGA 1J5EF 3QT8A 3OFGA 4Y2KA 3TJ8A 3BQ2A 2FGOA 2VG7B 2UUCF 3OL9A 2GHPA 2DXEA 3AFGA 3HT3A 1S49A 2QA4G 5KT4A 5KFAA 1H7XA 4NCAA 2YKQA 4CTAB 1AFJA 4AXJA 1W7WA 4A46A 3UNYA 1JJ4A 4ERDA 1TL1B 1DURA 3GSIA 3PNIA 5A0YB 2UV8A 1WD6A 4ZPDA 1M5OC 1Y00A 3TJ9A 1U7LA 2W9BB 4DQSA 4I69A 2KVIA 3VAMA 3P96A 1XNQF 4LF7J 2ZHOA 2XHCA 3SZ2A 1FESA 4GO7X 3R1LA 4ZVSB 4ZHRA 1HFEL 4MKYA 1GNKA 2ZD1A 2E5IA 5C7PA 2BJ9A 5RUBA 1RE1B 3DRPA 2W9CB 3HF5A 3BJYA 1T3NA 1IVZA 1WNEA 3CDAA 2K3KA 4OI4A 2DGQA 5F8MA 3IRXA 3NY0A 5D8HB 4C8ZA 2L9DA 3N79A 1FWLA 1VQMS 2YBVA 4ZK7M 2F9JA 3U1LA 2Y1RI 1HNVB 3NEKA 3HCXA 4JV5J 2DXFA 1Q5YA 2PMWA 4KO0B 4NE9C 2AJ2A 5HJXA 4HR2A 3PRDA 3R5BA 3EX7B 2BJ8A 3G6XA 4Z37A 3PW5A 5T41A 5ETSA 1HNWF 1F9HA 3GMGA 4ILLA 1EP4B 2J8AA 1HPZB 3A3OB 4NA1A 3QZ8A 1T3OA 2EFOA 4G6VB 2PT0A 2LCWA 2VICA 1RWMB 2C2MB 2BV3A 4PXEA 2YNIB 4IQXA 2KI2A 5AT1B 1F3VA 2QIFA 3GCXP 1TTHB 1LFWA 5K20B 5F9NA 3OV7A 3POTA 1SCJB 2CXEA 3QIPA 1S4EA 4UUWA 1C1BA 1U0SA 4YHHF 3HHKA 1CEZA 2EKYA 3B78A 4I7FA 1JB0C 4QIVA 1OWXA 2VFTA 2WRMA 3LAKA 2RUGA 2FC9A 2KB2A 3NS7B 3SFUA 3TZWA 2QFJA 5LMUJ 1FJEB 4B3RJ 3G9CA 1K8AT 1N88A 4NI2B 4MTPA 2JJ4D 4QBUA 5KFWA 2N82B 4NLGA 1ZA2B 1YJVA 2XBPA 4KO0A 5K8NA 4CRJA 4AL5A 4G3IA 2XYGB 5GADU 3FRYA 1TL5A 2BQUA 1YSJA 2ZUGA 3QLHA 1REVB 2GS8A 2IYGA 4IH7A 5EWEA 1KLNA 5T7LB 1D9AA 2NYHA 4FYWB 1RK8A 4RX6A 3FVYA 2B9XA 1C2PA 1HPZA 1WHYA 1S6QB 2C2NA 1HBOB 3F44A 3G2XA 3UN3A 5GAEU 3V6DB 3ZZZA 4X4NA 1HD0A 1T03A 3I31A 2HRTA 2XCAA 2HAFA 2F8MA 3V81B 1VCTA 4OYXA 1ZPVA 4C8MA 8AT1B 3ZTOA 5HP1A 3MM9A 3CMES 3WIVA 4DU8A 4FYDA 2AZ3A 2B6AB 4ES2A 3G8TA 4WFXA 1K9MT 4WIIA 2B9WA 2PGCA 3D66A 3SMZA 3RBXA 2FZCB 4ZVFA 4DR5F 3KUHA 3HI9A 2PFFB 1WJ9A 2OPPA 3NGUA 4IFYB 4M5GA 3DOLB 1HNWJ 4PZVA 3DLJA 1Q8IA 2OI2A 1FDNA 1PYOB 2X3DA 3C6UB 4OX9F 3ET6B 3SCLE 1XMOJ 4DR7J 1CJVB 2KFNA 4EO8A 2BABA 3BYPA 3AHPA 1NPPA 5HQ8A 2DR5A 4TN2A 1C0TA 3C46A 3PJXA 4M5NA 2E1AA 3P5TL 2CJXB 4RW9B 1RT6B 1F0XA 1O51A 2LQ9A 3HHLB 2QC3A 1KLMB 2F8EX 1RHJB 1T9UA 1NHVA 2ALYB 2FHKA 3MCOA 2RSQA 2DO4A 3X3UA 1LWFB 1EHWA 3M7VA 2OEJA 4UF4A 2BBEA 2LU2A 1U1OA 1PYTA 3QT7A 2UP1A 3BEGB 2H48B 4NLUA 3B82A 2V2KA 2ZKTA 2BA9A 3QO9A 4B3MF 2KXHA 3MDFA 4QIEA 4GKJF 2DGWA 2ZVIA 1HNZJ 1NLKL 4E0DA 1U6FA 3KXDA 4K4UA 3LP2A 4U6PA 1QVGR 1G6BA 3DLEA 4IOAQ 3OPKA 4YN3B 2DGTA 3N5FA 1RHUB 3IBWA 3ITHA 3MEGB 1UW9A 2JLFA 4TKTA 2VBZA 1S1UB 2ZNZA 5HL7Q 3VALA 1GAOA 1ZETA 2UUCJ 4IFYA 5E5NA 3FCVA 2COLA 2HPUA 3DU5A 4A4JA 2ZBPA 2VQEF 1R0BG 1C1CA 4JI3F 4OYBA 2ZE2A 2E9ZA 2GCFA 1YRUA 1WEZA 1XR7A 3GJTB 4IFVA 3HULA 4ZVHA 4BLGA 3EDQB 3ELHA 3R3TA 2F1FA 5KFJA 3ZO7A 2HZAA 5E7OB 5F0UA 2C2EA 1B64A 1QVFR 1JJHA 1VRTA 5CZVA 1VK3A 3FKBA 3QFHA 4RW6B 3MGJA 5ETMA 1ZAXA 3KMSA 4CLKA 1AYEA 2ZITA 3ITHB 2HBQB 4X62F 3ZTSA 1NK8A 1KHVA 1KQSR 3M9MB 4RNHA 2OHDA 3SEOA 4ZCLA 1I51B 1DHMA 3IG1B 2MHNA 2W9AA 2LMIA 3KG4A 1UVNA 2DGXA 2CQIA 4ICLB 2Z4PA 2MZTA 1KVJA 3GR0A 2M8DB 1FNXH 2IHR1 1AXQA 1W2IA 2GJ2A 1BC6A 4ELTA 3H0PA 1RBLA 1YQHA 1S1UA 2QL7B 1NDPA 3DHWC 4C97A 4H54A 1ACMB 1O0PA 4I0WA 5J2PA 2EFVA 1RAFB 1TVRB 1S97A 3VCDA 4YP3A 3UW1A 4LRBA 1SIZA 3SQGA 2HFUA 1RA6A 3TQEA 4PQUA 3K57A 4NLRA 5LMNF 2G0IA 2X1FA 3RW6A 4ZVUB 4E2FB 1S1TB 2A10A 1QUVA 1UFWA 5ADZA 3QATA 2AEMA 3KLIB 2PA3A 2DPIA 3PYEA 5KFPA 4TLRA 2HGNA 2V8HA 5HVHA 2VHGA 4LT6A 3JAMY 2AEFA 4YFUA 3V6DA 4GRSA 1H3DA 2ZHAA 1WG4A 4W4MA 5KFBA 2DD8S 4K4VA 5J2MA 1IQZA 1U6ZA 1VYAA 5I42A 1T9VA 2PSZA 1KTQA 1TUGB 2VONA 1NDCA 2UVVA 1FXRA 4DEZA 1QD1A 2CQDA 4USHA 4WYWA 3G82A 4RZRA 4F4WA 4U7UD 1BE4A 2CPEA 3AXMA 3HM9A 2E5LF 2ZD1B 3GR1A 2FVSA 2B8PA 1JLEA 1SBRA 4EU0A 5B09A 2C3UA 2YKNA 4OJ1A 2DVIA 2WBRA 1JLCB 3MD3A 2DHSA 1KS2A 2YQ3A 2GVZA 3QNWB 2CNNB 4A8KA 4LFBF 2AQ4A 1IBCB 3MTKA 1DY3A 1T9YA 4ZP7A 1HQUA 3O6QA 4USKA 2KT2A 2OSRA 4DR5J 1RTHA 1Y5LB 3DMJB 4X4UA 3NP5A 2YNHB 1NJZA 4RL1A 3R6GB 2IVFB 2BKOA 3M2VB 4ZPBA 4R8UB 1K73T 1WHVA 2JEGA 3I96A 1Z4UA 4DSKA 2CWXA 3D54A 3CTRA 2HK3A 4PUOB 4HDGA 4MYTA 4WBFA 4GVBA 2OTLS 1BWEA 4DR7F 1RT5B 4BDPA 4B3SJ 3ZC4A 5HROB 3R7BB 4WYLA 1R8HA 2RKIB 3D9BA 5KT5A 4TLQA 4C3LA 3CDEA 1JQGA 4OHZA 1RXOB 3KG1A 2KKHA 3HKWA 3RAMA 1RTIA 4LFCJ 1HWUA 4OYWA 1RAHB 2QA1A 1U48A 3M9OB 5M2PA 2W2PP 3KLEA 2A3JA 2H5JB 3SQOP 4WFBQ 2KG1A 2BR0A 3I9ZA 3EM1A 2D7SA 5IT4A 1IWGA 5E3QA 2OGUA 1EETA 3MR3A 2J76E 3RRKA 5E41A 1S0NA 4CLYA 4FF3A 3PR4A 1PAUB 4NMLA 4DV5F 1TV6B 1B7YB 3MI7X 5A0YA 4U67Q 4JI6F 3H25A 4DS5A 1Q0NA 2LDYA 2DIUA 1VRUB 1MWZA 1NU4A 2HZCA 2QRRA 5CD4H 3J7ZT 3T5KA 4PWDA 5D15A 4IOBA 1MN9A 2FTRA 2Q3PA 4C3KA 4CP5A 2GO9A 3H4BA 1P6TA 2ZH5A 1U02A 1U45A 4N8NA 4ZVTB 2HFNA 2XZWA 2LXUA 4QQBA 3G71S 1QE1B 1R6VA 3DHXA 4DR3J 1RT3B 5LOQA 2RDDA 1JXVA 1YX2A 4ZJOA 3ULHA 2O5DA 2RRAA 3BKFA 2DK2A 2GVDA 4ZHRB 4EFAC 4IG3A 4V1Ak 4NLXA 3W2VB 1FCAA 1RTIB 4LVNP 5HLFA 1L3VA 1FK9A 2HWHA 1RU1A 3W9IA 5JUMA 4YB1P 1RCXB 2XMAA 4DLEA 1JX4A 4JI0F 2IM1A 3PHEA 5HAOA 5I3QA 3N6NA 3DYAB 2UZAA 4RU2A 3GIIA 3IA0A 4LRAA 3VAJA 4ED7A 2OMLA 4M5JA 2YWKA 4HKQA 3AAWB 3JSYA 2FD2A 1U49A 3TX8A 4Q2MA 2YKMB 1S9EB 4ETXA 3JTPA 3B4MA 3GYNA 5D0GA 1TFYA 1VBKA 1UA1A 2R8JA 1YLXA 4UTGA 3VVTA 1T9TA 3RYLA 4WP3A 3QGIA 3M6UA 4XTTA 5GAHU 1CJTB 3FEZA 2GAGC 4NPOA 2W24A 3ZTQA 3C15A 1BMQB 2DKOB 3I82A 1AZSB 4HI1A 2CDRB 1NEEA 4OX7A 2FGCA 1IKWB 5GAHI 3J81U 2R7SA 4J9QA 3BV8A 5CYMA 2AJ0A 2RDIA 3VF0B 2IAJB 2MQLA 5FD1A 2KG0A 4TVAB 2PE8A 3MEEA 2C3MA 3QWPA 4OLPA 4ANDA 4MAKA 1U1KA 3KHLA 3MOZA 2EVZA 1CS4B 5AJ3J 3CCJS 2MB0B 1P27B 4L3NA 3MEGA 4LVOP 1N5YA 1FRLA 4ILMA 2G2YA 2HHSA 1APSA 4XPEA 2Q6CA 4DPWA 5L38A 1UWBB 4QWAA 2ZOMA 3MUMP 5JVGQ 4FZVA 4P7TA 2RF2A 2HHHJ 4B9VA 3NLCA 1J2VA 4L74A 2V2ZA 2AWZA 5I3PA 4NMXA 3OR2A 1VQYA 3TUZC 2U2FA 3K7RA 3CJ3A 4ETZA 3OL7A 2XY6A 1Q7LB 3H2UB 1OY8A 3NMRA 1TZ0A 1S9GA 1H2VZ 2DNMA 2U1AA 3EVMA 3I4HX 3N5BA 5AXMA 4QYZK 2R7WA 1S72S 3M05A 4O4GB 3FSYA 3HK2A 1TMMA 4P9SA 2WVEA 1Q53A 3ETOA 2GO8A 3H42A 2XHWA 1U1RA 4KPCA 3MHYA 5CCMA 4JI1J 5L39A 2OP5A 3DRSA 3FSXA 3WX8A 5HN0A 1J27A 4ENOA 1S1WB 1FE0A 1HWKA 3BKUA 5IFMA 1N5YB 3DRYA 5GAGU 4LBIA 2H5IB 4HHHA 1CS4A 2FJXA 3MM7A 1O8BA 4RWWA 4U7UK 4DX7A 2O01C 5H9FK 1BXNA 3DLBA 2PI5A 3MEEB 2RVJA 3MMAB 2OPQB 3H90A 2FY1A 2IM3A 2R42A 5C24B 2VKRA 4DG1A 1UVJA 3J7AN 3M8QA 4S0MA 1VQNS 4LIRA 5F3TA 4DV6J 2B9EA 3MFIA 1JKHB 2QFIA 3J80Y 2B3TB 3K5OA 2HW3A 3M32B 3GONA 5A8RB 3V4IB 4USWA 1TQLA 1RAIB 4F04B 3HHLC 1WI6A 3T5HA 5D3GA 1ZM4A 4HLBA 5A6WA 2YY3A 4ED0A 2MKJA 1D1UA 4Q8EA 4FS2A 5C2GA 3D68A 2WSEC 4ED3A 2YQ1A 2CPFA 1N56A 2APOA 4RNNA 2OEKA 1FI4A 4MKVA 1HQEB 1VHFA 4ZLJA 2BQRA 4NXMF 4LSLB 1Q8LA 4A8WA 4Y2AA 4DWIA 3HJFA 4KHPF 3Q8PB 5HJYA 1HNIA 3N4WA 1FJ7A 2XYPB 2KHDA 2PA8D 3I0SA 4I2PA 5L8RC 5CABA 2EI5A 3G8QA 5F8GA 3PIPQ 3UPFA 4DR1J 1UVMA 3OXGA 1HYSB 3EPIA 3W2VA 4TY9A 2BJ1A 1LWEA 4B3OB 1KFDA 3FEYB 3QIPB 2Z2ZA 5SUHA 4ECZA 3P8BB 3JTOA 1HWIA 1VOMA 4RUHA 1NJWA 3MMCA 4F4ZA 3M8WA 4OYMA 1ROFA 2CZ9A 1VMBA 1A7GE 3HFVA 4RUBA 2BXJA 3EYZA 1YWXA 1JWWA 2GQCA 2MEWA 2AJ4A 1S6QA 1XTZA 3A8JA 3CC2S 2ZDPA 3CDWA 3M32A 2SXLA 3O5TB 2ZH9A 2Y8WA 1N33F 3SFGA 4A8XA 1DLOA 2G13A 5KFMA 3V5RA 1V3ZA 4F50A 3CCTA 3C3LA 2OPSA 2XSFA 3HDSA 1WDTA 5J1EA 1E6VB 3T3FA 4DFMA 4ED8A 1E6YA 2DXDA 1WORA 2G1HA 1EKSA 2CPXA 4ZJLA 3IN5A 3IRXB 2R7TA 2HIQA 1UFKA 1TUWA 3AB4B 3B6BA 3QWUA 3PJ9A 6FDRA 3VZHA 3CMAS 4OHVA 2AYEA 4Q0BB 2ZFHA 1TKZA 2VPXB 3BGLA 4B3OA 4IDKB 4FP9A 2VPYB 4OYOA 3GILA 4TU7A 2FJBB 3C6TA 4DDFA 1FD2A 3R8YA 1KRPA 2B8QA 4C8LA 4W90B 3R5JB 2OPPB 2NSCA 1UKUA 3SDEB 2RQCA 4IOCQ 1PGZA 4KKOB 2YVSA 1D8ZA 4PYDA 5B08A 1DZ5A 4Y3CA 4OI1A 1EP4A 2QGFB 4ECRA 1ZZNA 1SC6A 4W98A 1VLOA 2LXFA 4DS4A 4ZVRB 3MR2A 1TFWA 4K4SA 1KWMA 2I8EA 4AXIA 5BYSA 1L3UA 1TUVA 1TK5A 5KG0A 1LW2A 3IM8A 2RE1A 2HBYB 3LTOA 2QE5A 1HI0P 2H9ZA 1RTDA 3ILIA 3NGKA 3MAHA 3FFIB 5KFZA 3M6XA 3THTA 4DQRA 4C4WA 2JWNA 5ETLA 1CC8A 3DCAA 1RISA 3IGNA 4YHHJ 5A2QY 1D3WA 5K5MA 1N52B 2J8SA 2RDJA 3K5MA 3VAIA 1Z2LA 1MG7A 2MZRA 3GP9A 1RYRA 3S7RA 4RNMA 4QWEA 3RW7A 5DDOC 1N32J 1IKYA 4C9DA 3G96A 4M5KA 1JMTA 1GTEA 2CFXA 1LOUA 3ETMA 3W61A 1OQ6A 3PFOA 2AHOB 2BVZA 4PG8A 5DETA 1UEUA 2ZWPA 5KG2A 2VPWB 2XMKA 1SC1B 3M2UA 3KHGA 1EAYC 1U4BA 2NUHA 2YKMA 2GGPA 3U1MA 4PYAA 2DY9A 1JLBA 1UVLA 4KGKA 2DNPA 1VQOS 2VG6B 1ZA1B 3OD2A 4EZ9A 1RT7A 3QSIA 1UJ6A 5F9LA 2VUGA 1T11A 1NK5A 4JI4J 4QWBA 1RWXB 3OW2R 1FNOA 2C2RA 3LP1B 4URSA 2DH8A 1A6LA 2VQFF 4EBCA 2FY8A 3CT9A 1SUQB 1Y9OA 2IBOA 4H4MB 4L3KA 4GC6A 4EBDA 1C0TB 1WF2A 2B56A 3W8PA 2PDAA 5JXSA 1FE4A 4TXSA 2IPOB 3ADAC 2OEMA 3H20A 3C6UA 3N28A 1V9OA 3BPSP 4NXNF 4R25A 1RHKB 4I1TA 4YUDA 1Q5VA 3GYGA 3FUYA 3HLUA 5ETOA 4WTOB 3SCIE 2AGPA 2LKZA 2XGPA 4DUTA 1X4AA 4J7CA 3HD1A 1UWBA 2NUUG 2L48A 2HZVA 1H2TZ 3R1HA 4YB5A 4WK3A 4OYZA 5IZHA 4I67A 3J81j 2H65B 2MTLA 5K14B 3TVKA 1X0PA 4CDIA 3W3SA 2ASLA 3D7SB 3MPUB 4KE5A 2RH3A 5KFDA 3IM9A 4N5SA 5EWFA 5FLXU 1UETA 1S1WA 1GQEA 2XMJA 3PVXA 2HQIA 4WFNQ 3JYTA 3KJVA 4U96A 3PYDA 3BSCA 1TL3A 3D0HE 1FDAA 1NZAA 5J1PA 2GNKA 4LF9F 1RT4B 3EZUA 5F41A 1WDDA 1PC5A 3CNQP 4O4GA 4Y34A 3IWLA 4C0HA 3MMBA 2AEJA 3IBCB 1URNA 2JC1A 2MGZA 1RWVB 1V5IB 3RR8A 3KK3B 5IQQA 1F9FA 3NCRA 1HBNB 4P2SA 4OZ1A 5HLFB 3MXHP 4LBPA 5BR8F 3DN9A 1IJEB 3FQLA 2B9YA 1VRTB 2L41A 2CJAA 1I5OB 1NH8A 2KH9A 2KZZA 2QLBB 2N3OA 4DQPA 3MPYA 4F26A 4G65A 1Y10A 1G7CB 1S1XA 2BM0A 2PN6A 1RB0A 1B4SA 3HZEA 4WFZA 2VBYA 2VH7A 4ID8A 5G0RA 5B0FA 1T05A 4WF9Q 1NSKL 1N6QB 3TA2A 1LW0A 4UUXA 1ZPWX 2AIRB 2LEAA 5G4DA 3BR9A 2IAJA 3DDIA 2FJDB 4K5RA 2A2CA 2ASYA 3PACA 3LP0A 5AXNA 1OS5A 3HVAA 4LSZB 2GMLA 4ZLNA 1KEKA 1SJ3P 3C15B 3DNCA 3FNNA 4F0KA 2VDIA 2P6TA 3WIUA 5K8MA 4X4RA 2ROEA 4AUKA 2XNQA 2EPIA 5BYQA 3OUYA 2ZH7A 1YJWS 4U8YA 2X1AA 3CJKB 1OMSA 4CLZA 2VDHA 2AYMA 1NKCA 1FDDA 1NKEA 2V50A 3D2WA 2DH7A 9ATCB 2ZH3A 4B3MJ 3WHIA 4DR4F 2I6WA 1VBXA 2UUAF 4PG4A 4J91A 3TAPA 1NH7A 2ACMA 3OHBA 3LPYA 5DG7A 1X9WA 1HMVA 1NUEA 2E5HA 5LL6d 4X4QA 1V3SA 1KDNA 4OQJA 1PJ6A 4UT4A 1DLOB 2D3O1 2BW7A 3MEDA 1L3SA 4KHRA 5GMKa 1S9FA 2R7VA 4LBHA 2HAIA 2WBMA 1SKSA 4JYAF 5D0RA 3ILOA 4L73A 2C1EB 4X4OA 1BD6A 1AROP 4RKUC 3UFCX 3KLHB 1NK4A 1CJUA 2CJBA 2CDQA 4R0JA 1WEYA 5F0WA 2IA6A 2R7UA 3PDNA 3EUNA 2GZOA 1IBKJ 3ZZYA 1GH8A 4WKRA 3QT5A 3CJKA 1FX2A 1QE1A 2XULA 2VU5A 3IS9B 4HT7A 1KQKA 3MAAA 3ZNJ1 5BJRA 3TAQA 4WE1B 2FHJA 5KFNA 1XIQA 3DRRA 4ZVEA 2YNFA 4QU7A 1D9DA 1JLCA 1PO6A 4F4KA 4NLYA 3D1OA 4QR0A 3TUIC 1X9MA 4OV6A 2HS3A 2YNGA 2Q43A 4I7FB 3RBZA 5L46A 3DLGB 1HMVB 1RTHB 4C11A 3OT9A 1L3KA 1HQUB 3ZZOA 4G1QA 4ECVA 3SV4A 1XMQF 5FIIA 4ZIWA 2JX2A 2FUG9 2KM8C 3GV8B 2EFNA 1Y5IB 4C3MA 1TU0B 1P9YA 2Q1LA 3MM8B 1MROA 2KRRA 1R3NA 1TAQA 5HSPA 5K14A 4NX9A 4TU9A 1LK5A 2AX1A 4JP8A 3VGVA 4DV4F 4V19X 2V4JB 1G3OA 4FVCA 4MK7A 4I2PB 4ZPAA 3K5LA 3CCVS 4QCLA 1REVA 5DDPC 5J1NA 3R5AA 4C7QA 2CPJA 1FDBA 3DRRB 1YJNS 2ATCB 2FDNA 1GX6A 5KFIA 3OFEA 2MYFA 1U1NA 1S6PA 2FHOB 3EWGA 2H1YA 3MEKA 3L7UA 2DNRA 3LOUA 1T03B 1FT8A 3AOCA 3L09A 5EN1A 4B17A 1Z2ZA 4XDCA 1NM2A 4OHWA 3MURP 2ILYA 2M70A 3U7JA 3AJ1A 4NZ7A 3OTDA 3GQCA 2W2QP 1OY9A 4USJC 3PEHA 4WCEQ 4W92B 2W7PA 1MMLA 1S1VB 3CD0A 3MECB 2OD4A 3EGWB 4RUAA 1GT8A 3LW5C 1QJHA 4RW7A 3UO0A 1CJKA 2MY7A 3R7NB 4LR7A 5ETRA 2VOPA 3EVOA 1HWLA 2C2ZB 3CJ0A 1NAQA 1V5VA 2R9LA 2JC0A 4LQ3A 2J0XA 3OR1A 4K0KJ 3UD3P 1OQ3A 3RB3A 1EX8A 2CQCA 2Z2YB 3A8EA 3M8SA 2E9TA 1GX5A 4R0EA 4Y6IA 3QZ7A 2JEJA 3NNHA 3PJWA 3D3BJ 2KVQE 4NYZA 3CEDA 5ETNA 3OUYB 1CPZA 2VFRA 4ED1A 1H7WA 2G9OA 4QJVA 4WK1A 4EYHB 2R8GA 1L3TA 7FD1A 3MM7B 2AZ1A 2VG5A 4PPDA 3M9NB 2XI2A 1B3TA 3MM6B 4AFFA 2CQGA 1QAYA 3IWXA 4GVLA 4OHXA 3BSAA 4DX8H 5JJBA 3GV5B 1UPPA 3F73A 1QLNA 3I32A 2LLZA 1Q86T 3PW0A 3NAHA 2KRBA 4DMZA 2OIHA 1NDKA 2BANB 2WB4A 2W7AA 2X1GA 1W25A 4YY3J 4Q45A 3PIOQ 1RKJA 3MUVP 4NXMJ 2HVEA 1NHUA 2DGVA 4EUVA 2VASA 2D3OR 3A3NB 4O4RA 2UVRA 2PO4A 4CZCA 1YJ9S 2V6AA 2UUBF 1CQMA 2YH0A 3KLFB 3R5DA 5E0OA 5L1LA 1IR2A 1AZSA 1Q78A 3K5NA 3N6MA 3JXOA 2Z56B 1RI7A 3I9V9 3MMBB 3N9UC 2FVRA 4H4KC 4NEYA 3IFEA 1JNRB 2GHVC 3DOMB 2F4VF 3WZ0A 5GMEA 2VA2A 2BJEA 2Y1LB 2J9CA 4G1IA 4OZJA 5DZ6A 1WOPA 1U0HB 2BYCA 1RAJA 1RAAB 4ELVA 2CNLB 1NDLA 4J9PA 3M2UB 4KH1B 5M2UA 2DNQA 1SV5B 2KXNB 4NRTA 3CE8A 4KGXB 5U47A 4CLTA 3EZ5A 2D9OA 1R43A 3D0GE 1VQ6S 4LRDA 4KC5A 1OO0B 2HS0A 3D1HA 3FZBA 5E3AA 4F0HA 1C4CA 1HWJA 4BHQA 3NOCA 2KT3A 2Z58B 3TUPA 4KR0B 1RAGB 2IJFA 2Y3YA 3NBPA 3NCPA 2DJWA 5KFVA 4DR4J 1IKVB 1XR6A 3P5BP 4AE5A 2BMBA 4MK8A 5C25A 2E1MC 4K50A 3A1YG 2F4FA 3I5BA 4J9UE 5ETQA 1Y0HA 2NXNA 1DBDA 3JQJA 2RT3A 3BS9A 5KOXA 5JMNA 2BUNA 4KHMA 5EUHA 3DRSB 3F56A 3NWGA 2M52A 4WP8A 1Q4RA 1SUQA 4H4MA 4XK8C 3T6BA 5B0BA 4FF4A 2QJ3A 4NLOA 1M1HA 4J9NA 3H59A 2KFYA 4KBIA 1U1QA 2EFQA 4AQYJ 3LPEA 3DLKB 1KOOA 3D6TB 1SJFA 4DV7F 3LANA 2E5JA 2BX6A 1U1LA 2L9WA 4WP9A 2V8DA 1N36F 2PD1A 2B5JB 1IXKA 3IR7B 3R5GA 1DFDA 1HNXJ 1MMDA 3GFHA 1VQSA 5EX0A 4LFAJ 1XEZA 2YNHA 2BQ3A 2GMHA 1C0UA 1YKWA 5LMNJ 2MQ8A 3MECA 2HLUA 2DBBA 2CIMA 1U2RA 2LEPA 2EFPA 3W8GA 3UD5A 5K8PA 4RPFA 3C6TB 4DUYF 1WEXA 4YS2A 3OHAA 1Q82T 4DSJA 4ZVOB 4NI2A 3L7PA 2MHEA 3KHRA 2D3UA 2V94A 5CQGA 3S01A 4OX9J 3NMAA 1XNRJ 2O3DA 3NS5A 4CO3A 6AT1B 4PG7A 2MKSA 4ZLPA 3J7YI 2VFUA 2D74B 2IA0A 4P6QA 3QQCD 5T7LA 3UVJA 2UU9F 2NYIA 3EGVA 2JOQA 3D6MB 4JV0A 4FKXA 3PXGa 2NXCA 3BQ1A 4A8FA 3GJSB 3Q83A 4ES1A 4QYZJ 4FDFA 1N5SA 1HARA 4J90A 4BCAA 3IXQA 4D3GA 4DSLA 1WI8A 1WTFA 3TNVA 4PCQA 2MGZB 3GFXA 1X60A 1MU2B 2BE7D 5L1JA 2HS4A 1HIYA 4DLGA 1I3OB 2XLIA 2E7XA 3G87A 3OXFA 3T1YJ 2QLFB 3VAGA 4Y28C 2B4PA 1WF0A 2F8HA 2MZQA 4OHYA 3KWMA 3P45B 1WTBA 5CYJA 3LUYA 2CPZA 4LMZA 3QIDA 5F8JA 2W7OA 4MT1A 5J2NB 3RB0A 1TK8A 3NGRA 4JI5J 3AA9A 1M90T 1T9XA 1UFLA 4QR2A 2YNIA 4DX6A 3KK2B 4FF2A 3OVAA 4DR2F 3BREA 7FDRA 4M8LA 2E1PA 2HLTA 4KPYA 3HO1A 3P4UB 1KTVA 4DR6J 1PBAA 1XWLA 3DXSX 2XMUA 3MMJA 4QR1A 2AGOA 1C1BB 3G82B 3W5YA 1S7IA 1S12A 4Y2IA 3TANA 5EWGA 5DM7Q 4WPAA 1S6PB 1D9FA 2OMOA 3DLHA 3T19A 3BH7B 2YWGA 4QWDA 3KJNB 1ICEB 4DFKA 1CQNA 4MFBA 2ZBIA 3C8YA 2R8KA 1R27B 5A8WA 1RGVA 4X64J 2G0JA 2AJFE 2O1PA 4MYUA 3PG9A 3FBEA 4M95A 2MMYA 4KIAA 4LREA 2ALZA 3QJPA 1U1PA 4WFAQ 1UEKA 1X4DA 2NSBA 4I68A 4ES3A 5KG7A 3PY8A 1RT1A 1VIOA 4OV1A 2YPZA 4CO1A 1S79A 1Y3KA 3G6VA 1D0EA 3KJQB 1Y3JA 2Z57B 2QMUB 1MLAA 2NXEA 2V2VA 2WAQD 6FD1A 2E5GA 4LF4J 2C28A 3RUBL 5KFFA 3CCSS 2UUAJ 1SJ1A 1DARA 2LP4A 1AUSL 1IKWA 2GIRA 2YNFB 1RBAA 3FFIA 2CQBA 2P6SA 4K2JA 1S7HA 5A2QU 4KY3A 2JFDA 4WE1A 1CJTA 1JXEA 2DGOA 2DITA 4GO5X 1OJ4A 2CPHA 2HRYA 4KSEB 4DL6A 1IKXB 3ENQA 5L1KA 4A8YA 2WVFA 1VQKS 1RHQB 3FRZA 2N4DA 1NSPA 2LDIA 3ZZRA 2YH1A 4NYPA 2E9RX 2DGUA 2GA7A 2K06A 2QYGA 4IUFA 2RF2B 2K7KA 2C2OB 2BANA 3IAM9 1FERA 2VBXA 3H2LA 3BYRA 1IM4A 4RUCA 3ENVA 2E1RA 4DV1F 1IR1A 2HVIA 2CJ9A 1LWCA 2EG1A 3HHLA 1G1XA 2VC1A 4KGVB 3OXLA 4USTA 4PUOA 5CYQB 2KT5A 1TKDA 1X31C 4FBUA 3K2YA 2WHOA 4P72A 2BRKA 1K0VA 2AW0A 3M2RB 3F0NA 3FK4A 2V67A 1SQGA 4QPXA 4NLTA 1X4HA 1XNRF 2HQDA 3V6HA 1GXTA 5IM0A 4C0BA 1CULB 3UCUP 4CO4A 4GKKJ 2ZH2A 2Z8QA 3Q24A 4WTYA 4ZJQA 4LF9J 2P9CA 2YWHA 3S6EA 3J81Y 2HWIA 2XO6A 1N8RT 4BS2A 2QO3A 4I56A 4QPTA 5IC6B 2CJKA 4F4YA 3TI0A 1ITPA 3IR5B 2OFGX 4RLEA 4LFBJ 1SB6A 2EKNA 2WTFA 1K1SA 2C22A 1S6OA 3BSNA 1KHWA 3W2WA 2NS1B 3MCSA 5IXUA 4K7QA 2L3MA 1S1VA 3HVTB 5EHHA 1OSCA 3M8QB 4PWUA 2RILA 3HMJG 2R8IA 4DL7A 4JV2A 4JV5F 2KO1A 2OPQA 3BBCA 4DN0A 4KTQA 2JVOA 4M5HA 5BYRA 1WC0A 3OFHA 3K59A 4HH0A 1KD1T 2OH2A 2B7BB 3GPAA 2DIVA 3PKYA 2IMOA 4HI2A 4DFJA 4WU3A 4EI2A 4MIWA 3CMQA 3OR1B 1BWVA 2J7KA 2LA6A 1AFIA 1HNXF 4PXDA 1N34J 2JLEA 1YITS 1UCNA 2EBEA 1HHTP 3C16B 3M8PA 2ZH1A 2M2BA 1XR5A 3G6YA 4FXVA 3KHHA 2B4OA 2AD9A 3MR7A 1N5VA 1VJWA 5AE3A 4CNZA 4N41A 4J9KA 3KJVB 3CO9A 2OFHX 3TZYA 4X65F 1Q7YT 2QV6A 1HL6A 1NRKA 4CO5A 3CGIA 2HQFA 2J9EA 3M6VA 4OI2A 4ECXA 2F63A 5J2QA 1ZH5A 2IFXA 2PIIA 1TELA 3IC1A 5G0RB 1KVKA 5HATA 3H5XA 8ATCB 4KV8A 4LSLA 3GYXB 5K8OA 1HR0F 2AP6A 2HGLA 1X5PA 3JSBA 3K8VA 4C11B 3PR5B 3MFHA 3FSIA 3BZQA 1C0UB 3HT0A 4P2FA 5THWA 4DHVA 2ZM6J 4O0IA 2ZH4A 3VGUA 1YHQS 5D4OA 1H98A 2P5VA 2YNGB 4OYAA 4USMA 3GIKA 4J9LA 2B5JA 1IR0A 3KLEB 3EVWA 1EQ0A 1LWEB 3PO5A 4C8KA 1WG5A 3RRGA 3QRPA 1RQ0A 3CCRS 2BW2A 3ISNC 2N7CA 4IH6A 3GZ7A 2IY5B 4JBCA 4TNOA 2ACYA 3PRBA 1DTTB 2UUBJ 3DGPA 2YKAA 3CCES 1N54B 1VC0A 4DPTA 4DSFA 1GTHA 5J1EB 1Y5NB 4HHUA 1X8DA 3IP0A 1FKPB 5DRKA 4NLWA 3AT1B 1M5HA 3DDKA 1B0TA 2JSXA 1S59A 1Y4ZB 2FZKB 1OY6A 2J6TA 4CM0A 1IBMJ 4LF8J 1J5OB 3DXBA 4LF1A 4MJKA 1LXNA 2Q6BA 3DMJA 4TYAA 2ZHBA 3SYZA 3K5PA 4PQUB 2XWYA 1IKVA 2GV1A 3KDNA 2WW8A 1I94F 3QPIA 4N77A 3HXMA 3JAMU 4CH0S 3SDEA 2ZWOA 3I0RA 2NLWA 2FVQA 4ZP9A 2GJIA 4IG0B 1WHXA 4DX5A 1FK9B 4NWBA 1F5CA 4CTAA 3RBDA 2HNDA 2I1RA 1VHIA 2F65A 3BN7A 4LSNB 3KKFA 3AA8A 3LWMA 1DTTA 1RACB 1HBMB 2ZOFA 3MPVA 3MPDA 4RW4A 3OSPA 4IQMA 4DCPB 1G2EA 1F2GA 4UW2A 2WOMB 3E01A 2QA2A 2OUGA 2L9NA 1PSDA 3GE9A 3DRXA 4CH7A
chains in the Genus database with same CATH topology
4K59A 1JLFA 2M7SA 3IG1A 3PW4A 3ZZ0A 4OFZA 1X0FA 4HTJA 1QAXA 4HVZA 3JAMY 2MDAA 2B6AA 2FB0A 2RKIA 2DB1A 2V8GA 4XO0A 4DV3F 2MZSA 1RT5A 4LF4F 1F60B 2IM0A 1YJRA 4DSIA 1OSDA 1UP1A 4JUZA 1U26A 2D1CA 3FEXB 3PW2A 3SXLA 3AQOA 1IBKF 4F3QA 1MNEA 1NJXA 3KNAA 1FRXA 1ZYQA 4B9TA 1RP5A 4DL2A 4IG0A 5KFRA 1S6UA 4XDDA 2YTCA 3DLGA 2DNGA 2XO7A 3THVA 3BR8A 2AU0A 2XS7A 2A18A 2WOMA 3WC0A 4BWMA 1TKXB 1N0VC 2FJEB 2LYVA 4UY8T 2RNEA 3BO2A 2AF6A 3H5SA 4URQU 4O23A 1SI9A 1ZOTA 1TL4A 1ZTWA 4Y2CA 2ZH8A 3POTB 4B9NA 5HMZA 1E6YB 2VPZB 2W4PA 3KLFA 1FA0A 1FO1A 2G0CA 2PMZD 2LECA 3BGFA 2Q66A 4LF7F 2CG4A 4X4SA 4MIAA 2KTQA 2JEIA 2Y0SD 2J0QD 4NA2A 5LJ5Y 1UAWA 4OZNA 2NR0A 2ZE2B 4B9SA 2DHAA 2Q79A 3BO3A 4NLSA 4ZCMA 3NAIA 1SJQA 1T7PA 5FLXY 1VGYA 3UDCA 2MQMA 3MR5A 1U1MA 3Q22A 2UUTA 3F41A 3M30A 3MM5B 3QAUA 4WKYA 1QTMA 2EK6A 4ZKAA 3KOAA 2M9KA 3QMQA 2CQ4A 3OVBA 4ICLA 2BJDA 5HP1B 3ZFVA 1FNMA 1BY9A 2RQKA 1QSLA 5GAGI 4RNFA 2JFKA 3OTBA 4N47A 4NCGA 4CO0A 4B9MA 1L5UA 3KNGA 2QLWA 1S76D 3IAS9 5DQHA 2KU7A 3IO1A 1VQ4S 1MW7A 2HFOA 3T5LA 4PR6A 2J9DE 1IKYB 4X84A 4ELUA 5J2PB 3IGVA 1XERA 3FGVA 3B8HA 2LXIA 2M8HA 4FXWA 4K4ZA 3PM9A 4U7CA 1R0AB 2N3LA 1RT7B 3HHNB 3TR5A 2VFSA 4EWTA 5FDLA 4K4XA 4C98A 5F8IA 3M30B 3CCQS 3HVWA 4FPRA 4PG5A 2HNYA 1NK0A 2IBKA 1TKTA 5AJ3F 4NLDA 4YQWA 4WZQA 3M1VA 2JZ5A 1Q1KA 2E44A 1ZAVA 2UXDF 5I42B 3OTEA 4F2SA 4PKDB 4KV8B 1JLEB 3UR3C 1B0VA 3S8SA 4Y2MA 2VOOA 2KFZA 1ZZFA 3MF5A 3EXCX 4I4BA 4A47A 1JKHA 2OO4A 3KTQA 1AUDA 3G6ES 3VAFA 2DNHA 2HQ3A 4DG1B 3MEDB 4A8QA 1C1CB 2RD5C 1YRXA 2H5EA 3CJ5A 2RU3A 4IDKA 2N4CA 3I4PA 1ZM2A 2VFVA 4RW8A 3HPOA 1IBMF 4LF8F 1YJUA 5LXRA 4WJBA 4FS1A 1P1LA 1A9NB 4X64F 1WHWA 2RJZA 2XCPA 4HDHA 1VQLS 5B0EA 5AXKA 5KOWA 2W9BA 5ITHA 1T94A 3NS6A 4DL4A 1X9SA 3RU0A 5HROA 3DM2A 3J7A1 1VS3A 1KN6A 3TO8A 5HMWA 2RRNA 2XLJA 1UJ5A 3CPWR 2XI3A 3L7OA 1S99A 5DS7A 3LF0A 3VAKA 3O1LA 4WZMA 2CZVC 2JHEA 1IQTA 2C42A 4FF1A 3FDSA 2R7OA 4JI5F 3SCJE 1TVRA 5MAOA 2KJWA 2CPIA 2ZOGA 5C42A 2GX8A 1ZTTA 4A8SA 3LP0B 3TRGA 1BQMA 4ZOSA 3CD6S 2MKCA 3E01B 3OQ2A 4OX8A 4JI4F 1LW0B 4EO6A 2IJNA 3QYYA 2XY7A 3KMQA 3PZPA 4A8OA 4IRCA 3K58A 1SXLA 2FLPA 2VD3A 1JLFB 5J2MB 1RT2B 3ZZUA 3MWBA 2DRAA 2E7WA 4O3PA 1KOHA 3I87A 4F67A 4ECSA 1SH0A 4ZMMA 3BM7A 2CJQA 3WBZA 3QAEA 2ZDOA 5EGYA 2XY5A 3RZAA 2KXFA 3IR6B 1KFSA 3LO3A 2GC8A 4M63A 2UXCF 4ECWA 1R8AA 5LT5A 4ZA1A 2V9KA 4BC7A 5LXYA 2HHXA 4DF8A 4KB7A 3RB0A 2J7WA 2FVCA 3ZZTA 2ZC4A 2LA4A 3CD5A 2HHTA 5KAKA 3KLGB 3HP6A 1UA0A 1BQMB 5DG9A 3P49B 2JRSA 1FKPA 5DG8A 2XB2D 2K2PA 4RW7B 2EBGA 3TVZA 2NQPA 1SL1A 4O3OA 4YEAA 4B9LA 5CYMB 1DAXA 1RA7A 2OPRB 3T1HF 1QAJA 5KFCA 4IR9A 2P9EA 1N48A 4LF6F 2UVWA 3N6LA 4QIWD 3V81A 3PX4A 2HHWA 2CZ4A 4HYKA 3QJJA 1GXUA 1UJ4A 5LSLA 4V19J 3T1AA 4LUBA 2CVIA 3UQSA 3V2UC 3B4DA 5CHCB 5DLGA 1NB7A 2XG8A 5JVHQ 3CDUA 4B08A 4ITSA 2N7YA 3T1YF 1WELA 3KLGA 3MR6A 1RTJB 2ABYA 4ZPWR 3NNAA 3N01A 2VG6A 1JIHA 2DGSA 1UW4A 1JLBB 1KVIA 1C4AA 2FHMA 4FNHA 3PEJA 4FVMA 3SI8A 1WG1A 2MY8A 1Z1ZA 1OPZA 1U2FA 3TUJC 1SJRA 2V8VA 3OJUA 2JLGA 1SKWA 2MXYA 2IVMA 2RU9A 5FJ4A 4UQGA 4NL5A 2NREA 2B4VA 1M5KC 3BDEA 2X3GA 2IRYA 3RR7A 4O3QA 4NZ6A 1KR4A 1IJFB 4IR1A 1MMNA 4Y65A 2Z2MA 2RMLA 3T5JA 1FD8A 1NK9A 2XMVA 2VV5A 4ZCKA 4DL3A 3AB2B 1TP7A 1ZM9A 1N5QA 3DFEA 4C2MA 1VQ5S 2ZJQQ 1H2UX 3KYLA 4WFYA 2WSCC 1X4CA 2VKZG 2K7JA 2BZ2A 3EGNA 3IS9A 3H5YA 5C5JA 1VC6A 3W2WB 2R7XA 1S0OA 4K4YA 3HVTA 3IRWP 4L6V3 4MK9A 4J9RA 2GFFA 3J7Z5 3TARA 3CCLS 3TVYA 4RBVA 2UXBF 1N0UA 4K0KF 3ISZA 5I3UB 4AYBD 3G4SS 2O66A 2FJVA 4DV2F 3CIZA 4HH1A 3HKZD 4HHJA 5A6PA 4DQQA 1YGYA 3W7BA 4RW9A 3HZGA 4I2QA 2NPIA 4ZPTR 2CQ3A 4RBTA 3FQKA 4F8RA 5KFYA 4LIWA 3M8PB 4EEYA 3CCUS 4ECTA 4UOCA 5KFEA 1LV5A 5I4MA 5KFXA 4B9UA 4QU6A 4DOZA 3DOMA 4TYBA 1BQNA 1QM9A 1R8CA 4OMFG 2DHGA 2J0WA 2DO0A 3O44A 2D3ZA 4ZDNA 5DLFA 5KT6A 2OTJS 2OPSB 1FVSA 5SZTA 1P1TA 5B0GA 1DJ0A 4LF5F 2IMWP 2E29A 2YX4A 4NRUA 4RU9A 5H1SV 1HW8A 1HBUA 3TAMA 5DGAA 2MQPA 4FF2A 3MAQA 4ZP6A 2E1CA 3D0IE 3CJ4A 4OX6A 3BDPA 4DQIA 4KJIA 1R89A 3H8YA 3R27A 3MD1A 5KTQA 4X4TA 4YR2A 2Y1IA 1FJGF 2UUWA 1DTQB 1HI8A 3BO4A 4FNIA 2YKNB 2QA4S 2MZ1A 4KFBA 2HHHF 1S4FA 1VC5A 3ZZPA 2QYCA 2R7RA 4OI0A 2I0XA 1YRTA 2IM2A 4ZPCA 1R8PA 2WB1D 4NYOA 2AX0A 4TQRA 2KJVA 4CO2A 1FVQA 1H6KX 1VQ9S 4B3RF 4OL8A 1NJIT 4TU8A 1HQEA 4CIOA 3KK2A 1TL3B 2EW9A 3LGMA 3N0VA 2PI4A 2ZBCA 5L9NA 2YX1A 5KG6A 1J5OA 1FRMA 3I5CA 5KFSA 3PKMA 2DHXA 3KFWX 4GC7A 4J37A 3SSRA 2FJAB 4BC9A 4K4WA 4U9RA 2LVWA 1VQ7S 2W4CA 3RAQA 1XBWA 3UI3A 5AE2A 5KG5A 2LU1A 2CPYA 1VI7A 2DNKA 1CLFA 1SL2A 4G1PA 3GG0A 3PX6A 5LSOA 3HX9A 4KAIA 2Z2LA 4HEA9 4N76A 4YB7A 5T14A 2OD6A 4DR1F 3UDLA 4RW4B 3UNGC 5GADI 3Q8QB 4KFBB 3G8SA 1BLUA 3MM8A 2C3YA 1FXLA 3O8WA 4LFAF 1FHTA 4MH8A 2KM8B 2DPJA 2GGPB 5IT0A 3NG8A 1JLAA 4KQZA 1L3SA 3AH6A 1RT1B 5IT9Y 3GIMA 2C3PA 1PILA 2PMHA 5IWAF 3LGNA 3C2PA 3JSMA 2IC3A 1JLGB 5HO4A 3VAHA 1U47A 1BGXT 3PFEA 2ROGA 4YR3A 4NA3A 2OLWA 2ZVSA 2JEFA 1CSJA 1VBZA 3SV3A 4IRKA 2LQ5A 5CA5A 5A8KA 5KFHA 4O3RA 3GSDA 2HGMA 4DUZF 4KKOA 1SKRA 4Y0FA 4ZP8A 2MKHA 1D8YA 1WACA 2DTJA 1M5VC 5H9EJ 2HRUA 2KYXA 2XMMA 3U02A 5EDWA 2HYIB 4TQSA 3PO4A 4C8OA 2GMJA 4BBYA 1YI2S 3BN4A 5LMUF 1X4FA 4K5SA 2RQMA 3VTIA 3DOLA 1U09A 5HMYA 3NGDA 4EBEA 4KGMA 1RTDB 3OBIA 4ID5B 2J0SD 2HNZB 4ZS6A 4ED6A 2ASJA 2DR9A 1LW2B 2IRXA 3OLAA 2OAUA 4IRDA 3OL6A 1XC9A 3MM6A 3DLKA 1HW9A 4PXCA 1NNDA 3HFKA 4WXWA 5F8LA 2MKIA 3LALA 1V3RA 4ILRA 4X4PA 2ZJPQ 3KK1B 2EG2A 3K8WA 3CCZA 3PW7A 4MMOA 1EETB 1R8BA 1S1XB 3DC2A 5HBMB 3UR0A 1KSPA 2W8LA 2R7QA 3MMCB 2CQ1A 3U27A 3JSRA 3OVSA 3LP2B 4Y00A 4ECUA 2V4QA 2M88A 2E66A 5E3RA 4B3TF 4C0OC 2AYBA 3LQVA 4LJMA 2BOPA 2MJUA 1QSSA 2AV5A 2YWFA 3RRHA 1S0MA 1R7IA 5KG1A 3OLBA 1U25A 1YJTA 1W2BR 1E6VA 3WC2A 4NOHA 2I9SA 1SV5A 3Q8SB 4ID5A 3QJLA 2VC0A 2MQQA 4Q2LA 4ZVGA 2WONB 5E3PA 1WF1A 3ISND 3C66A 4Q44A 3RTVA 2XS2A 4NLVA 5KFTA 3RAXA 3CWJA 1QSYA 5FDLB 1M1KT 1KONA 2J6SA 3CC7S 2KN4A 4IFVB 4RWXA 3CUNA 2RS2A 4X66F 4JI2F 2DNLA 5CH7B 2NPFA 4DN9A 2BRLA 3MMAA 2DNZA 5KG4A 1Y7PA 3CIMA 2QT7A 3V4IA 1S77D 4YDXA 2JH3A 4H4KA 3H40A 3CVKA 5D3GB 2NZ4A 4FBTA 1X5TA 5A8RA 2YKPA 2XC9A 4QOTA 3GV7B 1TKTB 2LQBA 1NKBA 2HHUA 3HHEA 3CJ2A 5H9FJ 2CKWA 1X5OA 1JLQB 2GIQA 2M4MA 2YWEA 3D5MA 1HBNA 2RQ4A 2QMXA 2B7CB 2X51A 3E8OA 1YG0A 2CPDA 1UEVA 2RS8A 4FXDA 2VL1A 2DH9A 4YR0A 3KLIA 5D4NA 5CXTA 3KG0A 4J9SA 3KLVA 5F3ZA 4N8OA 4B02A 3BGRB 4OJHA 4X4VA 4IKAA 1Q16B 5LJ3Y 2F7VA 3JTNA 2K1RB 5CZXA 4Q8FA 3X1LB 1DTQA 1JJ2R 3K0JA 4YMEA 4IYQA 5F8NA 4ZPVR 4OLOA 4DF4A 4Q5VA 3OSNA 1S9GB 1UVIA 2V4JA 1LFPA 4JI8F 3TW0A 1IBLF 3UWTA 3E51A 3C46A 5B0CA 1T8EA 1MROB 2F9DA 4H4OA 3I56S 3THPA 1HNVA 1Q79A 2VA3A 4F02A 1IN0A 3R5CA 4OIXA 2JDJA 2HFZA 2B51A 2OPRA 3DI6A 4F4XA 2HMIB 2KDOA 4PRFA 4IH5A 1LKZA 1PC4A 4J5OA 4PQAA 1FKOA 1RKIA 2LQJA 1S0VA 1MU2A 1UVKA 2YKOA 4RNOA 2VZ9A 2WCXA 2K1RA 2DNNA 3Q2SC 3QLHB 2HHQA 5C42B 4PG6A 1IKXA 5EX3A 3DYAA 1NJYA 3CF5Q 2DCUB 2XSJB 3CCMS 3T6JA 1HA1A 1FRJA 3PX0A 3D1QA 4L72B 5KFOA 5DGBA 2FVPA 2MSTA 2K8GA 1FKAF 2NXUA 4NZ0A 4N56A 4OJ3A 4MKAA 3RB4A 3BB5A 1RT2A 3L3CA 2ZH6A 2FIUA 4O3NA 4QIFA 1JNZB 4D3HA 1HNZF 4XIUA 4USIA 2J7UA 4DFPA 3E3XA 3P6YC 1TKXA 4AL6A 4PQUA 4M5DB 1VQPS 1I6JA 3QGPA 1M5SA 4OI6A 1T95A 1JK9B 3TAMB 3BQ0A 2R4FA 3OTOF 4J9MA 2D9PA 3MUTP 2A2DA 1MWYA 2HG4A 5B0AA 4IO9Q 2PEHA 2XSJA 5D6GA 1UMJA 5A8WB 3P3DA 2BM1A 3H5UA 5KFKA 4ED2A 4J9OA 1SH3A 2FLLA 2DNYA 3T9NA 1KLMA 1DRZA 4M94A 3QGGA 3NCQA 1RDRA 4DSEA 5DDQC 4F25A 1ZM3A 2QSWA 5E2QA 2EFGA 4I6YA 1VRUA 5E33A 3VQTA 4R5PB 1HBMA 4P7VA 2R8HA 3AY0A 3S1TA 4DJBA 1M0SA 2V0NA 3VZIA 2ASDA 1RT3A 3ICLA 1LWFA 5KFLA 2KHCA 3CC4S 4KT0C 2MSSA 1RYSA 4CT8A 2I5JA 4HT5A 2HNZA 4CQ1A 2MQOA 5KFUA 1KC8T 4IG3B 4C8YA 3LH2S 1TKZB 2EWHA 4M5DA 5J2QB 1YBAA 4YDDB 2FLNA 3SCKE 1RWUA 1F5AA 4CT9A 3O3LA <