1BC7C

Serum response factor accessory protein 1a (sap-1)/dna complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*AP*CP*AP*GP*GP*AP*TP*GP*TP*G)-3')
total genus 24
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bc7C00
1RI7A 3F8CA 3VFZA 3OOPA 1PDNC 2O6GE 2EK5A 3GF2A 4ETSA 2A6EF 4Y13A 2HDCA 3C3WA 2VBYA 4NQWA 4HX7A 2PI0A 2QLZA 2BYVE 2L4AA 5HS8A 4OIQF 1WWXA 4U0YA 5E1WA 2A07F 2XV4S 5IT9K 2ZNYA 1Z6TA 5K5RA 3QU6A 2FSWA 1FP2A 4JBAA 4UV9A 4L0YB 1EV7A 4PGHA 5HLGA 5AIPA 4MQ9F 3WE2A 1BI2A 2F2EA 4HLXA 1R58A 1ZREA 5D8LB 1MDMA 5D4SA 1CF7A 1D5VA 3NEUA 2NNYA 1GVJA 2DAOA 1D3YA 5DEQA 2J5OA 6PAXA 4L9VA 3IC7A 1R7JA 1F9NA 2JT1A 3K9TA 2EV0A 3ZN1A 3BJOA 2MLGA 4KIFA 3WTSC 3MCZA 4RB3C 3RDIA 4A2UA 5FLXK 1TNTA 2DK8A 2RGVA 3ROUA 1B1BA 5CYVA 3BY6A 4LK1F 1U5TC 2XAFA 2V1UA 2RN7A 1WKMA 2A61A 2EJRA 3GLXA 2IW5A 1S6LA 1ZH5A 1G3WA 2OZ6A 5AIQA 2MC3A 4MEXF 1CF7B 1ZRCA 4CICA 3KCCA 4L9NA 1USTA 2D45A 1FPQA 4MTEA 2M8EA 2FEZA 1G6NA 2H09A 2FRHA 5JI6A 4I02A 1FYKA 1WSUA 2O61A 1B4AA 4AWXB 4HW0A 1KGSA 2PG4A 2HZTA 2HQNA 1FLIA 4M9SA 4CGZA 2DW4A 5JFRA 4KFCA 2Y48A 1YW9A 5K5QA 2FA5A 4NHJA 1TQPA 4EM1A 1BBYA 4DQ2A 2DQLA 4UVCA 2VC1A 1P92A 4ZZLA 1YS6A 1SMTA 4A6DA 4UNOA 4BHBA 4B09A 3BROA 3KP6A 2A6HF 4EJWA 1FX7A 4ZZDA 4EQQA 1Z1DA 2K7LA 2JSCA 2IA0A 3HRSA 3ZMDA 3DPTA 1LQ1A 3WE3A 2HYGD 2PQ8A 2NNNA 3RPUA 5LGNA 2XVCA 2E7WA 2L01A 3KP7A 1T39A 1XSDA 3QOPA 1FOKA 2HS5A 1KYWA 5LEJA 2M45A 5DUKA 2CGPA 3CLOA 4FT8A 3RJPA 2EFOA 2R3SA 4KN7X 4MQVA 3G73A 2HYFA 4CO8A 4MGRA 1IW7F 1D8JA 1S7AA 4LFUA 2K4JA 4AIKA 3ZPLA 1I1SA 1HXDA 1TNSA 4XSZF 4NB5A 3P7NA 4OU0A 2EFNA 4WK8F 5KVRA 3PQKA 1LDJA 2M30A 4YFXF 5FO5A 2P6TA 3D5LA 4U7DA 2A68F 2IT0A 3V7SA 3WTTC 3K2ZA 3WTZA 3I58A 3ZMUA 2KKOA 2D1VA 3WGGA 1PP7U 2P5LC 5DV5A 2QYOA 4RS8A 4RB1A 4GYGA 3TGNA 1SD5A 3I71A 3QP5A 1EH6A 1STZA 4N9IA 1FWZA 1TW2A 2YPRA 4GYIA 2IA1A 2IP2A 3ULQB 4KICA 2XGXA 1P4AA 3E5QA 4CZZA 4OIRF 2KIMA 4P55A 4WXHA 3JSPA 5HVQC 2IRFG 4IHTA 2HTJA 3CDHA 4ZYDA 2D1HA 2QQ9A 2NRAC 3KZZA 4XLPF 1O3SA 5ICEA 4ENNA 2FF4A 3MFKA 5FFXA 1FYLA 4LJZF 2L3DA 2EA2A 2STTA 5DCMB 1XSVA 1IAWA 3F8NA 4UVAA 4OOIA 3HRMA 3WTWC 3K69A 3ZMTA 3KEOA 4HLYA 5D6EA 4A5NA 1T98A 2RV8A 3FWEA 5CVUA 2KIFA 3CUQC 2BGCA 4IHSA 2PMHA 4FHTA 5FD5A 1JHHA 1H9GA 3GEZA 3HHGA 5HS7A 2W24A 1QO0D 3JSOA 5DD4A 3BJAA 3ABUA 4S04A 4U7BA 3F22A 4R79A 2IA2A 5ILSA 4GO1A 1LDKB 1ON1A 4P9UA 3ISPA 4P5OA 3PFIA 3DEUA 3JAMK 2EWNA 4QWQA 1QZZA 4YIFA 2P7CB 3DV8A 3BPVA 3JAMZ 2UWMA 3F72A 2G7HA 4HF1A 2G9WA 5DUIA 1DPRA 3QRFF 1ZG3A 1UHMA 2XAHA 1O3QA 3ECHA 2V1DA 1SAXA 1XGOA 4WCGA 1FSHA 1KU2A 3RPQA 1JHFA 2HGCA 3VB2A 2P5VA 3DPLC 3FZVA 1K78B 2QWWA 3HTUA 4PZJA 3GXOA 1BM9A 4BXUA 3RI4A 2Z99A 3LA2A 3D0SA 4G6QA 2KRFA 3WTUC 1O57A 4ESBA 1ON2A 5DYMA 4Y15A 4I2OA 3L7WA 2XKOA 1R22A 4DNCA 3F8MA 1NHAA 4HDVA 1XN7A 2HTSA 5CLSA 4G8XA 1J9IA 3WU1B 4A5MA 1R36A 1BI0A 1Z6RA 3V7CA 4KIGA 1T0FA 3F3XA 2MH2A 2W25A 3F21A 4MHGA 5CVIA 3GX4X 2NS0A 2P8TA 4ENKA 4LGWA 1G3YA 5LHHA 4M9ZA 3E6MA 1K79A 3GFLA 2H6CA 4ENJA 2ZMEB 3H92A 2GZWA 5TRDA 1QGPA 4A0XA 4H0EA 1I27A 2M1BA 2BV6A 5D6FA 1LDDA 3QP6A 4Q5SF 5LRSA 1J7KA 2XAGA 1UFMA 2K27A 1IRFA 1BI3A 1JE8A 3KFWX 1R5HA 1FNNA 1SD7A 1EH7A 5D8KB 3KP3A 1ZRFA 1TTYA 2AS5F 2P4WA 2ZXJA 1FC3A 2VOOA 3T5XA 4K2EA 2YSRA 4LMYA 2PLYA 4G7ZF 2BBYA 2ZMEA 1ZAOA 4M72A 3V8JA 2CG4A 5D5VB 4JK1X 3IRRA 1K7AA 3EQLF 1YYVA 1G3TA 3CTAA 1DP7P 3JTHA 2GAUA 5D5UB 5E8IA 2W84A 5J6XA 1FZPB 4A0ZA 1KQ8A 3FHZA 3P9IA 4N9HA 1V4RA 4GCVA 1XDSA 5J8CA 3GFIA 1F1ZA 3B02A 4YFNF 2V6CA 5F1RA 1XGNA 2ESNA 1YS7A 4HQMA 2FNAA 1IF1A 2J5PA 3KLOA 3IKVA 2FBIA 3VEPA 2ISYA 3I64A 1A04A 3BOQA 3HRTA 1IN5A 4CYDA 3ZN0A 3F6OA 4A12A 2JZYA 4KIBA 5BS6A 2FBHA 4MTDA 3DQVC 2R7FA 2IPQX 1Z91A 1MDMB 2F5EA 1WQ2A 5ILVA 2EV6A 4CHUA 5L3DA 1H0MA 3E6DA 2Z3YA 1W7PA 2L4MA 4G9YA 3TDUC 5JR3A 5D5XB 3IWFA 1XDUA 4HBLA 4ESFA 2H6BA 1V3FA 4UV8A 4XSXF 2X4HA 2HWVA 4O6JA 2K86A 4IXAA 3MZHA 2DBBA 1J2XA 1R5GA 4ESJA 1IN8A 2CW0F 1OPCA 3K0LA 2CFXA 2FNPA 3QPTA 4G7HF 1HBXG 4OIPF 1FBQA 2Q2EA 4BHCA 3K1PA 5L3EA 3JW4A 3LQQA 5ED4A 3KZYA 4Q48A 4PDKA 3SHFA 1IN4A 3PQJA 2RVCA 1L3LA 1B9MA 3RIRA 4PCQA 5A2QZ 2KJBA 2CO5A 2X0LA 2D2WA 3S2WA 4OMYA 3KP2A 1OKRA 1JGSA 3TO7A 2CWEA 1IRGA 2GIVA 3I53A 4OINF 1QQIA 1HKSA 4HX4A 1QNTA 4Q4ZF 3TOAA 2Y75A 3CUQB 3KE2A 4XLNF 1G4DA 2E1CA 4G7OF 1TW3A 1BN5A 5CVJA 1YW8A 1FBSA 1ZGJA 3ABTA 5FD6A 2VC0A 5A2QK 3J81K 3FM5A 4PGGA 2V1XA 2VN2A 4RAYA 4G6DA 1JXSA 3BPXA 4QLCU 1R23A 5F64A 3BJ6A 1U5TB 3E3VA 1GXQA 3I54A 3Q9SA 3HUGA 3RKYA 1HKQA 1SFUA 4XBFA 1X3UA 3JTGA 2IJLA 4KYWA 2FQ3A 3HSEA 1ONVA 2PFBA 3QU3A 1R1TA 3WTYC 4HV6A 1U5TA 2FBKA 2QENA 2ACJA 3HSRA 3GYHX 2ZJ2A 4LLGF 4ASNA 2DTRA 4BQAA 1ZG5A 3ML6A 1MZBA 4R8HA 1ZG1A 5FLXZ 3HRUA 3C7JA 1OYWA 1J59A 3GW2A 1LVAA 2KJCA 1RUOA 1XGMA 3C18A 2H94A 4UUVA 1XGSA 1J75A 5ICFA 4HYEA 3FMRA 3ZQ7A 3MQ0A 4KN4X 2DFIA 1USSA 5ERIA 4L9JA 2VBXA 2FMLA 2VBWA 3CO7C 3RTRA 4WF2A 2ADUA 3L09A 2O03A 1XMKA 3T8TA 1BIBA 4EV0A 2O3FA 4JQFA 4AD9A 2YX7A 1AWCA 3R4KA 1HW5A 2ZKZA 3R6SA 3EUHA 4ZH4F 5J8FA 1I6XA 2PBIA 5ILUA 2QM3A 5ICCA 4LLNA 3IWZA 4AIJA 4I01A 1Z9CA 2XASA 3REOA 4GGGA 1T2KA 4LG0A 5L3GA 1TBXA 3L2CA 4I98B 4A6EA 4CDGA 5LHGA 1K78A 2ZO4A 1MJBA 3CO6C 3ZMVA 2VXZA 2NAZA 4LD5A 3F8FA 2PMUA 4L18B 3RKWA 1ZLKA 3QPHA 1KQ0A 2DI3A 1LB2A 5DCMA 1SD6A 3HOSA 2KIUA 3WODF 1Z05A 3B73A 4I0BA 3U9GA 1MKMA 3LAPA 1S29A 4RB0A 1PUEE 4KNYA 5HOOA 3E97A 4O5VA 2LF8A 3TO9A 3VODA 3U2RA 4EM2A 3E6CC 3WGIA 2K4BA 1B9NA 4EJOA 4GXOA 1YG2A 2QBYB 4RGUA 3L00A 4HX8A 4YG2F 4OMZA 2QUFA 3DFGA 3E5UA 3WGHA 4UXNA 5HDKA 4Y17A 1MGTA 2RKHA 4L5JA 2DU9A 3H3ZA 4KUMA 5E8GA 1LEBA 5D5WB 2JTVA 2WWYA 4EMSA 4KMUX 4E70A 1HW1A 1ZLJA 2M87A 4TV7A 1E17A 2H27A 4FX4A 3O3KA 1YW7A 1SFEA 1MJAA 2ISZA 4LG0B 3G3ZA 2HFHA 1S8NA 4RGXA 1ULYA 2F5FA 2GQQA 1LNWA 5LRRA 5BOXA 5JHUA 1RNLA 2MA3A 4YFKF 2LNBA 5L3CA 4HA8A 2P6SA 3V8LA 2RQPA 3T1BA 2O0YA 3DF8A 5H6RA 2ZFWA 2GWRA 4U0VA 2BEOA 3RKXA 1TQIA 1I5ZA 4HOBA 3N4MA 2WTEA 5K5OA 2HKXA 2ZNZA 1T38A 1R00A 2QVOA 2AXLA 4AIHA 5E1XA 4U88A 4BNCA 1YLFA 5LEKA 2XKPA 3F8BA 1B59A 3F23A 3HTSB 4EJUA 1HSTA 3O6BB 4M71A 5EEGA 2ZCWA 1ZHFA 4I7HA 1HQCA 1LJ9A 2DT5A 3LAJA 3TQNA 2VODA 1CGPA 5CVVA 2OD5A 1BI1A 4HF0A 1ZGAA 1SD4A 3U1DA 4HV5A 3K1NA 3J80Z 3LQRA 2EFPA 1FY7A 1QZYA 2JRTA 3I4PA 1DUXC 2L02A 2OU2A 3R60A 4HQEA 1LEAA 3T8RA 2TDXA 4IRGA 1RUNA 2VT3A 1W5SA 5E18F 2HR3A 1YQAA 2XAQA 2HKOA 3N97A 2V79A 1D8KA 1S7OA 2BE5F 3SZPA 5DDGA 2Z33A 5CVRA 5FB2A 1P4XA 1ZYRF 3R61A 1FYMA 3W6JB 1BC7C 1E2XA 4I09A 1O3RA 3NQOA 5EEHA 2DLLA 1K6OA 1U8RA 1L0OC 2E7XA 4O3MA 4I0AA 3ZMZA 1MJ9A 1HW2A 1BJAA 4ZYEA 2A5YB 1KA8A 3DKWA 1U3EM 2M5WA 5HLIA 1UHWA 4EGYA 1FSEA 1HSJA 5LBQA 3EYIA 2ETHA 3FXUA 2VE9A 3FM3A 2PN6A 1U2WA 3GO5A 2F5DA 3E6BA 3EETA 2MH9A 2QZ8A 2EFQA 3H3UA 3IHUA 3LFKA 5K1YA 3GWZA 1KQ9A 5HDGA 1UCRA 2O8XA 3NRVA 4BYYA 1TLHB 2ESHA 1Q1HA 2V9VA 1F4KA 1Y0UA 4S05A 5D4RA 3RYRA 4IJAA 4P9FA 4D0PA 1GHCA 1MD0A 3OV8A 1DDNA 2IVMA 5IT3A 2Q8KA 3I5UA 5BPDA 4HDUA 5AONA 3MAJA 2UXNA 2XIGA 5H6QA 5LHIA 1OR7A 3M1EA 3L9FA 4YIIA 2F5CA 2QQAA 4ON0A 1IXSB 1P4WA 1IN6A 3WU0A 4KMFA 1KU3A 3DP7A 3V7RA 4ZYHA 1KYZA 2W85A 1AOYA 2FU4A 2EV5A 4EJVA 1TQMA 2XUBA 2LKPA 4WX9A 2JPCA 2RDPA 2GA1A 3FXQA 3TO6A 5H20A 4OIOF 4G94A 2K02A 2OBPA 3LA7A 2ELHA 1C0WA 2CSOA 3RYPA 1ZARA 3W6KB 3CJNA 3FF5A 4UVBA 1GXPA 1SMYF 2XHKA 2OQGA 3T0YA 1OMIA 3WTXC 1WRJA 3HIFA 2UXXA 1DPUA 4HZFA 1XCVA 2VOPA 1J5YA 4LK0F 1R1VA 1XCBA 3KEQA 1IXCA 1FP1D 1YFHA 1YO5C 1U78A 4MEYF 3LWFA 2HQRA 3TOBA 1XMAA 5IT9Z 2OA4A 4BH9A 2JPBA 3M9AA 3EYYA 3GUDA 3P9CA 4HF2A 1VTNC 3BWGA 4FX0A 4BAYA 3WTVC 3KP5A 2DO7A 2XRNA 1FBUA 2VBZA 2MLKA 3SXYA 3CUOA 3GFMA 4KA4A 3MZYA 3O2PE 5LGUA 5E17F 3TDZC 1REPC 4XRFA 1P2FA 4L0ZB 2LF7A 1T6SA 3IKTA 5TJJA 1XB4A 4IF4A 4N0BA 3HSFA 3CUQA 4F7ZA 3KLNA 5E1ZB 5BPIA 4EGZA 3VOEA 4CXFA 4IVNA 4Q47A 2RC4A 5L3BA 4MNUA 1EH8A 3ELKA 1ODDA 3GVAA 2HEOA 3M8EA 3BDDA 2YR2A 3K1MA 4LB6B 1S3JA 1OYIA 1BOAA 1HKTA 3ECOA 3R0AA 2DPDA 2B0LA 4B8XA 2L54A 5LLQA 3MEXA 2Y0MA 4AVPA 2STWA 4WWCA 2QBYA 1XSXA 4WXDA 3GFJA 3GZ6A 1BC8C 1ZRDA 3LSTA 3DXJF 1O3TA 3IL2A 2Q0OA 5BQTA 3V4GA 3J80K 2Z9OA 3SQNA 2QQBA 1KU9A 4RGRA 3SFZA 3MWMA 4IPAA 2VONA 2FOKA 2LSOA 2WC2A 3COAC 1OYYA 1F5TA 2MBFA 5ICGA 3FMQA 2VT2A 2EFWA 2G7UA 1XD7A 4RAZA 2VE8A 1J0RA 3Q9VA 1B6AA 3FXRA 1WI9A 3FMSA 3QAHA 1FT9A 2DK5A 4ZYGA 2UZKA 4LB5A 2YU3A 1RIOH 1R1UA 5FGMA 2A3SA 3BZ6A 4RB2C 1YIOA 4UHTA 3J81Z 4EVIA 1IZ1A 3R0JA 4KT5C 4L5IA 5LGTA 1KU7A 2FE3A 1W7PD 3HYIA 3KP4A 2E1NA 1G3SA 4M6YA 2XROA 2DPUA 3Q5FA 3ZMSA 5BMZA 5JVTA 1IN7A 4EM0B 5HDNA 4M73A 4EJTA 4R1HA 2PJPA 2C6YA 5DD8A 3I59A 2A69F 1SFXA 4M74A 4M6XA 3V8KA 1W7PB 2P5KA 4IRIA 3ZP5A 4P96A 5F6FA 2FXAA 4ENMA 3EDPA 1W4MA 4WXCA 2EA4A 1P6RA 3M8FA 3HOTA 2P7VB 1I1GA 1O7LA 4IRHA 1QPMA 3ERED 3LA3A 3C1DA 2FMYA 3WG9A 2NYXA 4HAMA 4RGSA 3AAFA 2EB7A 2OZUA 3M7GA 2CQKA 4A0YA 4KDPA 4LLLA 3TKYA 2RNJA 2CYYA 2GA2A 2Z5UA 2MD5A 2R7DA 1W5TA 1RZ4A 4Z2YA 3BP8A 3I59B 3FX3A 4L9TA 5FFZA 1H9TA 3KETA 3I0TA 3GZ5A 3HHHA 2PEXA 2W57A 1IUYA 2YX4A 1U6GA 1ZN2A 1BIAA 5CJ9A 2DQRA 3SZTA 3F6VA 1Z7UA 5L3FA 2XAJA 2WV0A 2OQRA 5E20A 5KK1A 5HLHA 1IXRC 2LDUA 5DCFA 3P9KA 4U0WA 2COMA 3IRQA 1UB9A 2GXGA 3E5XA 2HOEA 3J7AO 1QBJA 1PP8F 4BHPA 2ZBKA 2OAZA 5HS9A 2GXBA 1O7FA 1YTYA 4M9XA
chains in the Genus database with same CATH superfamily
1RI7A 4L5EA 3UR3C 3GTLJ 3F8CA 3VFZA 1SANA 1WJEA 3ONQA 5JVGF 3OOPA 1PDNC 3S14J 2O6GE 2EK5A 3H5NA 3S1NJ 3GF2A 3L2QA 1PVEA 2DJIA 4ETSA 3C2GA 2A6EF 1JTYA 4Y13A 3P5JA 2HDCA 1TC3C 3C3WA 1S7EA 1VQ8I 3CLQA 4OWRB 2VBYA 4BS9A 4NQWA 3PSIA 4HX7A 2I8DA 2PI0A 2QLZA 2XPUA 1MH4A 2BYVE 2L4AA 5HS8A 4OIQF 5JLWA 1I50J 3BQYA 2Z16A 1X1PA 1WWXA 2BVLA 4U0YA 3TEDA 5E1WA 1N77A 1JKOC 2A07F 4YELA 4DBQA 2XV4S 5IT9K 1ZGWA 4UUSB 2ZNYA 1Z6TA 2V7FA 3BQZA 3ZGKA 5K5RA 3QU6A 4JX4A 4A3FJ 2FSWA 3BG5A 1T56A 1FP2A 4JBAA 4D5FA 1BOBA 2JMWA 2Y9YA 1FOXA 4UV9A 4L0YB 3G4SI 1IGNA 2EBIA 1EV7A 4PGHA 3I9V2 5HLGA 1HLVA 5AIPA 2D5VA 4MQ9F 3WE2A 1VQ6I 2NVQJ 1NTCA 3LSJA 3SEZA 1BI2A 2F2EA 4IOCF 2BXZA 3BTLA 2K9SA 4HLXA 2I10A 1FIPA 5B3SH 1R58A 2M4GA 1ZREA 4XRSG 5D8LB 2KHMA 1MDMA 5D4SA 1CF7A 1D5VA 4N4NB 3NEUA 2NNYA 2H1LA 4CUGA 2WAFA 4X0GA 2HU9A 2ZJQF 1GVJA 3FBNB 2KP6A 3S1RJ 2CQQA 2IGKA 2DAOA 1D3YA 3ZRGA 3OL4A 5DEQA 1TL8A 2J5OA 3H5AA 1E0EA 6PAXA 4L9VA 3IC7A 1Z3YA 3AG1H 1ETQA 1R7JA 1F9NA 2JT1A 2CQ7A 3K9TA 2XGCA 2EV0A 3ZN1A 3BJOA 2MLGA 4KIFA 1X1BA 3MCZA 3WTSC 4RB3C 2X1EA 3RDIA 4A2UA 5FLXK 2LYCA 1TNTA 2DK8A 2RGVA 2VL8A 3ROUA 1B1BA 3AG4H 3HPHA 5CYVA 3OYCA 3BY6A 3DLAA 3CMAI 1J09A 3OYJA 4LK1F 1W1WE 1U5TC 2XAFA 3L2RA 2V1UA 2RN7A 1WKMA 2L5QA 2A61A 2EJRA 3GLXA 2IW5A 2A5WA 2IS1A 1S6LA 1IV8A 1ZH5A 3S2DJ 1G3WA 2OZ6A 5KHDA 5AIQA 2KFDA 3S93A 1MMNA 2MC3A 4MEXF 1CF7B 1ZRCA 4BQQA 3NARA 4XR6A 4LG3A 4CICA 1APLC 3KCCA 4L9NA 2R7RA 1USTA 2D45A 2NVUB 3OY9A 1FPQA 4JX5A 4MTEA 1Y8RB 5F0CA 2M8EA 2FEZA 1G6NA 2H09A 2FRHA 1R4NB 5JI6A 1E3OC 3O8GA 2KQRA 4I02A 1FYKA 1WSUA 2O61A 1B4AA 4AWXB 4HW0A 2QQ8A 3CD6I 1KGSA 2PG4A 2HZTA 2HQNA 4I76A 1FLIA 4F93B 2VUMJ 3CZ6A 1FJLA 4M9SA 3SDBA 1D1BA 2VI6A 4CGZA 2KRCA 2DW4A 5JFRA 4KFCA 2Y48A 1YW9A 4AU7A 3D1NI 1TWFJ 5K5QA 3TL4X 2FA5A 4NHJA 1TQPA 4EM1A 1BBYA 4X6AJ 2FOWA 2XF7A 4DQ2A 2DQLA 4UVCA 2VC1A 1P92A 2DMUA 3H3VK 1XX5A 3UNGC 2JA2A 3S3NA 4ZZLA 1POGA 1YS6A 1X2MA 1SMTA 4A6DA 1T8IA 4UNOA 2Z1DA 4B44A 4PK4A 2M2EA 4BHBA 4B09A 3BROA 2M0MA 3KP6A 1SC7A 3Q3SA 4XN3A 2A6HF 4EJWA 3S15J 1FX7A 5B1AH 3BR5A 4ZZDA 2Q2EB 2DFHA 2F48A 2EIJH 3KYDB 2XF6A 3QPSA 1Z1DA 4EQQA 2K7LA 3OYBA 4BJTA 2JSCA 2IA0A 3HRSA 4BGDA 3CQZJ 4E7IA 3ZMDA 3DPTA 1MH3A 2HQAA 2R7XA 4FE4A 4AYBA 1LQ1A 4F91B 3WE3A 2W1OA 2ELKA 2HYGD 2PQ8A 2NNNA 2OTLI 3RPUA 3CJQB 4FISA 2E1OA 2DA6A 5LGNA 2XVCA 2E7WA 2R93J 2L01A 3SDGA 3KP7A 1T39A 4X1EA 2HVSA 1N75A 3GLLA 1XSDA 2GM4A 3QOPA 1FOKA 2HS5A 1KYWA 1V55H 4D1QA 4RLFA 5LEJA 3K2AA 2M45A 4A3KJ 1WGXA 2CMPA 3FHNA 5DUKA 3OYFA 4IHXA 4BE0A 2CGPA 3CLOA 4FT8A 3RJPA 2EFOA 5GPCA 1IDYA 2R3SA 2BZTA 4KN7X 2HYFA 4MQVA 4CO8A 3G73A 1JT0A 1FOYA 3BR0A 4MGRA 1JJ6C 1YJNI 4BXFA 1IW7F 2IS6A 1S7AA 1D8JA 4LFUA 2K4JA 1OCZH 4AIKA 3ZPLA 5GADJ 2HXIA 3DKYA 3JRHA 1I1SA 4LITA 3X2QH 1HXDA 3CC2I 1TNSA 4XSZF 4NB5A 3OSGA 3P7NA 2OC6A 4B3XA 4IX7A 3DLLF 4OU0A 2EFNA 4WK8F 3PJRA 2BY0A 2O5RA 1MNEA 5KVRA 4IHVA 1Z3XA 3PQKA 1LDJA 2M30A 4YFXF 4IEJA 4G12A 5FO5A 3OYDA 2P6TA 2L9SA 3D5LA 3ASOH 4U7DA 2A68F 2IT0A 3V7SA 3WTTC 3WU2C 1UHSA 4PSXA 3K2ZA 2W7NA 3WTZA 2GLOA 3H9GA 3I58A 4E7LA 5HLTA 1MMAA 3ZMUA 3MKZA 2KKOA 2D1VA 1GV5A 3WGGA 1PP7U 4LIVA 2P5LC 2WADA 1RR8C 5FKOA 5DV5A 2QYOA 1Y1WJ 1UMQA 3H1CA 4A3BJ 4RS8A 4RB1A 2K3PA 4BDZA 3BCAA 4CYCB 2L9NA 4D7NA 4IZZA 2VPLA 2QA4I 4GYGA 3TGNA 1SD5A 3I71A 3QP5A 1EH6A 1STZA 3JRDA 4N9IA 5F08A 1FWZA 1TW2A 1ETXA 2CUEA 2E1MC 2YPRA 3U21A 4GYIA 3QYBA 2AHQA 2IA1A 2IP2A 1LKXA 1CQTA 3LFUA 3H36A 4NDLA 4AC0A 3ULQB 3AFHA 3I55I 3LSMA 4KICA 3OYGA 2XGXA 1AA7A 1P4AA 1ZTRA 3E5QA 4NC8A 4PJMA 4CZZA 1OCRH 4JP0A 4OIRF 2ME6A 2KIMA 4P55A 2IS4A 3HKZN 4WXHA 4XIDA 3OYMA 1BR2A 3CC7I 1UAAA 3JSPA 5HVQC 2IRFG 1T95A 4IHTA 5EF6A 2HTJA 3CDHA 3HPGA 2CRGA 4ZYDA 2D1HA 3A02A 1AKHB 2QQ9A 1IRZA 2QF7A 4DYCA 2NRAC 5HNHA 3KZZA 2F4MB 2OCCH 4XLPF 1O3SA 5ICEA 4IHYA 4JYKA 4ENNA 3H9JA 2OCEA 2FF4A 1UJ8A 3MFKA 5FFXA 5TISC 1FYLA 5J4VA 4LJZF 2L3DA 4DJAA 2EA2A 3HDDA 2HNHA 2STTA 5DCMB 1XSVA 1IAWA 3MVPA 2CUFA 3F8NA 4UVAA 2LKSA 3SEQA 4OOIA 3HRMA 1B72A 4PJ0C 3WTWC 1OJLA 3K69A 3ZMTA 3KEOA 4BEHA 4HLYA 5D6EA 3I4NJ 4A5NA 3PIOF 1MSEC 1T98A 1LFPA 2E2IJ 1JUSA 2M0CA 2RV8A 3FWEA 5CVUA 5KCMA 2KIFA 4ZTFA 1PUFA 1MMDA 2ZFUA 1IUFA 3CUQC 2BGCA 1D5YA 4IHSA 2PMHA 1OCOH 4FHTA 4S0HB 2CQXA 1DU6A 5FD5A 4XLAA 1JHHA 1H9GA 3GEZA 3HHGA 1OLTA 5HS7A 1OCCH 2W24A 4YRVA 2DOFA 1QO0D 3JSOA 5DD4A 3BJAA 3ABUA 4S04A 3DEEA 4U7BA 3F22A 2CV2A 3QPLA 3OWTA 4IQ4A 4R79A 2E19A 2IA2A 5ILSA 2DOAA 4GO1A 1LDKB 3V42A 1ON1A 2ZC2A 4ZDLA 2NOGA 4P9UA 3ISPA 3HOZJ 4P5OA 3ZQIA 1ORKA 1QVUA 3PFIA 3DEUA 3O8HA 3JAMK 4KJZA 2K9QA 1GDTA 5M5YJ 4F55A 3TMOA 1ZR2A 2EWNA 3SZGA 2HQ5A 4QWQA 1QZZA 4YIFA 2P7CB 3DV8A 3BPVA 4BQNA 1YIJI 3JAMZ 2UWMA 3HOUJ 3F72A 2G7HA 4HF1A 2G9WA 2NXNB 1DPRA 5DUIA 1ZG3A 3QRFF 1UHMA 2XAHA 3ECHA 1O3QA 2V1DA 5KAFC 3GTMJ 3H0DA 3HUGB 1W0TA 1SAXA 3PM1A 4JX6A 5EZHA 3HG9A 3PUFA 3L1PA 3TP3A 1XG1A 1XGOA 3PFYA 3BC8A 4WCGA 2DDBA 2XGDA 1KU2A 1FSHA 3RPQA 1JHFA 4HG2A 3G1MA 2HGCA 3OR1C 2VKVA 2P5VA 3VB2A 2JUCA 3DPLC 1YX3A 3G71I 3GTGJ 2DA5A 2M3AA 3FZVA 4NBQA 1K78B 2QWWA 2KLOA 4XKCA 3HTUA 2L7MP 4PZJA 3S2HJ 3MKYB 3GXOA 1W36D 3MKLA 4B1RA 1FMVA 2GOMA 1BM9A 1H88C 3QYEA 4BXUA 3RI4A 1FTTA 2B9SA 2Z99A 3K70C 2JK3A 3LA2A 5J1RA 4BBSJ 3D0SA 2QGUA 1P7IA 4G6QA 2HOTA 2KRFA 4HSTA 2XB5A 1X1AA 3C2HA 1O57A 3WTUC 4DBRA 4ESBA 1ON2A 3ZR8X 5DYMA 3OYNA 1RESA 4Y15A 4I2OA 3L7WA 3ZQHA 3HGYA 2IAIA 2XKOA 1R22A 4II3A 4DNCA 3F8MA 1NHAA 4HDVA 2PJRA 2K3FA 1XN7A 3CJTB 2HTSA 3HM5A 5CLSA 2WB1A 4G8XA 5CPRB 5K7ZA 1J9IA 3WU1B 4A5MA 2L0KA 5GAHJ 1R36A 1BI0A 1Z6RA 3V7CA 1T0FC 1R6RA 4KIGA 1T0FA 3F3XA 3OR2C 2MH2A 2JN6A 2Y69H 5HODA 2W25A 3F21A 4MHGA 2Y0SA 5CVIA 3GX4X 2NS0A 2P8TA 4ENKA 1VQOI 4LGWA 1MW7A 5FKNA 2HVRA 3M4OJ 3JRGA 2E35A 1G3YA 5IPAA 1VQ5I 5LHHA 5IYCJ 2TRTA 5C4XJ 1HOMA 4M9ZA 1U9NA 3E6MA 3CMMA 5GTHC 2QSFX 3I3LA 3ZQQA 1K79A 3JRAA 3GFLA 1T33A 2H6CA 2ZB9A 2ZMEB 4ABZA 2LH9A 4ENJA 3H92A 4E7ZA 2GZWA 2L7ZA 2BHZA 3FXLA 3MD2A 5TRDA 2WAEA 1QGPA 3BG7A 3NWSA 2HZDA 3FXJA 4A0XA 4H0EA 1A5JA 4XN0A 2PJRB 1I27A 2M1BA 4YIRX 4RAGA 2BV6A 3ABKH 5D6FA 3A1YA 2PX9A 4C2MJ 3ZQFA 1LDDA 3QP6A 4Q5SF 3GBGA 5LRSA 1JKRC 1J7KA 2XAGA 1QZEA 1UFMA 2K27A 1IRFA 3G6EI 4GFBA 1BI3A 1JE8A 3KFWX 3CF5F 3HOYJ 1R5HA 1FNNA 1SD7A 3RZOJ 1EH7A 5D8KB 2HXOA 3KP3A 1ZRFA 1TTYA 2P4WA 2ZXJA 2AS5F 1FC3A 1Y8QB 4MFDA 4B3AA 2VOOA 3BZKA 3T5XA 1A35A 4K2EA 2YSRA 4XKBA 5FRMA 3ZOBA 1S5LC 2JVGA 3EUKL 1NH3A 2M34A 4LMYA 2PLYA 3HOWJ 2DA2A 4E7JA 4G7ZF 2BBYA 5M3FJ 2VJIA 2K9MA 2JA8J 2ZMEC 3LSIA 1N25A 4MO7A 2ZMEA 1ZAOA 4HNVA 4M72A 2JA6J 3V8JA 2V4JC 2CG4A 5D5VB 4JK1X 2NS7A 3IRRA 1VZ0A 1K7AA 3EQLF 2DYRH 5K7HA 4NQWB 1I6HJ 1YYVA 1G3TA 3CTAA 1DP7P 4RM3A 3JTHA 2GAUA 4DYRA 5D5UB 5E8IA 2W84A 1A6QA 4BACA 2KRHA 2BW3B 5J6XA 4Y52J 2RREA 4W1UA 4E6KG 4M6VA 1FZPB 3K4CA 4A0ZA 1KQ8A 3FHZA 2E2JJ 3P9IA 4N9HA 1V4RA 4GCVA 1XDSA 5J8CA 5GPAA 1F1ZA 3GFIA 5LD2C 3DPUA 2WB1N 3LSRA 3B02A 2OTJI 2ZXIA 4DZJA 4YFNF 3VDXA 2M8GX 4XLCA 2DXIA 2Q1ZB 2YU9J 2L7FP 1YX5A 2V6CA 5F1RA 1VNDA 4PJNA 4YEJA 1XGNA 4GDFA 2JSPA 4GRIA 3A01B 2XSJC 4IQJA 2ESNA 1YS7A 4HQMA 2QSHX 3QYFA 2FNAA 1IF1A 2J5PA 3K4KA 1BJZA 2XGEA 3OSFA 1YRNA 3KLOA 3IKVA 1G59A 2LD5A 2DJNA 2FBIA 2HYJA 3VEPA 2ISYA 1I3AA 2BY3A 3IH3A 3I64A 4A3EJ 1A04A 2X1DA 3BOQA 4CCJA 3HRTA 1IN5A 2K5CA 4CYDA 2XB0X 3ZN0A 3F6OA 4AVZA 4XRSA 2N8GA 4A12A 1MSFC 2JZYA 2X6XA 4KIBA 3OIQA 2LC2A 2FBHA 5BS6A 1P7JA 1S9HA 2M4KA 4MTDA 3B6AA 1ETKA 3DQVC 2R7FA 4CSWA 2E71A 5EG0B 1SVOA 1YE9A 1Z91A 2IPQX 1MDMB 3PNTA 2VASA 1DU0A 2F5EA 1WQ2A 2IXSA 4C3JJ 4ZYAA 5ILVA 2R7UA 2EV6A 5GAGJ 4CHUA 4AM3A 5L3DA 1FTZA 4BBRJ 5J4YA 1WJFA 1TWHJ 2M7BA 4BUPA 1H0MA 3E6DA 2G0EA 3FXMA 2Z3YA 4E7SA 1W7PA 2L4MA 2KISA 4G9YA 4CZCA 1UG2A 3TDUC 1V5FA 1B8IA 5JR3A 5D5XB 4CCNA 3OIPA 3H5RA 3IWFA 1XDUA 1WJBA 4HBLA 2DDAA 1R5ID 4AIDA 1F43A 4MLOA 4CCLA 4ESFA 3ABMH 1VI0A 2H6BA 1AHDP 2DT6A 1V3FA 4UV8A 4XSXF 1WJCA 3IP4B 2WY7Q 1T08B 2X4HA 1D0XA 3ASNH 4BQOA 2HWVA 4M3EA 4O6JA 2ME0A 3HEFA 5J40A 5FJ8J 3MKWB 2K86A 4PFOA 3M3YJ 4IXAA 2W82A 3MZHA 2HDDA 2DBBA 1Y6IA 1J2XA 3F0CA 1R5GA 4MFEA 3CCMI 3DWLE 4Z6YA 4ESJA 1XS9A 1IN8A 2CW0F 1OPCA 3K0LA 2CFXA 1LE8B 4BE2A 1U0JA 2FNPA 5KAIC 3QPTA 1ITYA 2BW3A 4G7HF 1HBXG 2KMUA 3C2BA 1D0ZA 1KZHA 1A31A 4OIPF 1FBQA 2Q2EA 1OCPA 4U87A 5FLVA 4BHCA 1RKTA 3K1PA 5L3EA 3TBIA 2DA4A 3JW4A 5IP9J 1WH7A 4C9YA 3LQQA 4M3DA 5ED4A 3U1KA 3KZYA 4PJLA 4Q48A 4PDKA 3SHFA 1IN4A 3PQJA 3KZIC 3QOEA 2RVCA 1L3LA 2Y2ZA 1B9MA 3RIRA 4PCQA 5LFAA 3A01A 5A2QZ 2KJBA 3FDYA 2CO5A 3PL8A 2WV1A 4HNTA 3J7ZI 2X0LA 1WFXA 1XMXA 1X4OA 2D2WA 3S2WA 3OYKA 5E3OA 4OMYA 1LFUP 2F6CA 4AYBN 4XRMA 3KP2A 5JLXA 1DQUA 1OKRA 3QODA 1R9TJ 2E2HJ 3A0HC 5EGOB 1JGSA 3TO7A 4M3GA 2CWEA 1IRGA 1E3PA 2CV1A 2GIVA 4F52A 3I53A 1MBKA 3OIOA 2ZJRF 1QU3A 2MFZA 4OINF 1QQIA 1HKSA 4HX4A 1QNTA 4Q4ZF 2E5ZA 2KPMA 1WZ2A 3TOAA 1SVLA 2Y75A 1OQYA 3CUQB 1EF4A 3KE2A 2P0WA 4XLNF 1G4DA 2E1CA 2AO9A 4G7OF 2DA7A 1TW3A 1BN5A 3NAUA 5CVJA 1YW8A 3BLYA 3LNQA 1FBSA 1ZGJA 3ABTA 4D9JA 3JRBA 1FIAA 3OS2A 3BTJA 3CJRB 5FD6A 2VC0A 5A2QK 2QKLB 2E34A 3J81K 3FM5A 1VQPI 4PGGA 3TW7A 2V1XA 2VN2A 4RAYA 4G6DA 3JREA 1JXSA 3BPXA 5EYRA 3HKZA 4QLCU 1R23A 5F64A 3BJ6A 4PSWA 4G6TB 3IAM2 2GXAA 1U5TB 3E3VA 4J00A 1JJ8C 1GXQA 3I54A 2R5ZA 3CMEI 3Q9SA 3HUGA 2IGNA 1G8XA 3RKYA 1HKQA 1SFUA 2W48A 4XBFA 4II2A 1X3UA 3JTGA 2IJLA 3W6VA 2JA5J 4KYWA 2FQ3A 2R7TA 1MBFA 1JUMA 2JJ7A 3HSEA 1A36A 1ONVA 2PFBA 2MSYA 3QU3A 3QWLA 1B72B 1V5EA 1R1TA 2CUJA 3AG3H 4XL9A 4HV6A 3WTYC 1U5TA 2L9RA 2FBKA 3LL7A 1WH5A 2R7OA 3WG7H 3FIWA 2QENA 2ACJA 3HSRA 4J19A 3GYHX 1JUPA 2ZJ2A 3HZJA 4LLGF 4ASNA 1IJWC 2DTRA 2IBDA 1PUFB 4BQAA 1XC5A 1ZG5A 3ML6A 2DYSH 5J1UA 1MZBA 2PMZN 2KDZA 3DTKA 4XLEA 2E60A 4R8HA 4NC7A 1ZG1A 3DKXA 2QKMB 2E1MB 5FLXZ 3HRUA 2XRLA 3C7JA 4FASD 1OYWA 3ABLH 1J59A 3GW2A 1Q1VA 1LVAA 2KJCA 2X9DA 3E1SA 1RUOA 1XGMA 3C18A 3GMEA 2H94A 5CKTA 4UUVA 1XGSA 2IEKA 1J75A 5ICFA 1K4SA 4XICA 2XF5A 2ID3A 4HYEA 1K83J 2VB6A 2R7SA 1QRYA 2VLAA 1DGWY 3FMRA 3JRCA 4UUTA 3ZQ7A 3MQ0A 4KN4X 4JOMA 3OYLA 2DFIA 4IKFA 2V26A 1USSA 5ERIA 4L9JA 2VBXA 3WHCA 2CJJA 3L2VA 2FMLA 1PJRA 2VBWA 2ZSIB 2GIZA 3CO7C 3RTRA 3VYTB 3S16J 2L2OA 3VYRB 2I5UA 2LBFB 4WF2A 2ADUA 3L09A 2O03A 1XMKA 3T8TA 1BIBA 1MIJA 9ANTA 4EV0A 3CESA 2O3FA 4JQFA 2PMZA 4CYCA 2LY1A 4AD9A 2YX7A 3K4MA 1AWCA 3R4KA 2VJ5A 1HW5A 1SAUA 2ZKZA 3VPRA 3R6SA 2LG4A 3EUHA 4ZH4F 5J8FA 5IY5H 1I6XA 4ZTJA 1IDZA 2PBIA 2VJ4A 4BEHB 5ILUA 3E7LA 2QM3A 5ICCA 3H35A 4LLNA 5FRNA 3IWZA 5E3LA 4AIJA 1QPIA 4I01A 1Z9CA 2XASA 4NUBA 3REOA 5EDNA 1RRJA 4GGGA 1T2KA 4LG0A 3AG2H 3FK6A 2CH0A 3G1OA 5L3GA 1TBXA 3L2CA 4I98B 4A6EA 1WJDA 4CDGA 3HOVJ 1ETVA 5LHGA 4HPQA 2R5ZB 4NC6A 1K78A 3CDIA 2LY2A 2ZO4A 3JRIA 4FTHA 1N78A 1MJBA 3MN2A 1TP4A 3CO6C 3DU5A 4UY8I 3ZMVA 1JKQC 3G2BA 2VXZA 1WPKA 2RAEA 5E3NA 2NAZA 4LD5A 2MGQA 2Y31A 3F8FA 2PMUA 3CP2A 4L18B 3RKWA 1K4TA 5C44J 2B7EA 2VXDA 4A3MJ 2OV7A 1ZLKA 3QPHA 2ZXWH 3MZ8A 2RNGA 3K4BA 1KQ0A 4QSHA 5IYDJ 2DI3A 4Y33A 3W2VA 1LB2A 3QQAA 4EATA 5DCMA 1SD6A 3HOSA 2KIUA 3WODF 2VQHA 1Z05A 3H0GJ 3B73A 4I0BA 1HDDC 3U9GA 2LMDA 1MKMA 3LAPA 1X3WB 4PJJA 1LPQA 4E7HA 1S29A 1Z0XA 1E3HA 3HJEA 3L2UA 3DBHB 4RB0A 1PUEE 4KNYA 2XSDC 5HOOA 3E97A 2FX0A 2IGOA 2JVHA 3OYEA 4O5VA 2LF8A 3TO9A 4XOTA 3VODA 3U2RA 3ESWB 4EM2A 3E6CC 2JA7J 3H9QA 3M8JA 5DTDA 3NWTA 2A6TA 3WGIA 2K4BA 1B9NA 4EJOA 4GXOA 1YG2A 2DCEA 2QBYB 4RGUA 3S17J 3L00A 4HX8A 4YG2F 4OMZA 3ZQCA 2QUFA 5F1JA 2R7QA 3DFGA 3E5UA 3WGHA 4QTRA 4UXNA 5HDKA 4Y17A 3BT9A 2W4SA 1MGTA 1I3QJ 2RKHA 4L5JA 5J3LA 3KEYA 5GAEJ 2DU9A 3H3ZA 4KUMA 3BTCA 2VKEA 5E8GA 2Y30A 1LEBA 2Y9ZA 5D5WB 2JTVA 4C2UA 5FKLA 2WWYA 2LP0A 3JR9A 1RC9A 4EMSA 2W00A 4KMUX 4E70A 1Z7LA 4RM2A 1HW1A 1ZLJA 2M87A 1QHGA 3K6GA 4Y3OA 1MMSA 4TV7A 5EEAA 1E17A 1ZELA 4FX4A 2H27A 3O3KA 1YW7A 1SFEA 2KIQA 1MJAA 2NVYJ 2ISZA 1F36A 2LOOA 2X6YA 3OS0A 4LG0B 3G3ZA 2HFHA 3LSGA 1S8NA 4RGXA 1ULYA 2F5FA 3SYTA 2GQQA 1LNWA 4HSRA 5LRRA 1SEUA 5BOXA 3CP8A 5DM7F 1MBJA 4B4CA 1MNDA 3A4CA 2HVQA 5JHUA 4KISA 3K4JA 5FROA 1RNLA 2MA3A 2EZHA 2K85A 2V9KA 4YFKF 2LNBA 2X6OA 2H8RA 5L3CA 1IV6A 1QHHD 2VKHA 4FQGA 4HA8A 3HC7A 1TWAJ 2P6SA 4F3QA 3S1MJ 3V8LA 2RQPA 3T1BA 2O0YA 3DF8A 5H6RA 2ZFWA 2GWRA 4U0VA 2X48A 2BEOA 3OYIA 3RKXA 1TQIA 3M07A 1HDPA 1I5ZA 3N05A 5KNLA 4HOBA 2KT0A 3N4MA 2WTEA 4I6ZA 2EH3A 5K5OA 2HKXA 4ZDPA 2K9NA 1YJWI 4I99C 3CCJI 1VQ4I 2ZNZA 1T38A 4F92B 1R00A 2V1NA 2QVOA 3PIPF 2AXLA 4AIHA 5E1XA 4U88A 3W2WA 2R5YB 4BNCA 4HNUA 5TGTA 1YLFA 5LEKA 2XKPA 5F0FA 1BL0A 3F8BA 1B59A 2AQEA 3F23A 3HTSB 1V5GA 4EJUA 1HSTA 3O6BB 4M71A 5EEGA 5EGOA 2ZCWA 2VPRA 3IAS2 5HNFA 1HF0A 3DU6A 3EUAA 1ZHFA 4I7HA 3CF2A 1HQCA 1TT0A 1LJ9A 2DT5A 3S32A 2LBFA 2K9LA 3IUOA 1X3ZB 3LAJA 3TQNA 2VODA 4A93J 1CGPA 4LOCA 5CVVA 2OD5A 1BI1A 2YUSA 4ANJA 4PFPA 3Q0VA 2MYSA 2EZKA 2NVXJ 3ZCOA 4C2TA 4HF0A 1ZGAA 1SD4A 4XQFA 1TZLA 1IG7A 2GOXB 2O9LA 3U1DA 4HV5A 3K1NA 3J80Z 5FKMA 1IO2A 3LQRA 1YHQI 1Y39A 2MG4A 2LTPA 3KIOA 4P1WA 3I4MJ 2VKDA 4OAZA 1OCTC 2VQCA 2EFPA 2JQ7A 2JUGA 1FY7A 1QZYA 2JRTA 3I4PA 1DUXC 2L02A 2OU2A 3R60A 2EZLA 4HQEA 1LEAA 4HRIA 2CUZA 5IP7J 3I56I 3T8RA 4DYQA 2TDXA 4IRGA 1SVMA 1FMWA 1RUNA 3BG9A 1X1CA 2IGMA 2FUG2 2VT3A 5BNGA 1W5SA 5E18F 2HR3A 3ZXSA 1YQAA 2XAQA 1KONA 2DA3A 2HKOA 2ZXHA 1MMGA 4IO9F 3PO2J 2H8WA 3N97A 2V79A 1D8KA 1S7OA 1JI8A 1VQ7I 2BE5F 3SZPA 5DDGA 2Z33A 2EPFA 5CVRA 5FB2A 1P4XA 1U9OA 1ZYRF 3R61A 3W6JB 1FYMA 1BC7C 1E2XA 4I09A 3CCLI 1O3RA 4M3FA 1ETWA 2X51A 3NQOA 5EEHA 2DLLA 1DP3A 1K6OA 1U8RA 2M9HA 2BVMA 1L0OC 2E7XA 1NG7A 4O3MA 4I0AA 3ZMZA 1MJ9A 5GTIC 1HW2A 1BJAA 2Y0SN 4ZYEA 2DTZA 4D5CA 2A5YB 1V54H 1KA8A 3DKWA 2R4GA 1OISA 1U3EM 4Y7NJ 2M5WA 1SFKA 1BW5A 3KYLA 2KDOA 4XMYA 5HLIA 1UHWA 4C30A 4EGYA 1FSEA 1HSJA 5LBQA 3PSFA 2EIMH 3EYIA 2CS3A 1GLNA 2ETHA 3RQ4A 3FXUA 2VE9A 3FM3A 2PN6A 3JCUC 1U2WA 3GO5A 2DN0A 3AL0B 1W5CC 3BCBA 1K61A 2EZIA 1X19A 2F5DA 3E6BA 3EETA 2MH9A 1GUUA 2QZ8A 2EFQA 2MW8A 3LSKA 2ELJA 3H3UA 3IHUA 3E0JB 3LFKA 2JRMA 2F4OB 3GWZA 5K1YA 2V6EA 4B47A 1KQ9A 5HDGA 3CCUI 1NK3P 2R7ZJ 1UCRA 2ICWG 2O8XA 5F04A 1UZCA 3NRVA 1TLHB 4BYYA 2DA1A 2ESHA 1MBHA 1Q1HA 2V9VA 2X85A 1F4KA 1Y0UA 3ZQLA 4S05A 5D4RA 3FXOA 2MABA 4A3DJ 2QEXI 3RYRA 4IJAA 2ID6A 4P9FA 4D0PA 1GHCA 2LLKA 4Y4RA 3HL2A 1MD0A 1BR4A 3CCYA 3OV8A 3VYSB 1DDNA 2IVMA 5IT3A 2Q8KA 4IOAF 3FKJA 3I5UA 5BPDA 3A03A 4HDUA 5AONA 1VF9A 3VSKA 3MAJA 3VYUB 1ZK8A 1DGRM 2UXNA 2VIXA 3OL3A 2XIGA 5H6QA 2HDWA 5LHIA 5M5WJ 3GCMA 3RQIA 2X1CA 1OR7A 5EG0A 2COBA 3CCEI 3SJMA 3OMYA 4XLFA 3L9FA 3M1EA 4YIIA 2XPWA 2F5CA 3CCVI 5EZGA 2QQAA 4BJ6C 4ON0A 2AXTC 4RMNA 1IXSB 1D1CA 3RKQA 2BY1A 1P4WA 3GZNB 1IN6A 4BKXA 4RBOA 3WU0A 1BA5A 2FQ4A 3S3OA 4EEFG 1KU3A 4E7KA 4KMFA 2EQRA 3DP7A 3V7RA 4ZYHA 5J47A 1TT5B 3UKGA 1KYZA 2ZSHB 5IYBJ 2W85A 1AOYA 2FU4A 1JT6A 2QSGX 2EV5A 4EJVA 1TQMA 1QA6A 2XUBA 2NOJB 3KYCB 2LKPA 4WX9A 3GTPJ 2JPCA 2RDPA 2GA1A 3FXQA 2R92J 3LOCA 2P81A 5H20A 3TO6A 5B66C 1H89C 4OIOF 3K10A 1ETOA 5FKKA 4G94A 1LVKA 4N4OB 4V19K 2OF7A 4C3HJ 2NS8A 2LRDA 1W36C 1RKWA 2K02A 2OBPA 3PUBA 3LA7A 3D5RC 3OYAA 2ELHA 1C0WA 2CSOA 1S72I 1ERDA 3K70D 1WCMJ 2VJJA 4CA0A 4XKWA 3RYPA 3S3MA 1ZARA 2R0QC 3W6KB 2E5NA 4BU2A 3CJNA 1TWGJ 3FF5A 4UVBA 1GXPA 1SMYF 2LVSA 2DFEA 5B1BH 2XHKA 3ZQGA 3Q0UA 2ECBA 2OQGA 3T0YA 5M5XJ 4BY1J 1R4MB 3BTIA 1OMIA 3WTXC 1WRJA 3HIFA 2UXXA 2M7AA 1DPUA 5DS9A 3GTOJ 4HZFA 1XCVA 5EJCA 2BHYA 4DOZA 1MBEA 4H4KC 2VOPA 3DTIA 4A69C 4CCOA 1J5YA 5E79C 4LK0F 4ZC3A 1R1VA 1XCBA 3KEQA 1IXCA 1FP1D 3J7YJ 1YFHA 1I39A 1YO5C 1HCRA 1JTXA 1OFCX 1U78A 1ZQ3P 4MEYF 3VSLA 3LWFA 1YI2I 3B6CA 5FLMJ 1FEXA 3RSNA 3ERMA 2HQRA 1G2HA 3BR6A 3TOBA 1RR7A 1XMAA 5IT9Z 2DMPA 2OA4A 2FD5A 4BH9A 1P9QC 2JPBA 4ZDOA 4E4HA 3CDLA 3M9AA 1Y56A 3EYYA 3GUDA 3P9CA 2UUZA 4HF2A 1VTNC 3BWGA 4FX0A 4BAYA 4CCMA 3GTJJ 3CCQI 3WTVC 3KP5A 2DO7A 2NVTJ 3HXLA 2WY8Q 2XRNA 4A3CJ 1FBUA 2VBZA 2BXYA 2MLKA 3SXYA 4RA2A 2XAUA 3CUOA 2EIKH 3GFMA 4XORA 4KA4A 3MZYA 3O2PE 5LGUA 5E17F 1X1DA 4DGWB 3TDZC 1REPC 3K4NA 4XRFA 2VQLA 1MNMC 1P2FA 4L0ZB 2LF7A 2CW8A 1EKEA 4NNJA 1T6SA 3IKTA 3JRFA 5TJJA 1NG6A 3OOUA 4LIUA 1XB4A 4CH7A 4KITB 2F5VA 3PNYA 4IF4A 2BOLA 3FK7A 4N0BA 3HSFA 3GTQJ 5K7FA 4AUXA 3CUQA 4F7ZA 4QIWN 3KLNA 3LMMA 5E1ZB 5BPIA 1R49A 4IHWA 4OAYA 4EGZA 3VOEA 4CXFA 2JWTA 1XTAA 2V9PA 3KPHA 4IVNA 2R7WA 4Q47A 3PNVA 2RC4A 5L3BA 1LUJB 3RCOA 4UUSA 1BR1A 4MNUA 1EH8A 3ELKA 3A2KA 3M1CA 3TP0A 1ODDA 2YS9A 3GVAA 2HEOA 1VQ9I 3M8EA 3BDDA 2YR2A 3K1MA 1YJ9I 4LB6B 1IRXA 1S3JA 2WA0A 1XPXA 1FOWA 1OYIA 1BOAA 5B5EC 1HKTA 3ECOA 4A3GJ 3R0AA 2DPDA 2B0LA 3BR3A 5H2FC 4B8XA 4RAFA 2L54A 1ZKGA 2VQGA 5LLQA 3MEXA 5J1YA 1IC8A 3OS1A 2Y0MA 3DBLB 2L7KA 3LSHA 1YRNB 4AVPA 2X6WA 2STWA 4WWCA 2QBYA 2OUMA 1XSXA 4WXDA 1H8AC 3GFJA 3GZ6A 1BC8C 1ZRDA 1EJ9A 3LSTA 3DXJF 1O3TA 2DOEA 1Z67A 3IL2A 4DIQA 4BY7J 2Q0OA 3IH4A 5GP9A 2R7VA 5BQTA 2FJ1A 3V4GA 2XDVA 1HC8A 3J80K 1LFBA 2Z9OA 2B63J 3SQNA 2QQBA 1KU9A 4RGRA 3SFZA 2GBYA 3MWMA 4IPAA 2WBMA 2VONA 1X2NA 2FOKA 2LSOA 2WC2A 2WAQA 1HA8A 4XLHA 3COAC 1OYYA 5F27A 2MC4A 4UB6C 4M3BA 1F5TA 2MBFA 2UV1A 2IS2A 5ICGA 3FMQA 3S1QJ 2VT2A 1AU7A 2EFWA 1VQKI 2G7UA 1XD7A 5IP6A 5DM6F 4RAZA 4XK4A 2VE8A 3GTKJ 3K7AJ 1J0RA 2OJED 3Q9VA 1MBGA 3WHBA 1B6AA 3S8PA 3LSPA 3FXRA 2KL4A 2DMQA 2OPTA 1GVDA 1WI9A 2LFBA 3HB9A 3FMSA 3BZCA 4BDYA 2XC7A 4CCKA 3QAHA 1FT9A 2DK5A 2HPIA 3BG6A 4ZYGA 4XOPA 2DFFA 2UZKA 4LB5A 2LK2A 1ZR4A 1GT0C 2YU3A 1UELB 1RIOH 1VQNI 1R1UA 5FGMA 1YOVB 2A3SA 3BZ6A 4RB2C 1YIOA 1A6IA 4UHTA 3HGGA 3BR1A 4QPOA 3J81Z 2E36A 1VQLI 4KT6A 4EVIA 1IZ1A 2O8KA 4V2FA 1ENHA 3R0JA 5JHFA 4A3LJ 4RLQA 4KT5C 4L5IA 5LGTA 1KU7A 1BW6A 3FBIB 2FE3A 3W3CA 1W7PD 3IH2A 4B43A 3Q0WA 1D1AA 3HYIA 3KP4A 1K6YA 1WI3A 2E1NA 1G3SA 1UG0A 2LR8A 3HBLA 4M6YA 4XONA 4RDUA 2XROA 1Y1VJ 2H1KA 2DPUA 2XPVA 4BE1A 4HEA2 2CW7A 3Q5FA 3ZMSA 5IOYA 3CMYA 2WAQN 5IOZA 3HOXJ 3EUHC 5BMZA 5JVTA 3L2WA 2QCOA 3IV5A 1U8BA 1IN7A 3W2AA 4EM0B 5HDNA 4M73A 3J7AY 1M1EB 2CV0A 4EJTA 4R1HA 2CFOA 2PJPA 2C6YA 1EA3A 5DD8A 3RPUD 1W0UA 3I59A 2CQNA 2A69F 5CQGA 2HOSA 2ECCA 1SFXA 2K40A 3K4LA 4M74A 4ITVA 4XM3A 5CQEA 4M6XA 5M3MJ 3V8KA 1W7PB 1Y0NA 1B8IB 2KZVA 2O7OA 3EPZA 2DODA 2P5KA 4IRIA 3ZP5A 4P96A 2DMTA 5F6FA 1LE8A 2FXAA 4D7MA 4ENMA 3DEWA 4MIMA 1OR7C 3EDPA 4BJ5C 1ETYA 1W4MA 4WXCA 2EA4A 3CCSI 3D5SC 4DZPA 1P6RA 1WJ5A 3M8FA 3HOTA 3DBRB 2P7VB 1I1GA 1O7LA 4IRHA 1QPMA 3ERED 2HPMA 3LA3A 3C1DA 4FCYA 4V2GA 2FMYA 3WG9A 4ZJZA 2NYXA 4HAMA 3OYHA 4RGSA 3AAFA 1YITI 2EB7A 2OZUA 3M7GA 1SFOJ 1VFCA 3AKZA 2CQKA 2HOAA 4A0YA 4KDPA 1PYVA 4LLLA 3TKYA 2RNJA 2CYYA 4XNFA 2GA2A 4FE7A 2A05A 1NK2P 2Z5UA 2MD5A 2EILH 2R7DA 1W5TA 1RZ4A 4Z2YA 3BP8A 3I59B 3SFIA 1WJAA 3F9KA 3FX3A 4L9TA 3RZDJ 5FFZA 3MMYB 2LY9A 3DTEA 3KETA 1H9TA 3I0TA 3GZ5A 2Z2SB 3HHHA 3KX2A 2PEXA 3TW6A 2W57A 1IUYA 2YX4A 4DW6A 4BL0B 3PO3J 1U6GA 1ZN2A 5C3EJ 1BIAA 5CJ9A 2DQRA 1RPWA 3CCRI 1X58A 2LREA 4W97A 3SZTA 2DMNA 4PUSA 1JGGA 1GV2A 3A0BC 3F6VA 2LKXA 1Z7UA 5L3FA 3DCFA 4FETA 5C4JJ 1VQMI 2F4IA 2XAJA 3VWBA 2WV0A 2OQRA 1Z77A 4BXXJ 3FXKA 1JKPC 5E20A 4UB8C 2ZJPF 2L9VA 4IL6C 5KK1A 5HLHA 1IXRC 1WVRA 2LDUA 1R71A 5DCFA 3P9KA 4U0WA 5F0HA 2COMA 1RETA 2R5YA 2MD0A 3IRQA 3FISA 2TCTA 3BR2A 1UB9A 2HI3A 4XKVA 1ACIA 2GXGA 2RQQA 1X4PA 4A3IJ 3E5XA 4C3IJ 2HOEA 2BY2A 3FKIJ 1AKHA 3J7AO 1TWCJ 1QBJA 2CU7A 4B48A 1PP8F 1D0YA 1Z21A 1QVTA 4BHPA 2ZBKA 3G1LA 2OAZA 3BG3A 4J01A 2EINH 1O4XA 5HS9A 5E3MA 2GXBA 4QPQA 1O7FA 1YTYA 2KZGA 4M9XA 3CC4I 2AQFA 4A3JJ 3AL0C 2DT7B 1WHUA
chains in the Genus database with same CATH topology
1RI7A 3F8CA 3VFZA 3OOPA 1PDNC 2O6GE 2EK5A 3GF2A 4ETSA 2A6EF 4Y13A 2HDCA 3C3WA 2VBYA 4NQWA 4HX7A 2PI0A 2QLZA 2BYVE 2L4AA 5HS8A 4OIQF 1WWXA 4U0YA 5E1WA 2A07F 2XV4S 5IT9K 2ZNYA 1Z6TA 5K5RA 3QU6A 2FSWA 1FP2A 4JBAA 4UV9A 4L0YB 1EV7A 4PGHA 5HLGA 5AIPA 4MQ9F 3WE2A 1BI2A 2F2EA 4HLXA 1R58A 1ZREA 5D8LB 1MDMA 5D4SA 1CF7A 1D5VA 3NEUA 2NNYA 1GVJA 2DAOA 1D3YA 5DEQA 2J5OA 6PAXA 4L9VA 3IC7A 1R7JA 1F9NA 2JT1A 3K9TA 2EV0A 3ZN1A 3BJOA 2MLGA 4KIFA 3WTSC 3MCZA 4RB3C 3RDIA 4A2UA 5FLXK 1TNTA 2DK8A 2RGVA 3ROUA 1B1BA 5CYVA 3BY6A 4LK1F 1U5TC 2XAFA 2V1UA 2RN7A 1WKMA 2A61A 2EJRA 3GLXA 2IW5A 1S6LA 1ZH5A 1G3WA 2OZ6A 5AIQA 2MC3A 4MEXF 1CF7B 1ZRCA 4CICA 3KCCA 4L9NA 1USTA 2D45A 1FPQA 4MTEA 2M8EA 2FEZA 1G6NA 2H09A 2FRHA 5JI6A 4I02A 1FYKA 1WSUA 2O61A 1B4AA 4AWXB 4HW0A 1KGSA 2PG4A 2HZTA 2HQNA 1FLIA 4M9SA 4CGZA 2DW4A 5JFRA 4KFCA 2Y48A 1YW9A 5K5QA 2FA5A 4NHJA 1TQPA 4EM1A 1BBYA 4DQ2A 2DQLA 4UVCA 2VC1A 1P92A 4ZZLA 1YS6A 1SMTA 4A6DA 4UNOA 4BHBA 4B09A 3BROA 3KP6A 2A6HF 4EJWA 1FX7A 4ZZDA 4EQQA 1Z1DA 2K7LA 2JSCA 2IA0A 3HRSA 3ZMDA 3DPTA 1LQ1A 3WE3A 2HYGD 2PQ8A 2NNNA 3RPUA 5LGNA 2XVCA 2E7WA 2L01A 3KP7A 1T39A 1XSDA 3QOPA 1FOKA 2HS5A 1KYWA 5LEJA 2M45A 5DUKA 2CGPA 3CLOA 4FT8A 3RJPA 2EFOA 2R3SA 4KN7X 4MQVA 3G73A 2HYFA 4CO8A 4MGRA 1IW7F 1D8JA 1S7AA 4LFUA 2K4JA 4AIKA 3ZPLA 1I1SA 1HXDA 1TNSA 4XSZF 4NB5A 3P7NA 4OU0A 2EFNA 4WK8F 5KVRA 3PQKA 1LDJA 2M30A 4YFXF 5FO5A 2P6TA 3D5LA 4U7DA 2A68F 2IT0A 3V7SA 3WTTC 3K2ZA 3WTZA 3I58A 3ZMUA 2KKOA 2D1VA 3WGGA 1PP7U 2P5LC 5DV5A 2QYOA 4RS8A 4RB1A 4GYGA 3TGNA 1SD5A 3I71A 3QP5A 1EH6A 1STZA 4N9IA 1FWZA 1TW2A 2YPRA 4GYIA 2IA1A 2IP2A 3ULQB 4KICA 2XGXA 1P4AA 3E5QA 4CZZA 4OIRF 2KIMA 4P55A 4WXHA 3JSPA 5HVQC 2IRFG 4IHTA 2HTJA 3CDHA 4ZYDA 2D1HA 2QQ9A 2NRAC 3KZZA 4XLPF 1O3SA 5ICEA 4ENNA 2FF4A 3MFKA 5FFXA 1FYLA 4LJZF 2L3DA 2EA2A 2STTA 5DCMB 1XSVA 1IAWA 3F8NA 4UVAA 4OOIA 3HRMA 3WTWC 3K69A 3ZMTA 3KEOA 4HLYA 5D6EA 4A5NA 1T98A 2RV8A 3FWEA 5CVUA 2KIFA 3CUQC 2BGCA 4IHSA 2PMHA 4FHTA 5FD5A 1JHHA 1H9GA 3GEZA 3HHGA 5HS7A 2W24A 1QO0D 3JSOA 5DD4A 3BJAA 3ABUA 4S04A 4U7BA 3F22A 4R79A 2IA2A 5ILSA 4GO1A 1LDKB 1ON1A 4P9UA 3ISPA 4P5OA 3PFIA 3DEUA 3JAMK 2EWNA 4QWQA 1QZZA 4YIFA 2P7CB 3DV8A 3BPVA 3JAMZ 2UWMA 3F72A 2G7HA 4HF1A 2G9WA 5DUIA 1DPRA 3QRFF 1ZG3A 1UHMA 2XAHA 1O3QA 3ECHA 2V1DA 1SAXA 1XGOA 4WCGA 1FSHA 1KU2A 3RPQA 1JHFA 2HGCA 3VB2A 2P5VA 3DPLC 3FZVA 1K78B 2QWWA 3HTUA 4PZJA 3GXOA 1BM9A 4BXUA 3RI4A 2Z99A 3LA2A 3D0SA 4G6QA 2KRFA 3WTUC 1O57A 4ESBA 1ON2A 5DYMA 4Y15A 4I2OA 3L7WA 2XKOA 1R22A 4DNCA 3F8MA 1NHAA 4HDVA 1XN7A 2HTSA 5CLSA 4G8XA 1J9IA 3WU1B 4A5MA 1R36A 1BI0A 1Z6RA 3V7CA 4KIGA 1T0FA 3F3XA 2MH2A 2W25A 3F21A 4MHGA 5CVIA 3GX4X 2NS0A 2P8TA 4ENKA 4LGWA 1G3YA 5LHHA 4M9ZA 3E6MA 1K79A 3GFLA 2H6CA 4ENJA 2ZMEB 3H92A 2GZWA 5TRDA 1QGPA 4A0XA 4H0EA 1I27A 2M1BA 2BV6A 5D6FA 1LDDA 3QP6A 4Q5SF 5LRSA 1J7KA 2XAGA 1UFMA 2K27A 1IRFA 1BI3A 1JE8A 3KFWX 1R5HA 1FNNA 1SD7A 1EH7A 5D8KB 3KP3A 1ZRFA 1TTYA 2AS5F 2P4WA 2ZXJA 1FC3A 2VOOA 3T5XA 4K2EA 2YSRA 4LMYA 2PLYA 4G7ZF 2BBYA 2ZMEA 1ZAOA 4M72A 3V8JA 2CG4A 5D5VB 4JK1X 3IRRA 1K7AA 3EQLF 1YYVA 1G3TA 3CTAA 1DP7P 3JTHA 2GAUA 5D5UB 5E8IA 2W84A 5J6XA 1FZPB 4A0ZA 1KQ8A 3FHZA 3P9IA 4N9HA 1V4RA 4GCVA 1XDSA 5J8CA 3GFIA 1F1ZA 3B02A 4YFNF 2V6CA 5F1RA 1XGNA 2ESNA 1YS7A 4HQMA 2FNAA 1IF1A 2J5PA 3KLOA 3IKVA 2FBIA 3VEPA 2ISYA 3I64A 1A04A 3BOQA 3HRTA 1IN5A 4CYDA 3ZN0A 3F6OA 4A12A 2JZYA 4KIBA 5BS6A 2FBHA 4MTDA 3DQVC 2R7FA 2IPQX 1Z91A 1MDMB 2F5EA 1WQ2A 5ILVA 2EV6A 4CHUA 5L3DA 1H0MA 3E6DA 2Z3YA 1W7PA 2L4MA 4G9YA 3TDUC 5JR3A 5D5XB 3IWFA 1XDUA 4HBLA 4ESFA 2H6BA 1V3FA 4UV8A 4XSXF 2X4HA 2HWVA 4O6JA 2K86A 4IXAA 3MZHA 2DBBA 1J2XA 1R5GA 4ESJA 1IN8A 2CW0F 1OPCA 3K0LA 2CFXA 2FNPA 3QPTA 4G7HF 1HBXG 4OIPF 1FBQA 2Q2EA 4BHCA 3K1PA 5L3EA 3JW4A 3LQQA 5ED4A 3KZYA 4Q48A 4PDKA 3SHFA 1IN4A 3PQJA 2RVCA 1L3LA 1B9MA 3RIRA 4PCQA 5A2QZ 2KJBA 2CO5A 2X0LA 2D2WA 3S2WA 4OMYA 3KP2A 1OKRA 1JGSA 3TO7A 2CWEA 1IRGA 2GIVA 3I53A 4OINF 1QQIA 1HKSA 4HX4A 1QNTA 4Q4ZF 3TOAA 2Y75A 3CUQB 3KE2A 4XLNF 1G4DA 2E1CA 4G7OF 1TW3A 1BN5A 5CVJA 1YW8A 1FBSA 1ZGJA 3ABTA 5FD6A 2VC0A 5A2QK 3J81K 3FM5A 4PGGA 2V1XA 2VN2A 4RAYA 4G6DA 1JXSA 3BPXA 4QLCU 1R23A 5F64A 3BJ6A 1U5TB 3E3VA 1GXQA 3I54A 3Q9SA 3HUGA 3RKYA 1HKQA 1SFUA 4XBFA 1X3UA 3JTGA 2IJLA 4KYWA 2FQ3A 3HSEA 1ONVA 2PFBA 3QU3A 1R1TA 3WTYC 4HV6A 1U5TA 2FBKA 2QENA 2ACJA 3HSRA 3GYHX 2ZJ2A 4LLGF 4ASNA 2DTRA 4BQAA 1ZG5A 3ML6A 1MZBA 4R8HA 1ZG1A 5FLXZ 3HRUA 3C7JA 1OYWA 1J59A 3GW2A 1LVAA 2KJCA 1RUOA 1XGMA 3C18A 2H94A 4UUVA 1XGSA 1J75A 5ICFA 4HYEA 3FMRA 3ZQ7A 3MQ0A 4KN4X 2DFIA 1USSA 5ERIA 4L9JA 2VBXA 2FMLA 2VBWA 3CO7C 3RTRA 4WF2A 2ADUA 3L09A 2O03A 1XMKA 3T8TA 1BIBA 4EV0A 2O3FA 4JQFA 4AD9A 2YX7A 1AWCA 3R4KA 1HW5A 2ZKZA 3R6SA 3EUHA 4ZH4F 5J8FA 1I6XA 2PBIA 5ILUA 2QM3A 5ICCA 4LLNA 3IWZA 4AIJA 4I01A 1Z9CA 2XASA 3REOA 4GGGA 1T2KA 4LG0A 5L3GA 1TBXA 3L2CA 4I98B 4A6EA 4CDGA 5LHGA 1K78A 2ZO4A 1MJBA 3CO6C 3ZMVA 2VXZA 2NAZA 4LD5A 3F8FA 2PMUA 4L18B 3RKWA 1ZLKA 3QPHA 1KQ0A 2DI3A 1LB2A 5DCMA 1SD6A 3HOSA 2KIUA 3WODF 1Z05A 3B73A 4I0BA 3U9GA 1MKMA 3LAPA 1S29A 4RB0A 1PUEE 4KNYA 5HOOA 3E97A 4O5VA 2LF8A 3TO9A 3VODA 3U2RA 4EM2A 3E6CC 3WGIA 2K4BA 1B9NA 4EJOA 4GXOA 1YG2A 2QBYB 4RGUA 3L00A 4HX8A 4YG2F 4OMZA 2QUFA 3DFGA 3E5UA 3WGHA 4UXNA 5HDKA 4Y17A 1MGTA 2RKHA 4L5JA 2DU9A 3H3ZA 4KUMA 5E8GA 1LEBA 5D5WB 2JTVA 2WWYA 4EMSA 4KMUX 4E70A 1HW1A 1ZLJA 2M87A 4TV7A 1E17A 2H27A 4FX4A 3O3KA 1YW7A 1SFEA 1MJAA 2ISZA 4LG0B 3G3ZA 2HFHA 1S8NA 4RGXA 1ULYA 2F5FA 2GQQA 1LNWA 5LRRA 5BOXA 5JHUA 1RNLA 2MA3A 4YFKF 2LNBA 5L3CA 4HA8A 2P6SA 3V8LA 2RQPA 3T1BA 2O0YA 3DF8A 5H6RA 2ZFWA 2GWRA 4U0VA 2BEOA 3RKXA 1TQIA 1I5ZA 4HOBA 3N4MA 2WTEA 5K5OA 2HKXA 2ZNZA 1T38A 1R00A 2QVOA 2AXLA 4AIHA 5E1XA 4U88A 4BNCA 1YLFA 5LEKA 2XKPA 3F8BA 1B59A 3F23A 3HTSB 4EJUA 1HSTA 3O6BB 4M71A 5EEGA 2ZCWA 1ZHFA 4I7HA 1HQCA 1LJ9A 2DT5A 3LAJA 3TQNA 2VODA 1CGPA 5CVVA 2OD5A 1BI1A 4HF0A 1ZGAA 1SD4A 3U1DA 4HV5A 3K1NA 3J80Z 3LQRA 2EFPA 1FY7A 1QZYA 2JRTA 3I4PA 1DUXC 2L02A 2OU2A 3R60A 4HQEA 1LEAA 3T8RA 2TDXA 4IRGA 1RUNA 2VT3A 1W5SA 5E18F 2HR3A 1YQAA 2XAQA 2HKOA 3N97A 2V79A 1D8KA 1S7OA 2BE5F 3SZPA 5DDGA 2Z33A 5CVRA 5FB2A 1P4XA 1ZYRF 3R61A 1FYMA 3W6JB 1BC7C 1E2XA 4I09A 1O3RA 3NQOA 5EEHA 2DLLA 1K6OA 1U8RA 1L0OC 2E7XA 4O3MA 4I0AA 3ZMZA 1MJ9A 1HW2A 1BJAA 4ZYEA 2A5YB 1KA8A 3DKWA 1U3EM 2M5WA 5HLIA 1UHWA 4EGYA 1FSEA 1HSJA 5LBQA 3EYIA 2ETHA 3FXUA 2VE9A 3FM3A 2PN6A 1U2WA 3GO5A 2F5DA 3E6BA 3EETA 2MH9A 2QZ8A 2EFQA 3H3UA 3IHUA 3LFKA 5K1YA 3GWZA 1KQ9A 5HDGA 1UCRA 2O8XA 3NRVA 4BYYA 1TLHB 2ESHA 1Q1HA 2V9VA 1F4KA 1Y0UA 4S05A 5D4RA 3RYRA 4IJAA 4P9FA 4D0PA 1GHCA 1MD0A 3OV8A 1DDNA 2IVMA 5IT3A 2Q8KA 3I5UA 5BPDA 4HDUA 5AONA 3MAJA 2UXNA 2XIGA 5H6QA 5LHIA 1OR7A 3M1EA 3L9FA 4YIIA 2F5CA 2QQAA 4ON0A 1IXSB 1P4WA 1IN6A 3WU0A 4KMFA 1KU3A 3DP7A 3V7RA 4ZYHA 1KYZA 2W85A 1AOYA 2FU4A 2EV5A 4EJVA 1TQMA 2XUBA 2LKPA 4WX9A 2JPCA 2RDPA 2GA1A 3FXQA 3TO6A 5H20A 4OIOF 4G94A 2K02A 2OBPA 3LA7A 2ELHA 1C0WA 2CSOA 3RYPA 1ZARA 3W6KB 3CJNA 3FF5A 4UVBA 1GXPA 1SMYF 2XHKA 2OQGA 3T0YA 1OMIA 3WTXC 1WRJA 3HIFA 2UXXA 1DPUA 4HZFA 1XCVA 2VOPA 1J5YA 4LK0F 1R1VA 1XCBA 3KEQA 1IXCA 1FP1D 1YFHA 1YO5C 1U78A 4MEYF 3LWFA 2HQRA 3TOBA 1XMAA 5IT9Z 2OA4A 4BH9A 2JPBA 3M9AA 3EYYA 3GUDA 3P9CA 4HF2A 1VTNC 3BWGA 4FX0A 4BAYA 3WTVC 3KP5A 2DO7A 2XRNA 1FBUA 2VBZA 2MLKA 3SXYA 3CUOA 3GFMA 4KA4A 3MZYA 3O2PE 5LGUA 5E17F 3TDZC 1REPC 4XRFA 1P2FA 4L0ZB 2LF7A 1T6SA 3IKTA 5TJJA 1XB4A 4IF4A 4N0BA 3HSFA 3CUQA 4F7ZA 3KLNA 5E1ZB 5BPIA 4EGZA 3VOEA 4CXFA 4IVNA 4Q47A 2RC4A 5L3BA 4MNUA 1EH8A 3ELKA 1ODDA 3GVAA 2HEOA 3M8EA 3BDDA 2YR2A 3K1MA 4LB6B 1S3JA 1OYIA 1BOAA 1HKTA 3ECOA 3R0AA 2DPDA 2B0LA 4B8XA 2L54A 5LLQA 3MEXA 2Y0MA 4AVPA 2STWA 4WWCA 2QBYA 1XSXA 4WXDA 3GFJA 3GZ6A 1BC8C 1ZRDA 3LSTA 3DXJF 1O3TA 3IL2A 2Q0OA 5BQTA 3V4GA 3J80K 2Z9OA 3SQNA 2QQBA 1KU9A 4RGRA 3SFZA 3MWMA 4IPAA 2VONA 2FOKA 2LSOA 2WC2A 3COAC 1OYYA 1F5TA 2MBFA 5ICGA 3FMQA 2VT2A 2EFWA 2G7UA 1XD7A 4RAZA 2VE8A 1J0RA 3Q9VA 1B6AA 3FXRA 1WI9A 3FMSA 3QAHA 1FT9A 2DK5A 4ZYGA 2UZKA 4LB5A 2YU3A 1RIOH 1R1UA 5FGMA 2A3SA 3BZ6A 4RB2C 1YIOA 4UHTA 3J81Z 4EVIA 1IZ1A 3R0JA 4KT5C 4L5IA 5LGTA 1KU7A 2FE3A 1W7PD 3HYIA 3KP4A 2E1NA 1G3SA 4M6YA 2XROA 2DPUA 3Q5FA 3ZMSA 5BMZA 5JVTA 1IN7A 4EM0B 5HDNA 4M73A 4EJTA 4R1HA 2PJPA 2C6YA 5DD8A 3I59A 2A69F 1SFXA 4M74A 4M6XA 3V8KA 1W7PB 2P5KA 4IRIA 3ZP5A 4P96A 5F6FA 2FXAA 4ENMA 3EDPA 1W4MA 4WXCA 2EA4A 1P6RA 3M8FA 3HOTA 2P7VB 1I1GA 1O7LA 4IRHA 1QPMA 3ERED 3LA3A 3C1DA 2FMYA 3WG9A 2NYXA 4HAMA 4RGSA 3AAFA 2EB7A 2OZUA 3M7GA 2CQKA 4A0YA 4KDPA 4LLLA 3TKYA 2RNJA 2CYYA 2GA2A 2Z5UA 2MD5A 2R7DA 1W5TA 1RZ4A 4Z2YA 3BP8A 3I59B 3FX3A 4L9TA 5FFZA 1H9TA 3KETA 3I0TA 3GZ5A 3HHHA 2PEXA 2W57A 1IUYA 2YX4A 1U6GA 1ZN2A 1BIAA 5CJ9A 2DQRA 3SZTA 3F6VA 1Z7UA 5L3FA 2XAJA 2WV0A 2OQRA 5E20A 5KK1A 5HLHA 1IXRC 2LDUA 5DCFA 3P9KA 4U0WA 2COMA 3IRQA 1UB9A 2GXGA 3E5XA 2HOEA 3J7AO 1QBJA 1PP8F 4BHPA 2ZBKA 2OAZA 5HS9A 2GXBA 1O7FA 1YTYA 4M9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RI7 A;  3F8C A;  3VFZ A;  3OOP A;  1PDN C;  2O6G E;  2EK5 A;  3GF2 A;  4ETS A;  2A6E F;  4Y13 A;  2HDC A;  3C3W A;  2VBY A;  4NQW A;  4HX7 A;  2PI0 A;  2QLZ A;  2BYV E;  2L4A A;  5HS8 A;  4OIQ F;  1WWX A;  4U0Y A;  5E1W A;  2A07 F;  2XV4 S;  5IT9 K;  2ZNY A;  1Z6T A;  5K5R A;  3QU6 A;  2FSW A;  1FP2 A;  4JBA A;  4UV9 A;  4L0Y B;  1EV7 A;  4PGH A;  5HLG A;  5AIP A;  4MQ9 F;  3WE2 A;  1BI2 A;  2F2E A;  4HLX A;  1R58 A;  1ZRE A;  5D8L B;  1MDM A;  5D4S A;  1CF7 A;  1D5V A;  3NEU A;  2NNY A;  1GVJ A;  2DAO A;  1D3Y A;  5DEQ A;  2J5O A;  6PAX A;  4L9V A;  3IC7 A;  1R7J A;  1F9N A;  2JT1 A;  3K9T A;  2EV0 A;  3ZN1 A;  3BJO A;  2MLG A;  4KIF A;  3WTS C;  3MCZ A;  4RB3 C;  3RDI A;  4A2U A;  5FLX K;  1TNT A;  2DK8 A;  2RGV A;  3ROU A;  1B1B A;  5CYV A;  3BY6 A;  4LK1 F;  1U5T C;  2XAF A;  2V1U A;  2RN7 A;  1WKM A;  2A61 A;  2EJR A;  3GLX A;  2IW5 A;  1S6L A;  1ZH5 A;  1G3W A;  2OZ6 A;  5AIQ A;  2MC3 A;  4MEX F;  1CF7 B;  1ZRC A;  4CIC A;  3KCC A;  4L9N A;  1UST A;  2D45 A;  1FPQ A;  4MTE A;  2M8E A;  2FEZ A;  1G6N A;  2H09 A;  2FRH A;  5JI6 A;  4I02 A;  1FYK A;  1WSU A;  2O61 A;  1B4A A;  4AWX B;  4HW0 A;  1KGS A;  2PG4 A;  2HZT A;  2HQN A;  1FLI A;  4M9S A;  4CGZ A;  2DW4 A;  5JFR A;  4KFC A;  2Y48 A;  1YW9 A;  5K5Q A;  2FA5 A;  4NHJ A;  1TQP A;  4EM1 A;  1BBY A;  4DQ2 A;  2DQL A;  4UVC A;  2VC1 A;  1P92 A;  4ZZL A;  1YS6 A;  1SMT A;  4A6D A;  4UNO A;  4BHB A;  4B09 A;  3BRO A;  3KP6 A;  2A6H F;  4EJW A;  1FX7 A;  4ZZD A;  4EQQ A;  1Z1D A;  2K7L A;  2JSC A;  2IA0 A;  3HRS A;  3ZMD A;  3DPT A;  1LQ1 A;  3WE3 A;  2HYG D;  2PQ8 A;  2NNN A;  3RPU A;  5LGN A;  2XVC A;  2E7W A;  2L01 A;  3KP7 A;  1T39 A;  1XSD A;  3QOP A;  1FOK A;  2HS5 A;  1KYW A;  5LEJ A;  2M45 A;  5DUK A;  2CGP A;  3CLO A;  4FT8 A;  3RJP A;  2EFO A;  2R3S A;  4KN7 X;  4MQV A;  3G73 A;  2HYF A;  4CO8 A;  4MGR A;  1IW7 F;  1D8J A;  1S7A A;  4LFU A;  2K4J A;  4AIK A;  3ZPL A;  1I1S A;  1HXD A;  1TNS A;  4XSZ F;  4NB5 A;  3P7N A;  4OU0 A;  2EFN A;  4WK8 F;  5KVR A;  3PQK A;  1LDJ A;  2M30 A;  4YFX F;  5FO5 A;  2P6T A;  3D5L A;  4U7D A;  2A68 F;  2IT0 A;  3V7S A;  3WTT C;  3K2Z A;  3WTZ A;  3I58 A;  3ZMU A;  2KKO A;  2D1V A;  3WGG A;  1PP7 U;  2P5L C;  5DV5 A;  2QYO A;  4RS8 A;  4RB1 A;  4GYG A;  3TGN A;  1SD5 A;  3I71 A;  3QP5 A;  1EH6 A;  1STZ A;  4N9I A;  1FWZ A;  1TW2 A;  2YPR A;  4GYI A;  2IA1 A;  2IP2 A;  3ULQ B;  4KIC A;  2XGX A;  1P4A A;  3E5Q A;  4CZZ A;  4OIR F;  2KIM A;  4P55 A;  4WXH A;  3JSP A;  5HVQ C;  2IRF G;  4IHT A;  2HTJ A;  3CDH A;  4ZYD A;  2D1H A;  2QQ9 A;  2NRA C;  3KZZ A;  4XLP F;  1O3S A;  5ICE A;  4ENN A;  2FF4 A;  3MFK A;  5FFX A;  1FYL A;  4LJZ F;  2L3D A;  2EA2 A;  2STT A;  5DCM B;  1XSV A;  1IAW A;  3F8N A;  4UVA A;  4OOI A;  3HRM A;  3WTW C;  3K69 A;  3ZMT A;  3KEO A;  4HLY A;  5D6E A;  4A5N A;  1T98 A;  2RV8 A;  3FWE A;  5CVU A;  2KIF A;  3CUQ C;  2BGC A;  4IHS A;  2PMH A;  4FHT A;  5FD5 A;  1JHH A;  1H9G A;  3GEZ A;  3HHG A;  5HS7 A;  2W24 A;  1QO0 D;  3JSO A;  5DD4 A;  3BJA A;  3ABU A;  4S04 A;  4U7B A;  3F22 A;  4R79 A;  2IA2 A;  5ILS A;  4GO1 A;  1LDK B;  1ON1 A;  4P9U A;  3ISP A;  4P5O A;  3PFI A;  3DEU A;  3JAM K;  2EWN A;  4QWQ A;  1QZZ A;  4YIF A;  2P7C B;  3DV8 A;  3BPV A;  3JAM Z;  2UWM A;  3F72 A;  2G7H A;  4HF1 A;  2G9W A;  5DUI A;  1DPR A;  3QRF F;  1ZG3 A;  1UHM A;  2XAH A;  1O3Q A;  3ECH A;  2V1D A;  1SAX A;  1XGO A;  4WCG A;  1FSH A;  1KU2 A;  3RPQ A;  1JHF A;  2HGC A;  3VB2 A;  2P5V A;  3DPL C;  3FZV A;  1K78 B;  2QWW A;  3HTU A;  4PZJ A;  3GXO A;  1BM9 A;  4BXU A;  3RI4 A;  2Z99 A;  3LA2 A;  3D0S A;  4G6Q A;  2KRF A;  3WTU C;  1O57 A;  4ESB A;  1ON2 A;  5DYM A;  4Y15 A;  4I2O A;  3L7W A;  2XKO A;  1R22 A;  4DNC A;  3F8M A;  1NHA A;  4HDV A;  1XN7 A;  2HTS A;  5CLS A;  4G8X A;  1J9I A;  3WU1 B;  4A5M A;  1R36 A;  1BI0 A;  1Z6R A;  3V7C A;  4KIG A;  1T0F A;  3F3X A;  2MH2 A;  2W25 A;  3F21 A;  4MHG A;  5CVI A;  3GX4 X;  2NS0 A;  2P8T A;  4ENK A;  4LGW A;  1G3Y A;  5LHH A;  4M9Z A;  3E6M A;  1K79 A;  3GFL A;  2H6C A;  4ENJ A;  2ZME B;  3H92 A;  2GZW A;  5TRD A;  1QGP A;  4A0X A;  4H0E A;  1I27 A;  2M1B A;  2BV6 A;  5D6F A;  1LDD A;  3QP6 A;  4Q5S F;  5LRS A;  1J7K A;  2XAG A;  1UFM A;  2K27 A;  1IRF A;  1BI3 A;  1JE8 A;  3KFW X;  1R5H A;  1FNN A;  1SD7 A;  1EH7 A;  5D8K B;  3KP3 A;  1ZRF A;  1TTY A;  2AS5 F;  2P4W A;  2ZXJ A;  1FC3 A;  2VOO A;  3T5X A;  4K2E A;  2YSR A;  4LMY A;  2PLY A;  4G7Z F;  2BBY A;  2ZME A;  1ZAO A;  4M72 A;  3V8J A;  2CG4 A;  5D5V B;  4JK1 X;  3IRR A;  1K7A A;  3EQL F;  1YYV A;  1G3T A;  3CTA A;  1DP7 P;  3JTH A;  2GAU A;  5D5U B;  5E8I A;  2W84 A;  5J6X A;  1FZP B;  4A0Z A;  1KQ8 A;  3FHZ A;  3P9I A;  4N9H A;  1V4R A;  4GCV A;  1XDS A;  5J8C A;  3GFI A;  1F1Z A;  3B02 A;  4YFN F;  2V6C A;  5F1R A;  1XGN A;  2ESN A;  1YS7 A;  4HQM A;  2FNA A;  1IF1 A;  2J5P A;  3KLO A;  3IKV A;  2FBI A;  3VEP A;  2ISY A;  3I64 A;  1A04 A;  3BOQ A;  3HRT A;  1IN5 A;  4CYD A;  3ZN0 A;  3F6O A;  4A12 A;  2JZY A;  4KIB A;  5BS6 A;  2FBH A;  4MTD A;  3DQV C;  2R7F A;  2IPQ X;  1Z91 A;  1MDM B;  2F5E A;  1WQ2 A;  5ILV A;  2EV6 A;  4CHU A;  5L3D A;  1H0M A;  3E6D A;  2Z3Y A;  1W7P A;  2L4M A;  4G9Y A;  3TDU C;  5JR3 A;  5D5X B;  3IWF A;  1XDU A;  4HBL A;  4ESF A;  2H6B A;  1V3F A;  4UV8 A;  4XSX F;  2X4H A;  2HWV A;  4O6J A;  2K86 A;  4IXA A;  3MZH A;  2DBB A;  1J2X A;  1R5G A;  4ESJ A;  1IN8 A;  2CW0 F;  1OPC A;  3K0L A;  2CFX A;  2FNP A;  3QPT A;  4G7H F;  1HBX G;  4OIP F;  1FBQ A;  2Q2E A;  4BHC A;  3K1P A;  5L3E A;  3JW4 A;  3LQQ A;  5ED4 A;  3KZY A;  4Q48 A;  4PDK A;  3SHF A;  1IN4 A;  3PQJ A;  2RVC A;  1L3L A;  1B9M A;  3RIR A;  4PCQ A;  5A2Q Z;  2KJB A;  2CO5 A;  2X0L A;  2D2W A;  3S2W A;  4OMY A;  3KP2 A;  1OKR A;  1JGS A;  3TO7 A;  2CWE A;  1IRG A;  2GIV A;  3I53 A;  4OIN F;  1QQI A;  1HKS A;  4HX4 A;  1QNT A;  4Q4Z F;  3TOA A;  2Y75 A;  3CUQ B;  3KE2 A;  4XLN F;  1G4D A;  2E1C A;  4G7O F;  1TW3 A;  1BN5 A;  5CVJ A;  1YW8 A;  1FBS A;  1ZGJ A;  3ABT A;  5FD6 A;  2VC0 A;  5A2Q K;  3J81 K;  3FM5 A;  4PGG A;  2V1X A;  2VN2 A;  4RAY A;  4G6D A;  1JXS A;  3BPX A;  4QLC U;  1R23 A;  5F64 A;  3BJ6 A;  1U5T B;  3E3V A;  1GXQ A;  3I54 A;  3Q9S A;  3HUG A;  3RKY A;  1HKQ A;  1SFU A;  4XBF A;  1X3U A;  3JTG A;  2IJL A;  4KYW A;  2FQ3 A;  3HSE A;  1ONV A;  2PFB A;  3QU3 A;  1R1T A;  3WTY C;  4HV6 A;  1U5T A;  2FBK A;  2QEN A;  2ACJ A;  3HSR A;  3GYH X;  2ZJ2 A;  4LLG F;  4ASN A;  2DTR A;  4BQA A;  1ZG5 A;  3ML6 A;  1MZB A;  4R8H A;  1ZG1 A;  5FLX Z;  3HRU A;  3C7J A;  1OYW A;  1J59 A;  3GW2 A;  1LVA A;  2KJC A;  1RUO A;  1XGM A;  3C18 A;  2H94 A;  4UUV A;  1XGS A;  1J75 A;  5ICF A;  4HYE A;  3FMR A;  3ZQ7 A;  3MQ0 A;  4KN4 X;  2DFI A;  1USS A;  5ERI A;  4L9J A;  2VBX A;  2FML A;  2VBW A;  3CO7 C;  3RTR A;  4WF2 A;  2ADU A;  3L09 A;  2O03 A;  1XMK A;  3T8T A;  1BIB A;  4EV0 A;  2O3F A;  4JQF A;  4AD9 A;  2YX7 A;  1AWC A;  3R4K A;  1HW5 A;  2ZKZ A;  3R6S A;  3EUH A;  4ZH4 F;  5J8F A;  1I6X A;  2PBI A;  5ILU A;  2QM3 A;  5ICC A;  4LLN A;  3IWZ A;  4AIJ A;  4I01 A;  1Z9C A;  2XAS A;  3REO A;  4GGG A;  1T2K A;  4LG0 A;  5L3G A;  1TBX A;  3L2C A;  4I98 B;  4A6E A;  4CDG A;  5LHG A;  1K78 A;  2ZO4 A;  1MJB A;  3CO6 C;  3ZMV A;  2VXZ A;  2NAZ A;  4LD5 A;  3F8F A;  2PMU A;  4L18 B;  3RKW A;  1ZLK A;  3QPH A;  1KQ0 A;  2DI3 A;  1LB2 A;  5DCM A;  1SD6 A;  3HOS A;  2KIU A;  3WOD F;  1Z05 A;  3B73 A;  4I0B A;  3U9G A;  1MKM A;  3LAP A;  1S29 A;  4RB0 A;  1PUE E;  4KNY A;  5HOO A;  3E97 A;  4O5V A;  2LF8 A;  3TO9 A;  3VOD A;  3U2R A;  4EM2 A;  3E6C C;  3WGI A;  2K4B A;  1B9N A;  4EJO A;  4GXO A;  1YG2 A;  2QBY B;  4RGU A;  3L00 A;  4HX8 A;  4YG2 F;  4OMZ A;  2QUF A;  3DFG A;  3E5U A;  3WGH A;  4UXN A;  5HDK A;  4Y17 A;  1MGT A;  2RKH A;  4L5J A;  2DU9 A;  3H3Z A;  4KUM A;  5E8G A;  1LEB A;  5D5W B;  2JTV A;  2WWY A;  4EMS A;  4KMU X;  4E70 A;  1HW1 A;  1ZLJ A;  2M87 A;  4TV7 A;  1E17 A;  2H27 A;  4FX4 A;  3O3K A;  1YW7 A;  1SFE A;  1MJA A;  2ISZ A;  4LG0 B;  3G3Z A;  2HFH A;  1S8N A;  4RGX A;  1ULY A;  2F5F A;  2GQQ A;  1LNW A;  5LRR A;  5BOX A;  5JHU A;  1RNL A;  2MA3 A;  4YFK F;  2LNB A;  5L3C A;  4HA8 A;  2P6S A;  3V8L A;  2RQP A;  3T1B A;  2O0Y A;  3DF8 A;  5H6R A;  2ZFW A;  2GWR A;  4U0V A;  2BEO A;  3RKX A;  1TQI A;  1I5Z A;  4HOB A;  3N4M A;  2WTE A;  5K5O A;  2HKX A;  2ZNZ A;  1T38 A;  1R00 A;  2QVO A;  2AXL A;  4AIH A;  5E1X A;  4U88 A;  4BNC A;  1YLF A;  5LEK A;  2XKP A;  3F8B A;  1B59 A;  3F23 A;  3HTS B;  4EJU A;  1HST A;  3O6B B;  4M71 A;  5EEG A;  2ZCW A;  1ZHF A;  4I7H A;  1HQC A;  1LJ9 A;  2DT5 A;  3LAJ A;  3TQN A;  2VOD A;  1CGP A;  5CVV A;  2OD5 A;  1BI1 A;  4HF0 A;  1ZGA A;  1SD4 A;  3U1D A;  4HV5 A;  3K1N A;  3J80 Z;  3LQR A;  2EFP A;  1FY7 A;  1QZY A;  2JRT A;  3I4P A;  1DUX C;  2L02 A;  2OU2 A;  3R60 A;  4HQE A;  1LEA A;  3T8R A;  2TDX A;  4IRG A;  1RUN A;  2VT3 A;  1W5S A;  5E18 F;  2HR3 A;  1YQA A;  2XAQ A;  2HKO A;  3N97 A;  2V79 A;  1D8K A;  1S7O A;  2BE5 F;  3SZP A;  5DDG A;  2Z33 A;  5CVR A;  5FB2 A;  1P4X A;  1ZYR F;  3R61 A;  1FYM A;  3W6J B;  1BC7 C;  1E2X A;  4I09 A;  1O3R A;  3NQO A;  5EEH A;  2DLL A;  1K6O A;  1U8R A;  1L0O C;  2E7X A;  4O3M A;  4I0A A;  3ZMZ A;  1MJ9 A;  1HW2 A;  1BJA A;  4ZYE A;  2A5Y B;  1KA8 A;  3DKW A;  1U3E M;  2M5W A;  5HLI A;  1UHW A;  4EGY A;  1FSE A;  1HSJ A;  5LBQ A;  3EYI A;  2ETH A;  3FXU A;  2VE9 A;  3FM3 A;  2PN6 A;  1U2W A;  3GO5 A;  2F5D A;  3E6B A;  3EET A;  2MH9 A;  2QZ8 A;  2EFQ A;  3H3U A;  3IHU A;  3LFK A;  5K1Y A;  3GWZ A;  1KQ9 A;  5HDG A;  1UCR A;  2O8X A;  3NRV A;  4BYY A;  1TLH B;  2ESH A;  1Q1H A;  2V9V A;  1F4K A;  1Y0U A;  4S05 A;  5D4R A;  3RYR A;  4IJA A;  4P9F A;  4D0P A;  1GHC A;  1MD0 A;  3OV8 A;  1DDN A;  2IVM A;  5IT3 A;  2Q8K A;  3I5U A;  5BPD A;  4HDU A;  5AON A;  3MAJ A;  2UXN A;  2XIG A;  5H6Q A;  5LHI A;  1OR7 A;  3M1E A;  3L9F A;  4YII A;  2F5C A;  2QQA A;  4ON0 A;  1IXS B;  1P4W A;  1IN6 A;  3WU0 A;  4KMF A;  1KU3 A;  3DP7 A;  3V7R A;  4ZYH A;  1KYZ A;  2W85 A;  1AOY A;  2FU4 A;  2EV5 A;  4EJV A;  1TQM A;  2XUB A;  2LKP A;  4WX9 A;  2JPC A;  2RDP A;  2GA1 A;  3FXQ A;  3TO6 A;  5H20 A;  4OIO F;  4G94 A;  2K02 A;  2OBP A;  3LA7 A;  2ELH A;  1C0W A;  2CSO A;  3RYP A;  1ZAR A;  3W6K B;  3CJN A;  3FF5 A;  4UVB A;  1GXP A;  1SMY F;  2XHK A;  2OQG A;  3T0Y A;  1OMI A;  3WTX C;  1WRJ A;  3HIF A;  2UXX A;  1DPU A;  4HZF A;  1XCV A;  2VOP A;  1J5Y A;  4LK0 F;  1R1V A;  1XCB A;  3KEQ A;  1IXC A;  1FP1 D;  1YFH A;  1YO5 C;  1U78 A;  4MEY F;  3LWF A;  2HQR A;  3TOB A;  1XMA A;  5IT9 Z;  2OA4 A;  4BH9 A;  2JPB A;  3M9A A;  3EYY A;  3GUD A;  3P9C A;  4HF2 A;  1VTN C;  3BWG A;  4FX0 A;  4BAY A;  3WTV C;  3KP5 A;  2DO7 A;  2XRN A;  1FBU A;  2VBZ A;  2MLK A;  3SXY A;  3CUO A;  3GFM A;  4KA4 A;  3MZY A;  3O2P E;  5LGU A;  5E17 F;  3TDZ C;  1REP C;  4XRF A;  1P2F A;  4L0Z B;  2LF7 A;  1T6S A;  3IKT A;  5TJJ A;  1XB4 A;  4IF4 A;  4N0B A;  3HSF A;  3CUQ A;  4F7Z A;  3KLN A;  5E1Z B;  5BPI A;  4EGZ A;  3VOE A;  4CXF A;  4IVN A;  4Q47 A;  2RC4 A;  5L3B A;  4MNU A;  1EH8 A;  3ELK A;  1ODD A;  3GVA A;  2HEO A;  3M8E A;  3BDD A;  2YR2 A;  3K1M A;  4LB6 B;  1S3J A;  1OYI A;  1BOA A;  1HKT A;  3ECO A;  3R0A A;  2DPD A;  2B0L A;  4B8X A;  2L54 A;  5LLQ A;  3MEX A;  2Y0M A;  4AVP A;  2STW A;  4WWC A;  2QBY A;  1XSX A;  4WXD A;  3GFJ A;  3GZ6 A;  1BC8 C;  1ZRD A;  3LST A;  3DXJ F;  1O3T A;  3IL2 A;  2Q0O A;  5BQT A;  3V4G A;  3J80 K;  2Z9O A;  3SQN A;  2QQB A;  1KU9 A;  4RGR A;  3SFZ A;  3MWM A;  4IPA A;  2VON A;  2FOK A;  2LSO A;  2WC2 A;  3COA C;  1OYY A;  1F5T A;  2MBF A;  5ICG A;  3FMQ A;  2VT2 A;  2EFW A;  2G7U A;  1XD7 A;  4RAZ A;  2VE8 A;  1J0R A;  3Q9V A;  1B6A A;  3FXR A;  1WI9 A;  3FMS A;  3QAH A;  1FT9 A;  2DK5 A;  4ZYG A;  2UZK A;  4LB5 A;  2YU3 A;  1RIO H;  1R1U A;  5FGM A;  2A3S A;  3BZ6 A;  4RB2 C;  1YIO A;  4UHT A;  3J81 Z;  4EVI A;  1IZ1 A;  3R0J A;  4KT5 C;  4L5I A;  5LGT A;  1KU7 A;  2FE3 A;  1W7P D;  3HYI A;  3KP4 A;  2E1N A;  1G3S A;  4M6Y A;  2XRO A;  2DPU A;  3Q5F A;  3ZMS A;  5BMZ A;  5JVT A;  1IN7 A;  4EM0 B;  5HDN A;  4M73 A;  4EJT A;  4R1H A;  2PJP A;  2C6Y A;  5DD8 A;  3I59 A;  2A69 F;  1SFX A;  4M74 A;  4M6X A;  3V8K A;  1W7P B;  2P5K A;  4IRI A;  3ZP5 A;  4P96 A;  5F6F A;  2FXA A;  4ENM A;  3EDP A;  1W4M A;  4WXC A;  2EA4 A;  1P6R A;  3M8F A;  3HOT A;  2P7V B;  1I1G A;  1O7L A;  4IRH A;  1QPM A;  3ERE D;  3LA3 A;  3C1D A;  2FMY A;  3WG9 A;  2NYX A;  4HAM A;  4RGS A;  3AAF A;  2EB7 A;  2OZU A;  3M7G A;  2CQK A;  4A0Y A;  4KDP A;  4LLL A;  3TKY A;  2RNJ A;  2CYY A;  2GA2 A;  2Z5U A;  2MD5 A;  2R7D A;  1W5T A;  1RZ4 A;  4Z2Y A;  3BP8 A;  3I59 B;  3FX3 A;  4L9T A;  5FFZ A;  1H9T A;  3KET A;  3I0T A;  3GZ5 A;  3HHH A;  2PEX A;  2W57 A;  1IUY A;  2YX4 A;  1U6G A;  1ZN2 A;  1BIA A;  5CJ9 A;  2DQR A;  3SZT A;  3F6V A;  1Z7U A;  5L3F A;  2XAJ A;  2WV0 A;  2OQR A;  5E20 A;  5KK1 A;  5HLH A;  1IXR C;  2LDU A;  5DCF A;  3P9K A;  4U0W A;  2COM A;  3IRQ A;  1UB9 A;  2GXG A;  3E5X A;  2HOE A;  3J7A O;  1QBJ A;  1PP8 F;  4BHP A;  2ZBK A;  2OAZ A;  5HS9 A;  2GXB A;  1O7F A;  1YTY A;  4M9X A; 
#chains in the Genus database with same CATH topology
 1RI7 A;  4L5E A;  3UR3 C;  3GTL J;  3F8C A;  3VFZ A;  1SAN A;  1WJE A;  3ONQ A;  5JVG F;  3OOP A;  1PDN C;  3S14 J;  2O6G E;  2EK5 A;  3H5N A;  3S1N J;  3GF2 A;  3L2Q A;  1PVE A;  2DJI A;  4ETS A;  3C2G A;  2A6E F;  1JTY A;  4Y13 A;  3P5J A;  2HDC A;  1TC3 C;  3C3W A;  1S7E A;  1VQ8 I;  3CLQ A;  4OWR B;  2VBY A;  4BS9 A;  4NQW A;  3PSI A;  4HX7 A;  2I8D A;  2PI0 A;  2QLZ A;  2XPU A;  1MH4 A;  2BYV E;  2L4A A;  5HS8 A;  4OIQ F;  5JLW A;  1I50 J;  3BQY A;  2Z16 A;  1X1P A;  1WWX A;  2BVL A;  4U0Y A;  3TED A;  5E1W A;  1N77 A;  1JKO C;  2A07 F;  4YEL A;  4DBQ A;  2XV4 S;  5IT9 K;  1ZGW A;  4UUS B;  2ZNY A;  1Z6T A;  2V7F A;  3BQZ A;  3ZGK A;  5K5R A;  3QU6 A;  4JX4 A;  4A3F J;  2FSW A;  3BG5 A;  1T56 A;  1FP2 A;  4JBA A;  4D5F A;  1BOB A;  2JMW A;  2Y9Y A;  1FOX A;  4UV9 A;  4L0Y B;  3G4S I;  1IGN A;  2EBI A;  1EV7 A;  4PGH A;  3I9V 2;  5HLG A;  1HLV A;  5AIP A;  2D5V A;  4MQ9 F;  3WE2 A;  1VQ6 I;  2NVQ J;  1NTC A;  3LSJ A;  3SEZ A;  1BI2 A;  2F2E A;  4IOC F;  2BXZ A;  3BTL A;  2K9S A;  4HLX A;  2I10 A;  1FIP A;  5B3S H;  1R58 A;  2M4G A;  1ZRE A;  4XRS G;  5D8L B;  2KHM A;  1MDM A;  5D4S A;  1CF7 A;  1D5V A;  4N4N B;  3NEU A;  2NNY A;  2H1L A;  4CUG A;  2WAF A;  4X0G A;  2HU9 A;  2ZJQ F;  1GVJ A;  3FBN B;  2KP6 A;  3S1R J;  2CQQ A;  2IGK A;  2DAO A;  1D3Y A;  3ZRG A;  3OL4 A;  5DEQ A;  1TL8 A;  2J5O A;  3H5A A;  1E0E A;  6PAX A;  4L9V A;  3IC7 A;  1Z3Y A;  3AG1 H;  1ETQ A;  1R7J A;  1F9N A;  2JT1 A;  2CQ7 A;  3K9T A;  2XGC A;  2EV0 A;  3ZN1 A;  3BJO A;  2MLG A;  4KIF A;  1X1B A;  3MCZ A;  3WTS C;  4RB3 C;  2X1E A;  3RDI A;  4A2U A;  5FLX K;  2LYC A;  1TNT A;  2DK8 A;  2RGV A;  2VL8 A;  3ROU A;  1B1B A;  3AG4 H;  3HPH A;  5CYV A;  3OYC A;  3BY6 A;  3DLA A;  3CMA I;  1J09 A;  3OYJ A;  4LK1 F;  1W1W E;  1U5T C;  2XAF A;  3L2R A;  2V1U A;  2RN7 A;  1WKM A;  2L5Q A;  2A61 A;  2EJR A;  3GLX A;  2IW5 A;  2A5W A;  2IS1 A;  1S6L A;  1IV8 A;  1ZH5 A;  3S2D J;  1G3W A;  2OZ6 A;  5KHD A;  5AIQ A;  2KFD A;  3S93 A;  1MMN A;  2MC3 A;  4MEX F;  1CF7 B;  1ZRC A;  4BQQ A;  3NAR A;  4XR6 A;  4LG3 A;  4CIC A;  1APL C;  3KCC A;  4L9N A;  2R7R A;  1UST A;  2D45 A;  2NVU B;  3OY9 A;  1FPQ A;  4JX5 A;  4MTE A;  1Y8R B;  5F0C A;  2M8E A;  2FEZ A;  1G6N A;  2H09 A;  2FRH A;  1R4N B;  5JI6 A;  1E3O C;  3O8G A;  2KQR A;  4I02 A;  1FYK A;  1WSU A;  2O61 A;  1B4A A;  4AWX B;  4HW0 A;  2QQ8 A;  3CD6 I;  1KGS A;  2PG4 A;  2HZT A;  2HQN A;  4I76 A;  1FLI A;  4F93 B;  2VUM J;  3CZ6 A;  1FJL A;  4M9S A;  3SDB A;  1D1B A;  2VI6 A;  4CGZ A;  2KRC A;  2DW4 A;  5JFR A;  4KFC A;  2Y48 A;  1YW9 A;  4AU7 A;  3D1N I;  1TWF J;  5K5Q A;  3TL4 X;  2FA5 A;  4NHJ A;  1TQP A;  4EM1 A;  1BBY A;  4X6A J;  2FOW A;  2XF7 A;  4DQ2 A;  2DQL A;  4UVC A;  2VC1 A;  1P92 A;  2DMU A;  3H3V K;  1XX5 A;  3UNG C;  2JA2 A;  3S3N A;  4ZZL A;  1POG A;  1YS6 A;  1X2M A;  1SMT A;  4A6D A;  1T8I A;  4UNO A;  2Z1D A;  4B44 A;  4PK4 A;  2M2E A;  4BHB A;  4B09 A;  3BRO A;  2M0M A;  3KP6 A;  1SC7 A;  3Q3S A;  4XN3 A;  2A6H F;  4EJW A;  3S15 J;  1FX7 A;  5B1A H;  3BR5 A;  4ZZD A;  2Q2E B;  2DFH A;  2F48 A;  2EIJ H;  3KYD B;  2XF6 A;  3QPS A;  1Z1D A;  4EQQ A;  2K7L A;  3OYB A;  4BJT A;  2JSC A;  2IA0 A;  3HRS A;  4BGD A;  3CQZ J;  4E7I A;  3ZMD A;  3DPT A;  1MH3 A;  2HQA A;  2R7X A;  4FE4 A;  4AYB A;  1LQ1 A;  4F91 B;  3WE3 A;  2W1O A;  2ELK A;  2HYG D;  2PQ8 A;  2NNN A;  2OTL I;  3RPU A;  3CJQ B;  4FIS A;  2E1O A;  2DA6 A;  5LGN A;  2XVC A;  2E7W A;  2R93 J;  2L01 A;  3SDG A;  3KP7 A;  1T39 A;  4X1E A;  2HVS A;  1N75 A;  3GLL A;  1XSD A;  2GM4 A;  3QOP A;  1FOK A;  2HS5 A;  1KYW A;  1V55 H;  4D1Q A;  4RLF A;  5LEJ A;  3K2A A;  2M45 A;  4A3K J;  1WGX A;  2CMP A;  3FHN A;  5DUK A;  3OYF A;  4IHX A;  4BE0 A;  2CGP A;  3CLO A;  4FT8 A;  3RJP A;  2EFO A;  5GPC A;  1IDY A;  2R3S A;  2BZT A;  4KN7 X;  2HYF A;  4MQV A;  4CO8 A;  3G73 A;  1JT0 A;  1FOY A;  3BR0 A;  4MGR A;  1JJ6 C;  1YJN I;  4BXF A;  1IW7 F;  2IS6 A;  1S7A A;  1D8J A;  4LFU A;  2K4J A;  1OCZ H;  4AIK A;  3ZPL A;  5GAD J;  2HXI A;  3DKY A;  3JRH A;  1I1S A;  4LIT A;  3X2Q H;  1HXD A;  3CC2 I;  1TNS A;  4XSZ F;  4NB5 A;  3OSG A;  3P7N A;  2OC6 A;  4B3X A;  4IX7 A;  3DLL F;  4OU0 A;  2EFN A;  4WK8 F;  3PJR A;  2BY0 A;  2O5R A;  1MNE A;  5KVR A;  4IHV A;  1Z3X A;  3PQK A;  1LDJ A;  2M30 A;  4YFX F;  4IEJ A;  4G12 A;  5FO5 A;  3OYD A;  2P6T A;  2L9S A;  3D5L A;  3ASO H;  4U7D A;  2A68 F;  2IT0 A;  3V7S A;  3WTT C;  3WU2 C;  1UHS A;  4PSX A;  3K2Z A;  2W7N A;  3WTZ A;  2GLO A;  3H9G A;  3I58 A;  4E7L A;  5HLT A;  1MMA A;  3ZMU A;  3MKZ A;  2KKO A;  2D1V A;  1GV5 A;  3WGG A;  1PP7 U;  4LIV A;  2P5L C;  2WAD A;  1RR8 C;  5FKO A;  5DV5 A;  2QYO A;  1Y1W J;  1UMQ A;  3H1C A;  4A3B J;  4RS8 A;  4RB1 A;  2K3P A;  4BDZ A;  3BCA A;  4CYC B;  2L9N A;  4D7N A;  4IZZ A;  2VPL A;  2QA4 I;  4GYG A;  3TGN A;  1SD5 A;  3I71 A;  3QP5 A;  1EH6 A;  1STZ A;  3JRD A;  4N9I A;  5F08 A;  1FWZ A;  1TW2 A;  1ETX A;  2CUE A;  2E1M C;  2YPR A;  3U21 A;  4GYI A;  3QYB A;  2AHQ A;  2IA1 A;  2IP2 A;  1LKX A;  1CQT A;  3LFU A;  3H36 A;  4NDL A;  4AC0 A;  3ULQ B;  3AFH A;  3I55 I;  3LSM A;  4KIC A;  3OYG A;  2XGX A;  1AA7 A;  1P4A A;  1ZTR A;  3E5Q A;  4NC8 A;  4PJM A;  4CZZ A;  1OCR H;  4JP0 A;  4OIR F;  2ME6 A;  2KIM A;  4P55 A;  2IS4 A;  3HKZ N;  4WXH A;  4XID A;  3OYM A;  1BR2 A;  3CC7 I;  1UAA A;  3JSP A;  5HVQ C;  2IRF G;  1T95 A;  4IHT A;  5EF6 A;  2HTJ A;  3CDH A;  3HPG A;  2CRG A;  4ZYD A;  2D1H A;  3A02 A;  1AKH B;  2QQ9 A;  1IRZ A;  2QF7 A;  4DYC A;  2NRA C;  5HNH A;  3KZZ A;  2F4M B;  2OCC H;  4XLP F;  1O3S A;  5ICE A;  4IHY A;  4JYK A;  4ENN A;  3H9J A;  2OCE A;  2FF4 A;  1UJ8 A;  3MFK A;  5FFX A;  5TIS C;  1FYL A;  5J4V A;  4LJZ F;  2L3D A;  4DJA A;  2EA2 A;  3HDD A;  2HNH A;  2STT A;  5DCM B;  1XSV A;  1IAW A;  3MVP A;  2CUF A;  3F8N A;  4UVA A;  2LKS A;  3SEQ A;  4OOI A;  3HRM A;  1B72 A;  4PJ0 C;  3WTW C;  1OJL A;  3K69 A;  3ZMT A;  3KEO A;  4BEH A;  4HLY A;  5D6E A;  3I4N J;  4A5N A;  3PIO F;  1MSE C;  1T98 A;  1LFP A;  2E2I J;  1JUS A;  2M0C A;  2RV8 A;  3FWE A;  5CVU A;  5KCM A;  2KIF A;  4ZTF A;  1PUF A;  1MMD A;  2ZFU A;  1IUF A;  3CUQ C;  2BGC A;  1D5Y A;  4IHS A;  2PMH A;  1OCO H;  4FHT A;  4S0H B;  2CQX A;  1DU6 A;  5FD5 A;  4XLA A;  1JHH A;  1H9G A;  3GEZ A;  3HHG A;  1OLT A;  5HS7 A;  1OCC H;  2W24 A;  4YRV A;  2DOF A;  1QO0 D;  3JSO A;  5DD4 A;  3BJA A;  3ABU A;  4S04 A;  3DEE A;  4U7B A;  3F22 A;  2CV2 A;  3QPL A;  3OWT A;  4IQ4 A;  4R79 A;  2E19 A;  2IA2 A;  5ILS A;  2DOA A;  4GO1 A;  1LDK B;  3V42 A;  1ON1 A;  2ZC2 A;  4ZDL A;  2NOG A;  4P9U A;  3ISP A;  3HOZ J;  4P5O A;  3ZQI A;  1ORK A;  1QVU A;  3PFI A;  3DEU A;  3O8H A;  3JAM K;  4KJZ A;  2K9Q A;  1GDT A;  5M5Y J;  4F55 A;  3TMO A;  1ZR2 A;  2EWN A;  3SZG A;  2HQ5 A;  4QWQ A;  1QZZ A;  4YIF A;  2P7C B;  3DV8 A;  3BPV A;  4BQN A;  1YIJ I;  3JAM Z;  2UWM A;  3HOU J;  3F72 A;  2G7H A;  4HF1 A;  2G9W A;  2NXN B;  1DPR A;  5DUI A;  1ZG3 A;  3QRF F;  1UHM A;  2XAH A;  3ECH A;  1O3Q A;  2V1D A;  5KAF C;  3GTM J;  3H0D A;  3HUG B;  1W0T A;  1SAX A;  3PM1 A;  4JX6 A;  5EZH A;  3HG9 A;  3PUF A;  3L1P A;  3TP3 A;  1XG1 A;  1XGO A;  3PFY A;  3BC8 A;  4WCG A;  2DDB A;  2XGD A;  1KU2 A;  1FSH A;  3RPQ A;  1JHF A;  4HG2 A;  3G1M A;  2HGC A;  3OR1 C;  2VKV A;  2P5V A;  3VB2 A;  2JUC A;  3DPL C;  1YX3 A;  3G71 I;  3GTG J;  2DA5 A;  2M3A A;  3FZV A;  4NBQ A;  1K78 B;  2QWW A;  2KLO A;  4XKC A;  3HTU A;  2L7M P;  4PZJ A;  3S2H J;  3MKY B;  3GXO A;  1W36 D;  3MKL A;  4B1R A;  1FMV A;  2GOM A;  1BM9 A;  1H88 C;  3QYE A;  4BXU A;  3RI4 A;  1FTT A;  2B9S A;  2Z99 A;  3K70 C;  2JK3 A;  3LA2 A;  5J1R A;  4BBS J;  3D0S A;  2QGU A;  1P7I A;  4G6Q A;  2HOT A;  2KRF A;  4HST A;  2XB5 A;  1X1A A;  3C2H A;  1O57 A;  3WTU C;  4DBR A;  4ESB A;  1ON2 A;  3ZR8 X;  5DYM A;  3OYN A;  1RES A;  4Y15 A;  4I2O A;  3L7W A;  3ZQH A;  3HGY A;  2IAI A;  2XKO A;  1R22 A;  4II3 A;  4DNC A;  3F8M A;  1NHA A;  4HDV A;  2PJR A;  2K3F A;  1XN7 A;  3CJT B;  2HTS A;  3HM5 A;  5CLS A;  2WB1 A;  4G8X A;  5CPR B;  5K7Z A;  1J9I A;  3WU1 B;  4A5M A;  2L0K A;  5GAH J;  1R36 A;  1BI0 A;  1Z6R A;  3V7C A;  1T0F C;  1R6R A;  4KIG A;  1T0F A;  3F3X A;  3OR2 C;  2MH2 A;  2JN6 A;  2Y69 H;  5HOD A;  2W25 A;  3F21 A;  4MHG A;  2Y0S A;  5CVI A;  3GX4 X;  2NS0 A;  2P8T A;  4ENK A;  1VQO I;  4LGW A;  1MW7 A;  5FKN A;  2HVR A;  3M4O J;  3JRG A;  2E35 A;  1G3Y A;  5IPA A;  1VQ5 I;  5LHH A;  5IYC J;  2TRT A;  5C4X J;  1HOM A;  4M9Z A;  1U9N A;  3E6M A;  3CMM A;  5GTH C;  2QSF X;  3I3L A;  3ZQQ A;  1K79 A;  3JRA A;  3GFL A;  1T33 A;  2H6C A;  2ZB9 A;  2ZME B;  4ABZ A;  2LH9 A;  4ENJ A;  3H92 A;  4E7Z A;  2GZW A;  2L7Z A;  2BHZ A;  3FXL A;  3MD2 A;  5TRD A;  2WAE A;  1QGP A;  3BG7 A;  3NWS A;  2HZD A;  3FXJ A;  4A0X A;  4H0E A;  1A5J A;  4XN0 A;  2PJR B;  1I27 A;  2M1B A;  4YIR X;  4RAG A;  2BV6 A;  3ABK H;  5D6F A;  3A1Y A;  2PX9 A;  4C2M J;  3ZQF A;  1LDD A;  3QP6 A;  4Q5S F;  3GBG A;  5LRS A;  1JKR C;  1J7K A;  2XAG A;  1QZE A;  1UFM A;  2K27 A;  1IRF A;  3G6E I;  4GFB A;  1BI3 A;  1JE8 A;  3KFW X;  3CF5 F;  3HOY J;  1R5H A;  1FNN A;  1SD7 A;  3RZO J;  1EH7 A;  5D8K B;  2HXO A;  3KP3 A;  1ZRF A;  1TTY A;  2P4W A;  2ZXJ A;  2AS5 F;  1FC3 A;  1Y8Q B;  4MFD A;  4B3A A;  2VOO A;  3BZK A;  3T5X A;  1A35 A;  4K2E A;  2YSR A;  4XKB A;  5FRM A;  3ZOB A;  1S5L C;  2JVG A;  3EUK L;  1NH3 A;  2M34 A;  4LMY A;  2PLY A;  3HOW J;  2DA2 A;  4E7J A;  4G7Z F;  2BBY A;  5M3F J;  2VJI A;  2K9M A;  2JA8 J;  2ZME C;  3LSI A;  1N25 A;  4MO7 A;  2ZME A;  1ZAO A;  4HNV A;  4M72 A;  2JA6 J;  3V8J A;  2V4J C;  2CG4 A;  5D5V B;  4JK1 X;  2NS7 A;  3IRR A;  1VZ0 A;  1K7A A;  3EQL F;  2DYR H;  5K7H A;  4NQW B;  1I6H J;  1YYV A;  1G3T A;  3CTA A;  1DP7 P;  4RM3 A;  3JTH A;  2GAU A;  4DYR A;  5D5U B;  5E8I A;  2W84 A;  1A6Q A;  4BAC A;  2KRH A;  2BW3 B;  5J6X A;  4Y52 J;  2RRE A;  4W1U A;  4E6K G;  4M6V A;  1FZP B;  3K4C A;  4A0Z A;  1KQ8 A;  3FHZ A;  2E2J J;  3P9I A;  4N9H A;  1V4R A;  4GCV A;  1XDS A;  5J8C A;  5GPA A;  1F1Z A;  3GFI A;  5LD2 C;  3DPU A;  2WB1 N;  3LSR A;  3B02 A;  2OTJ I;  2ZXI A;  4DZJ A;  4YFN F;  3VDX A;  2M8G X;  4XLC A;  2DXI A;  2Q1Z B;  2YU9 J;  2L7F P;  1YX5 A;  2V6C A;  5F1R A;  1VND A;  4PJN A;  4YEJ A;  1XGN A;  4GDF A;  2JSP A;  4GRI A;  3A01 B;  2XSJ C;  4IQJ A;  2ESN A;  1YS7 A;  4HQM A;  2QSH X;  3QYF A;  2FNA A;  1IF1 A;  2J5P A;  3K4K A;  1BJZ A;  2XGE A;  3OSF A;  1YRN A;  3KLO A;  3IKV A;  1G59 A;  2LD5 A;  2DJN A;  2FBI A;  2HYJ A;  3VEP A;  2ISY A;  1I3A A;  2BY3 A;  3IH3 A;  3I64 A;  4A3E J;  1A04 A;  2X1D A;  3BOQ A;  4CCJ A;  3HRT A;  1IN5 A;  2K5C A;  4CYD A;  2XB0 X;  3ZN0 A;  3F6O A;  4AVZ A;  4XRS A;  2N8G A;  4A12 A;  1MSF C;  2JZY A;  2X6X A;  4KIB A;  3OIQ A;  2LC2 A;  2FBH A;  5BS6 A;  1P7J A;  1S9H A;  2M4K A;  4MTD A;  3B6A A;  1ETK A;  3DQV C;  2R7F A;  4CSW A;  2E71 A;  5EG0 B;  1SVO A;  1YE9 A;  1Z91 A;  2IPQ X;  1MDM B;  3PNT A;  2VAS A;  1DU0 A;  2F5E A;  1WQ2 A;  2IXS A;  4C3J J;  4ZYA A;  5ILV A;  2R7U A;  2EV6 A;  5GAG J;  4CHU A;  4AM3 A;  5L3D A;  1FTZ A;  4BBR J;  5J4Y A;  1WJF A;  1TWH J;  2M7B A;  4BUP A;  1H0M A;  3E6D A;  2G0E A;  3FXM A;  2Z3Y A;  4E7S A;  1W7P A;  2L4M A;  2KIS A;  4G9Y A;  4CZC A;  1UG2 A;  3TDU C;  1V5F A;  1B8I A;  5JR3 A;  5D5X B;  4CCN A;  3OIP A;  3H5R A;  3IWF A;  1XDU A;  1WJB A;  4HBL A;  2DDA A;  1R5I D;  4AID A;  1F43 A;  4MLO A;  4CCL A;  4ESF A;  3ABM H;  1VI0 A;  2H6B A;  1AHD P;  2DT6 A;  1V3F A;  4UV8 A;  4XSX F;  1WJC A;  3IP4 B;  2WY7 Q;  1T08 B;  2X4H A;  1D0X A;  3ASN H;  4BQO A;  2HWV A;  4M3E A;  4O6J A;  2ME0 A;  3HEF A;  5J40 A;  5FJ8 J;  3MKW B;  2K86 A;  4PFO A;  3M3Y J;  4IXA A;  2W82 A;  3MZH A;  2HDD A;  2DBB A;  1Y6I A;  1J2X A;  3F0C A;  1R5G A;  4MFE A;  3CCM I;  3DWL E;  4Z6Y A;  4ESJ A;  1XS9 A;  1IN8 A;  2CW0 F;  1OPC A;  3K0L A;  2CFX A;  1LE8 B;  4BE2 A;  1U0J A;  2FNP A;  5KAI C;  3QPT A;  1ITY A;  2BW3 A;  4G7H F;  1HBX G;  2KMU A;  3C2B A;  1D0Z A;  1KZH A;  1A31 A;  4OIP F;  1FBQ A;  2Q2E A;  1OCP A;  4U87 A;  5FLV A;  4BHC A;  1RKT A;  3K1P A;  5L3E A;  3TBI A;  2DA4 A;  3JW4 A;  5IP9 J;  1WH7 A;  4C9Y A;  3LQQ A;  4M3D A;  5ED4 A;  3U1K A;  3KZY A;  4PJL A;  4Q48 A;  4PDK A;  3SHF A;  1IN4 A;  3PQJ A;  3KZI C;  3QOE A;  2RVC A;  1L3L A;  2Y2Z A;  1B9M A;  3RIR A;  4PCQ A;  5LFA A;  3A01 A;  5A2Q Z;  2KJB A;  3FDY A;  2CO5 A;  3PL8 A;  2WV1 A;  4HNT A;  3J7Z I;  2X0L A;  1WFX A;  1XMX A;  1X4O A;  2D2W A;  3S2W A;  3OYK A;  5E3O A;  4OMY A;  1LFU P;  2F6C A;  4AYB N;  4XRM A;  3KP2 A;  5JLX A;  1DQU A;  1OKR A;  3QOD A;  1R9T J;  2E2H J;  3A0H C;  5EGO B;  1JGS A;  3TO7 A;  4M3G A;  2CWE A;  1IRG A;  1E3P A;  2CV1 A;  2GIV A;  4F52 A;  3I53 A;  1MBK A;  3OIO A;  2ZJR F;  1QU3 A;  2MFZ A;  4OIN F;  1QQI A;  1HKS A;  4HX4 A;  1QNT A;  4Q4Z F;  2E5Z A;  2KPM A;  1WZ2 A;  3TOA A;  1SVL A;  2Y75 A;  1OQY A;  3CUQ B;  1EF4 A;  3KE2 A;  2P0W A;  4XLN F;  1G4D A;  2E1C A;  2AO9 A;  4G7O F;  2DA7 A;  1TW3 A;  1BN5 A;  3NAU A;  5CVJ A;  1YW8 A;  3BLY A;  3LNQ A;  1FBS A;  1ZGJ A;  3ABT A;  4D9J A;  3JRB A;  1FIA A;  3OS2 A;  3BTJ A;  3CJR B;  5FD6 A;  2VC0 A;  5A2Q K;  2QKL B;  2E34 A;  3J81 K;  3FM5 A;  1VQP I;  4PGG A;  3TW7 A;  2V1X A;  2VN2 A;  4RAY A;  4G6D A;  3JRE A;  1JXS A;  3BPX A;  5EYR A;  3HKZ A;  4QLC U;  1R23 A;  5F64 A;  3BJ6 A;  4PSW A;  4G6T B;  3IAM 2;  2GXA A;  1U5T B;  3E3V A;  4J00 A;  1JJ8 C;  1GXQ A;  3I54 A;  2R5Z A;  3CME I;  3Q9S A;  3HUG A;  2IGN A;  1G8X A;  3RKY A;  1HKQ A;  1SFU A;  2W48 A;  4XBF A;  4II2 A;  1X3U A;  3JTG A;  2IJL A;  3W6V A;  2JA5 J;  4KYW A;  2FQ3 A;  2R7T A;  1MBF A;  1JUM A;  2JJ7 A;  3HSE A;  1A36 A;  1ONV A;  2PFB A;  2MSY A;  3QU3 A;  3QWL A;  1B72 B;  1V5E A;  1R1T A;  2CUJ A;  3AG3 H;  4XL9 A;  4HV6 A;  3WTY C;  1U5T A;  2L9R A;  2FBK A;  3LL7 A;  1WH5 A;  2R7O A;  3WG7 H;  3FIW A;  2QEN A;  2ACJ A;  3HSR A;  4J19 A;  3GYH X;  1JUP A;  2ZJ2 A;  3HZJ A;  4LLG F;  4ASN A;  1IJW C;  2DTR A;  2IBD A;  1PUF B;  4BQA A;  1XC5 A;  1ZG5 A;  3ML6 A;  2DYS H;  5J1U A;  1MZB A;  2PMZ N;  2KDZ A;  3DTK A;  4XLE A;  2E60 A;  4R8H A;  4NC7 A;  1ZG1 A;  3DKX A;  2QKM B;  2E1M B;  5FLX Z;  3HRU A;  2XRL A;  3C7J A;  4FAS D;  1OYW A;  3ABL H;  1J59 A;  3GW2 A;  1Q1V A;  1LVA A;  2KJC A;  2X9D A;  3E1S A;  1RUO A;  1XGM A;  3C18 A;  3GME A;  2H94 A;  5CKT A;  4UUV A;  1XGS A;  2IEK A;  1J75 A;  5ICF A;  1K4S A;  4XIC A;  2XF5 A;  2ID3 A;  4HYE A;  1K83 J;  2VB6 A;  2R7S A;  1QRY A;  2VLA A;  1DGW Y;  3FMR A;  3JRC A;  4UUT A;  3ZQ7 A;  3MQ0 A;  4KN4 X;  4JOM A;  3OYL A;  2DFI A;  4IKF A;  2V26 A;  1USS A;  5ERI A;  4L9J A;  2VBX A;  3WHC A;  2CJJ A;  3L2V A;  2FML A;  1PJR A;  2VBW A;  2ZSI B;  2GIZ A;  3CO7 C;  3RTR A;  3VYT B;  3S16 J;  2L2O A;  3VYR B;  2I5U A;  2LBF B;  4WF2 A;  2ADU A;  3L09 A;  2O03 A;  1XMK A;  3T8T A;  1BIB A;  1MIJ A;  9ANT A;  4EV0 A;  3CES A;  2O3F A;  4JQF A;  2PMZ A;  4CYC A;  2LY1 A;  4AD9 A;  2YX7 A;  3K4M A;  1AWC A;  3R4K A;  2VJ5 A;  1HW5 A;  1SAU A;  2ZKZ A;  3VPR A;  3R6S A;  2LG4 A;  3EUH A;  4ZH4 F;  5J8F A;  5IY5 H;  1I6X A;  4ZTJ A;  1IDZ A;  2PBI A;  2VJ4 A;  4BEH B;  5ILU A;  3E7L A;  2QM3 A;  5ICC A;  3H35 A;  4LLN A;  5FRN A;  3IWZ A;  5E3L A;  4AIJ A;  1QPI A;  4I01 A;  1Z9C A;  2XAS A;  4NUB A;  3REO A;  5EDN A;  1RRJ A;  4GGG A;  1T2K A;  4LG0 A;  3AG2 H;  3FK6 A;  2CH0 A;  3G1O A;  5L3G A;  1TBX A;  3L2C A;  4I98 B;  4A6E A;  1WJD A;  4CDG A;  3HOV J;  1ETV A;  5LHG A;  4HPQ A;  2R5Z B;  4NC6 A;  1K78 A;  3CDI A;  2LY2 A;  2ZO4 A;  3JRI A;  4FTH A;  1N78 A;  1MJB A;  3MN2 A;  1TP4 A;  3CO6 C;  3DU5 A;  4UY8 I;  3ZMV A;  1JKQ C;  3G2B A;  2VXZ A;  1WPK A;  2RAE A;  5E3N A;  2NAZ A;  4LD5 A;  2MGQ A;  2Y31 A;  3F8F A;  2PMU A;  3CP2 A;  4L18 B;  3RKW A;  1K4T A;  5C44 J;  2B7E A;  2VXD A;  4A3M J;  2OV7 A;  1ZLK A;  3QPH A;  2ZXW H;  3MZ8 A;  2RNG A;  3K4B A;  1KQ0 A;  4QSH A;  5IYD J;  2DI3 A;  4Y33 A;  3W2V A;  1LB2 A;  3QQA A;  4EAT A;  5DCM A;  1SD6 A;  3HOS A;  2KIU A;  3WOD F;  2VQH A;  1Z05 A;  3H0G J;  3B73 A;  4I0B A;  1HDD C;  3U9G A;  2LMD A;  1MKM A;  3LAP A;  1X3W B;  4PJJ A;  1LPQ A;  4E7H A;  1S29 A;  1Z0X A;  1E3H A;  3HJE A;  3L2U A;  3DBH B;  4RB0 A;  1PUE E;  4KNY A;  2XSD C;  5HOO A;  3E97 A;  2FX0 A;  2IGO A;  2JVH A;  3OYE A;  4O5V A;  2LF8 A;  3TO9 A;  4XOT A;  3VOD A;  3U2R A;  3ESW B;  4EM2 A;  3E6C C;  2JA7 J;  3H9Q A;  3M8J A;  5DTD A;  3NWT A;  2A6T A;  3WGI A;  2K4B A;  1B9N A;  4EJO A;  4GXO A;  1YG2 A;  2DCE A;  2QBY B;  4RGU A;  3S17 J;  3L00 A;  4HX8 A;  4YG2 F;  4OMZ A;  3ZQC A;  2QUF A;  5F1J A;  2R7Q A;  3DFG A;  3E5U A;  3WGH A;  4QTR A;  4UXN A;  5HDK A;  4Y17 A;  3BT9 A;  2W4S A;  1MGT A;  1I3Q J;  2RKH A;  4L5J A;  5J3L A;  3KEY A;  5GAE J;  2DU9 A;  3H3Z A;  4KUM A;  3BTC A;  2VKE A;  5E8G A;  2Y30 A;  1LEB A;  2Y9Z A;  5D5W B;  2JTV A;  4C2U A;  5FKL A;  2WWY A;  2LP0 A;  3JR9 A;  1RC9 A;  4EMS A;  2W00 A;  4KMU X;  4E70 A;  1Z7L A;  4RM2 A;  1HW1 A;  1ZLJ A;  2M87 A;  1QHG A;  3K6G A;  4Y3O A;  1MMS A;  4TV7 A;  5EEA A;  1E17 A;  1ZEL A;  4FX4 A;  2H27 A;  3O3K A;  1YW7 A;  1SFE A;  2KIQ A;  1MJA A;  2NVY J;  2ISZ A;  1F36 A;  2LOO A;  2X6Y A;  3OS0 A;  4LG0 B;  3G3Z A;  2HFH A;  3LSG A;  1S8N A;  4RGX A;  1ULY A;  2F5F A;  3SYT A;  2GQQ A;  1LNW A;  4HSR A;  5LRR A;  1SEU A;  5BOX A;  3CP8 A;  5DM7 F;  1MBJ A;  4B4C A;  1MND A;  3A4C A;  2HVQ A;  5JHU A;  4KIS A;  3K4J A;  5FRO A;  1RNL A;  2MA3 A;  2EZH A;  2K85 A;  2V9K A;  4YFK F;  2LNB A;  2X6O A;  2H8R A;  5L3C A;  1IV6 A;  1QHH D;  2VKH A;  4FQG A;  4HA8 A;  3HC7 A;  1TWA J;  2P6S A;  4F3Q A;  3S1M J;  3V8L A;  2RQP A;  3T1B A;  2O0Y A;  3DF8 A;  5H6R A;  2ZFW A;  2GWR A;  4U0V A;  2X48 A;  2BEO A;  3OYI A;  3RKX A;  1TQI A;  3M07 A;  1HDP A;  1I5Z A;  3N05 A;  5KNL A;  4HOB A;  2KT0 A;  3N4M A;  2WTE A;  4I6Z A;  2EH3 A;  5K5O A;  2HKX A;  4ZDP A;  2K9N A;  1YJW I;  4I99 C;  3CCJ I;  1VQ4 I;  2ZNZ A;  1T38 A;  4F92 B;  1R00 A;  2V1N A;  2QVO A;  3PIP F;  2AXL A;  4AIH A;  5E1X A;  4U88 A;  3W2W A;  2R5Y B;  4BNC A;  4HNU A;  5TGT A;  1YLF A;  5LEK A;  2XKP A;  5F0F A;  1BL0 A;  3F8B A;  1B59 A;  2AQE A;  3F23 A;  3HTS B;  1V5G A;  4EJU A;  1HST A;  3O6B B;  4M71 A;  5EEG A;  5EGO A;  2ZCW A;  2VPR A;  3IAS 2;  5HNF A;  1HF0 A;  3DU6 A;  3EUA A;  1ZHF A;  4I7H A;  3CF2 A;  1HQC A;  1TT0 A;  1LJ9 A;  2DT5 A;  3S32 A;  2LBF A;  2K9L A;  3IUO A;  1X3Z B;  3LAJ A;  3TQN A;  2VOD A;  4A93 J;  1CGP A;  4LOC A;  5CVV A;  2OD5 A;  1BI1 A;  2YUS A;  4ANJ A;  4PFP A;  3Q0V A;  2MYS A;  2EZK A;  2NVX J;  3ZCO A;  4C2T A;  4HF0 A;  1ZGA A;  1SD4 A;  4XQF A;  1TZL A;  1IG7 A;  2GOX B;  2O9L A;  3U1D A;  4HV5 A;  3K1N A;  3J80 Z;  5FKM A;  1IO2 A;  3LQR A;  1YHQ I;  1Y39 A;  2MG4 A;  2LTP A;  3KIO A;  4P1W A;  3I4M J;  2VKD A;  4OAZ A;  1OCT C;  2VQC A;  2EFP A;  2JQ7 A;  2JUG A;  1FY7 A;  1QZY A;  2JRT A;  3I4P A;  1DUX C;  2L02 A;  2OU2 A;  3R60 A;  2EZL A;  4HQE A;  1LEA A;  4HRI A;  2CUZ A;  5IP7 J;  3I56 I;  3T8R A;  4DYQ A;  2TDX A;  4IRG A;  1SVM A;  1FMW A;  1RUN A;  3BG9 A;  1X1C A;  2IGM A;  2FUG 2;  2VT3 A;  5BNG A;  1W5S A;  5E18 F;  2HR3 A;  3ZXS A;  1YQA A;  2XAQ A;  1KON A;  2DA3 A;  2HKO A;  2ZXH A;  1MMG A;  4IO9 F;  3PO2 J;  2H8W A;  3N97 A;  2V79 A;  1D8K A;  1S7O A;  1JI8 A;  1VQ7 I;  2BE5 F;  3SZP A;  5DDG A;  2Z33 A;  2EPF A;  5CVR A;  5FB2 A;  1P4X A;  1U9O A;  1ZYR F;  3R61 A;  3W6J B;  1FYM A;  1BC7 C;  1E2X A;  4I09 A;  3CCL I;  1O3R A;  4M3F A;  1ETW A;  2X51 A;  3NQO A;  5EEH A;  2DLL A;  1DP3 A;  1K6O A;  1U8R A;  2M9H A;  2BVM A;  1L0O C;  2E7X A;  1NG7 A;  4O3M A;  4I0A A;  3ZMZ A;  1MJ9 A;  5GTI C;  1HW2 A;  1BJA A;  2Y0S N;  4ZYE A;  2DTZ A;  4D5C A;  2A5Y B;  1V54 H;  1KA8 A;  3DKW A;  2R4G A;  1OIS A;  1U3E M;  4Y7N J;  2M5W A;  1SFK A;  1BW5 A;  3KYL A;  2KDO A;  4XMY A;  5HLI A;  1UHW A;  4C30 A;  4EGY A;  1FSE A;  1HSJ A;  5LBQ A;  3PSF A;  2EIM H;  3EYI A;  2CS3 A;  1GLN A;  2ETH A;  3RQ4 A;  3FXU A;  2VE9 A;  3FM3 A;  2PN6 A;  3JCU C;  1U2W A;  3GO5 A;  2DN0 A;  3AL0 B;  1W5C C;  3BCB A;  1K61 A;  2EZI A;  1X19 A;  2F5D A;  3E6B A;  3EET A;  2MH9 A;  1GUU A;  2QZ8 A;  2EFQ A;  2MW8 A;  3LSK A;  2ELJ A;  3H3U A;  3IHU A;  3E0J B;  3LFK A;  2JRM A;  2F4O B;  3GWZ A;  5K1Y A;  2V6E A;  4B47 A;  1KQ9 A;  5HDG A;  3CCU I;  1NK3 P;  2R7Z J;  1UCR A;  2ICW G;  2O8X A;  5F04 A;  1UZC A;  3NRV A;  1TLH B;  4BYY A;  2DA1 A;  2ESH A;  1MBH A;  1Q1H A;  2V9V A;  2X85 A;  1F4K A;  1Y0U A;  3ZQL A;  4S05 A;  5D4R A;  3FXO A;  2MAB A;  4A3D J;  2QEX I;  3RYR A;  4IJA A;  2ID6 A;  4P9F A;  4D0P A;  1GHC A;  2LLK A;  4Y4R A;  3HL2 A;  1MD0 A;  1BR4 A;  3CCY A;  3OV8 A;  3VYS B;  1DDN A;  2IVM A;  5IT3 A;  2Q8K A;  4IOA F;  3FKJ A;  3I5U A;  5BPD A;  3A03 A;  4HDU A;  5AON A;  1VF9 A;  3VSK A;  3MAJ A;  3VYU B;  1ZK8 A;  1DGR M;  2UXN A;  2VIX A;  3OL3 A;  2XIG A;  5H6Q A;  2HDW A;  5LHI A;  5M5W J;  3GCM A;  3RQI A;  2X1C A;  1OR7 A;  5EG0 A;  2COB A;  3CCE I;  3SJM A;  3OMY A;  4XLF A;  3L9F A;  3M1E A;  4YII A;  2XPW A;  2F5C A;  3CCV I;  5EZG A;  2QQA A;  4BJ6 C;  4ON0 A;  2AXT C;  4RMN A;  1IXS B;  1D1C A;  3RKQ A;  2BY1 A;  1P4W A;  3GZN B;  1IN6 A;  4BKX A;  4RBO A;  3WU0 A;  1BA5 A;  2FQ4 A;  3S3O A;  4EEF G;  1KU3 A;  4E7K A;  4KMF A;  2EQR A;  3DP7 A;  3V7R A;  4ZYH A;  5J47 A;  1TT5 B;  3UKG A;  1KYZ A;  2ZSH B;  5IYB J;  2W85 A;  1AOY A;  2FU4 A;  1JT6 A;  2QSG X;  2EV5 A;  4EJV A;  1TQM A;  1QA6 A;  2XUB A;  2NOJ B;  3KYC B;  2LKP A;  4WX9 A;  3GTP J;  2JPC A;  2RDP A;  2GA1 A;  3FXQ A;  2R92 J;  3LOC A;  2P81 A;  5H20 A;  3TO6 A;  5B66 C;  1H89 C;  4OIO F;  3K10 A;  1ETO A;  5FKK A;  4G94 A;  1LVK A;  4N4O B;  4V19 K;  2OF7 A;  4C3H J;  2NS8 A;  2LRD A;  1W36 C;  1RKW A;  2K02 A;  2OBP A;  3PUB A;  3LA7 A;  3D5R C;  3OYA A;  2ELH A;  1C0W A;  2CSO A;  1S72 I;  1ERD A;  3K70 D;  1WCM J;  2VJJ A;  4CA0 A;  4XKW A;  3RYP A;  3S3M A;  1ZAR A;  2R0Q C;  3W6K B;  2E5N A;  4BU2 A;  3CJN A;  1TWG J;  3FF5 A;  4UVB A;  1GXP A;  1SMY F;  2LVS A;  2DFE A;  5B1B H;  2XHK A;  3ZQG A;  3Q0U A;  2ECB A;  2OQG A;  3T0Y A;  5M5X J;  4BY1 J;  1R4M B;  3BTI A;  1OMI A;  3WTX C;  1WRJ A;  3HIF A;  2UXX A;  2M7A A;  1DPU A;  5DS9 A;  3GTO J;  4HZF A;  1XCV A;  5EJC A;  2BHY A;  4DOZ A;  1MBE A;  4H4K C;  2VOP A;  3DTI A;  4A69 C;  4CCO A;  1J5Y A;  5E79 C;  4LK0 F;  4ZC3 A;  1R1V A;  1XCB A;  3KEQ A;  1IXC A;  1FP1 D;  3J7Y J;  1YFH A;  1I39 A;  1YO5 C;  1HCR A;  1JTX A;  1OFC X;  1U78 A;  1ZQ3 P;  4MEY F;  3VSL A;  3LWF A;  1YI2 I;  3B6C A;  5FLM J;  1FEX A;  3RSN A;  3ERM A;  2HQR A;  1G2H A;  3BR6 A;  3TOB A;  1RR7 A;  1XMA A;  5IT9 Z;  2DMP A;  2OA4 A;  2FD5 A;  4BH9 A;  1P9Q C;  2JPB A;  4ZDO A;  4E4H A;  3CDL A;  3M9A A;  1Y56 A;  3EYY A;  3GUD A;  3P9C A;  2UUZ A;  4HF2 A;  1VTN C;  3BWG A;  4FX0 A;  4BAY A;  4CCM A;  3GTJ J;  3CCQ I;  3WTV C;  3KP5 A;  2DO7 A;  2NVT J;  3HXL A;  2WY8 Q;  2XRN A;  4A3C J;  1FBU A;  2VBZ A;  2BXY A;  2MLK A;  3SXY A;  4RA2 A;  2XAU A;  3CUO A;  2EIK H;  3GFM A;  4XOR A;  4KA4 A;  3MZY A;  3O2P E;  5LGU A;  5E17 F;  1X1D A;  4DGW B;  3TDZ C;  1REP C;  3K4N A;  4XRF A;  2VQL A;  1MNM C;  1P2F A;  4L0Z B;  2LF7 A;  2CW8 A;  1EKE A;  4NNJ A;  1T6S A;  3IKT A;  3JRF A;  5TJJ A;  1NG6 A;  3OOU A;  4LIU A;  1XB4 A;  4CH7 A;  4KIT B;  2F5V A;  3PNY A;  4IF4 A;  2BOL A;  3FK7 A;  4N0B A;  3HSF A;  3GTQ J;  5K7F A;  4AUX A;  3CUQ A;  4F7Z A;  4QIW N;  3KLN A;  3LMM A;  5E1Z B;  5BPI A;  1R49 A;  4IHW A;  4OAY A;  4EGZ A;  3VOE A;  4CXF A;  2JWT A;  1XTA A;  2V9P A;  3KPH A;  4IVN A;  2R7W A;  4Q47 A;  3PNV A;  2RC4 A;  5L3B A;  1LUJ B;  3RCO A;  4UUS A;  1BR1 A;  4MNU A;  1EH8 A;  3ELK A;  3A2K A;  3M1C A;  3TP0 A;  1ODD A;  2YS9 A;  3GVA A;  2HEO A;  1VQ9 I;  3M8E A;  3BDD A;  2YR2 A;  3K1M A;  1YJ9 I;  4LB6 B;  1IRX A;  1S3J A;  2WA0 A;  1XPX A;  1FOW A;  1OYI A;  1BOA A;  5B5E C;  1HKT A;  3ECO A;  4A3G J;  3R0A A;  2DPD A;  2B0L A;  3BR3 A;  5H2F C;  4B8X A;  4RAF A;  2L54 A;  1ZKG A;  2VQG A;  5LLQ A;  3MEX A;  5J1Y A;  1IC8 A;  3OS1 A;  2Y0M A;  3DBL B;  2L7K A;  3LSH A;  1YRN B;  4AVP A;  2X6W A;  2STW A;  4WWC A;  2QBY A;  2OUM A;  1XSX A;  4WXD A;  1H8A C;  3GFJ A;  3GZ6 A;  1BC8 C;  1ZRD A;  1EJ9 A;  3LST A;  3DXJ F;  1O3T A;  2DOE A;  1Z67 A;  3IL2 A;  4DIQ A;  4BY7 J;  2Q0O A;  3IH4 A;  5GP9 A;  2R7V A;  5BQT A;  2FJ1 A;  3V4G A;  2XDV A;  1HC8 A;  3J80 K;  1LFB A;  2Z9O A;  2B63 J;  3SQN A;  2QQB A;  1KU9 A;  4RGR A;  3SFZ A;  2GBY A;  3MWM A;  4IPA A;  2WBM A;  2VON A;  1X2N A;  2FOK A;  2LSO A;  2WC2 A;  2WAQ A;  1HA8 A;  4XLH A;  3COA C;  1OYY A;  5F27 A;  2MC4 A;  4UB6 C;  4M3B A;  1F5T A;  2MBF A;  2UV1 A;  2IS2 A;  5ICG A;  3FMQ A;  3S1Q J;  2VT2 A;  1AU7 A;  2EFW A;  1VQK I;  2G7U A;  1XD7 A;  5IP6 A;  5DM6 F;  4RAZ A;  4XK4 A;  2VE8 A;  3GTK J;  3K7A J;  1J0R A;  2OJE D;  3Q9V A;  1MBG A;  3WHB A;  1B6A A;  3S8P A;  3LSP A;  3FXR A;  2KL4 A;  2DMQ A;  2OPT A;  1GVD A;  1WI9 A;  2LFB A;  3HB9 A;  3FMS A;  3BZC A;  4BDY A;  2XC7 A;  4CCK A;  3QAH A;  1FT9 A;  2DK5 A;  2HPI A;  3BG6 A;  4ZYG A;  4XOP A;  2DFF A;  2UZK A;  4LB5 A;  2LK2 A;  1ZR4 A;  1GT0 C;  2YU3 A;  1UEL B;  1RIO H;  1VQN I;  1R1U A;  5FGM A;  1YOV B;  2A3S A;  3BZ6 A;  4RB2 C;  1YIO A;  1A6I A;  4UHT A;  3HGG A;  3BR1 A;  4QPO A;  3J81 Z;  2E36 A;  1VQL I;  4KT6 A;  4EVI A;  1IZ1 A;  2O8K A;  4V2F A;  1ENH A;  3R0J A;  5JHF A;  4A3L J;  4RLQ A;  4KT5 C;  4L5I A;  5LGT A;  1KU7 A;  1BW6 A;  3FBI B;  2FE3 A;  3W3C A;  1W7P D;  3IH2 A;  4B43 A;  3Q0W A;  1D1A A;  3HYI A;  3KP4 A;  1K6Y A;  1WI3 A;  2E1N A;  1G3S A;  1UG0 A;  2LR8 A;  3HBL A;  4M6Y A;  4XON A;  4RDU A;  2XRO A;  1Y1V J;  2H1K A;  2DPU A;  2XPV A;  4BE1 A;  4HEA 2;  2CW7 A;  3Q5F A;  3ZMS A;  5IOY A;  3CMY A;  2WAQ N;  5IOZ A;  3HOX J;  3EUH C;  5BMZ A;  5JVT A;  3L2W A;  2QCO A;  3IV5 A;  1U8B A;  1IN7 A;  3W2A A;  4EM0 B;  5HDN A;  4M73 A;  3J7A Y;  1M1E B;  2CV0 A;  4EJT A;  4R1H A;  2CFO A;  2PJP A;  2C6Y A;  1EA3 A;  5DD8 A;  3RPU D;  1W0U A;  3I59 A;  2CQN A;  2A69 F;  5CQG A;  2HOS A;  2ECC A;  1SFX A;  2K40 A;  3K4L A;  4M74 A;  4ITV A;  4XM3 A;  5CQE A;  4M6X A;  5M3M J;  3V8K A;  1W7P B;  1Y0N A;  1B8I B;  2KZV A;  2O7O A;  3EPZ A;  2DOD A;  2P5K A;  4IRI A;  3ZP5 A;  4P96 A;  2DMT A;  5F6F A;  1LE8 A;  2FXA A;  4D7M A;  4ENM A;  3DEW A;  4MIM A;  1OR7 C;  3EDP A;  4BJ5 C;  1ETY A;  1W4M A;  4WXC A;  2EA4 A;  3CCS I;  3D5S C;  4DZP A;  1P6R A;  1WJ5 A;  3M8F A;  3HOT A;  3DBR B;  2P7V B;  1I1G A;  1O7L A;  4IRH A;  1QPM A;  3ERE D;  2HPM A;  3LA3 A;  3C1D A;  4FCY A;  4V2G A;  2FMY A;  3WG9 A;  4ZJZ A;  2NYX A;  4HAM A;  3OYH A;  4RGS A;  3AAF A;  1YIT I;  2EB7 A;  2OZU A;  3M7G A;  1SFO J;  1VFC A;  3AKZ A;  2CQK A;  2HOA A;  4A0Y A;  4KDP A;  1PYV A;  4LLL A;  3TKY A;  2RNJ A;  2CYY A;  4XNF A;  2GA2 A;  4FE7 A;  2A05 A;  1NK2 P;  2Z5U A;  2MD5 A;  2EIL H;  2R7D A;  1W5T A;  1RZ4 A;  4Z2Y A;  3BP8 A;  3I59 B;  3SFI A;  1WJA A;  3F9K A;  3FX3 A;  4L9T A;  3RZD J;  5FFZ A;  3MMY B;  2LY9 A;  3DTE A;  3KET A;  1H9T A;  3I0T A;  3GZ5 A;  2Z2S B;  3HHH A;  3KX2 A;  2PEX A;  3TW6 A;  2W57 A;  1IUY A;  2YX4 A;  4DW6 A;  4BL0 B;  3PO3 J;  1U6G A;  1ZN2 A;  5C3E J;  1BIA A;  5CJ9 A;  2DQR A;  1RPW A;  3CCR I;  1X58 A;  2LRE A;  4W97 A;  3SZT A;  2DMN A;  4PUS A;  1JGG A;  1GV2 A;  3A0B C;  3F6V A;  2LKX A;  1Z7U A;  5L3F A;  3DCF A;  4FET A;  5C4J J;  1VQM I;  2F4I A;  2XAJ A;  3VWB A;  2WV0 A;  2OQR A;  1Z77 A;  4BXX J;  3FXK A;  1JKP C;  5E20 A;  4UB8 C;  2ZJP F;  2L9V A;  4IL6 C;  5KK1 A;  5HLH A;  1IXR C;  1WVR A;  2LDU A;  1R71 A;  5DCF A;  3P9K A;  4U0W A;  5F0H A;  2COM A;  1RET A;  2R5Y A;  2MD0 A;  3IRQ A;  3FIS A;  2TCT A;  3BR2 A;  1UB9 A;  2HI3 A;  4XKV A;  1ACI A;  2GXG A;  2RQQ A;  1X4P A;  4A3I J;  3E5X A;  4C3I J;  2HOE A;  2BY2 A;  3FKI J;  1AKH A;  3J7A O;  1TWC J;  1QBJ A;  2CU7 A;  4B48 A;  1PP8 F;  1D0Y A;  1Z21 A;  1QVT A;  4BHP A;  2ZBK A;  3G1L A;  2OAZ A;  3BG3 A;  4J01 A;  2EIN H;  1O4X A;  5HS9 A;  5E3M A;  2GXB A;  4QPQ A;  1O7F A;  1YTY A;  2KZG A;  4M9X A;  3CC4 I;  2AQF A;  4A3J J;  3AL0 C;  2DT7 B;  1WHU A; 
#chains in the Genus database with same CATH homology
 1RI7 A;  3F8C A;  3VFZ A;  3OOP A;  1PDN C;  2O6G E;  2EK5 A;  3GF2 A;  4ETS A;  2A6E F;  4Y13 A;  2HDC A;  3C3W A;  2VBY A;  4NQW A;  4HX7 A;  2PI0 A;  2QLZ A;  2BYV E;  2L4A A;  5HS8 A;  4OIQ F;  1WWX A;  4U0Y A;  5E1W A;  2A07 F;  2XV4 S;  5IT9 K;  2ZNY A;  1Z6T A;  5K5R A;  3QU6 A;  2FSW A;  1FP2 A;  4JBA A;  4UV9 A;  4L0Y B;  1EV7 A;  4PGH A;  5HLG A;  5AIP A;  4MQ9 F;  3WE2 A;  1BI2 A;  2F2E A;  4HLX A;  1R58 A;  1ZRE A;  5D8L B;  1MDM A;  5D4S A;  1CF7 A;  1D5V A;  3NEU A;  2NNY A;  1GVJ A;  2DAO A;  1D3Y A;  5DEQ A;  2J5O A;  6PAX A;  4L9V A;  3IC7 A;  1R7J A;  1F9N A;  2JT1 A;  3K9T A;  2EV0 A;  3ZN1 A;  3BJO A;  2MLG A;  4KIF A;  3WTS C;  3MCZ A;  4RB3 C;  3RDI A;  4A2U A;  5FLX K;  1TNT A;  2DK8 A;  2RGV A;  3ROU A;  1B1B A;  5CYV A;  3BY6 A;  4LK1 F;  1U5T C;  2XAF A;  2V1U A;  2RN7 A;  1WKM A;  2A61 A;  2EJR A;  3GLX A;  2IW5 A;  1S6L A;  1ZH5 A;  1G3W A;  2OZ6 A;  5AIQ A;  2MC3 A;  4MEX F;  1CF7 B;  1ZRC A;  4CIC A;  3KCC A;  4L9N A;  1UST A;  2D45 A;  1FPQ A;  4MTE A;  2M8E A;  2FEZ A;  1G6N A;  2H09 A;  2FRH A;  5JI6 A;  4I02 A;  1FYK A;  1WSU A;  2O61 A;  1B4A A;  4AWX B;  4HW0 A;  1KGS A;  2PG4 A;  2HZT A;  2HQN A;  1FLI A;  4M9S A;  4CGZ A;  2DW4 A;  5JFR A;  4KFC A;  2Y48 A;  1YW9 A;  5K5Q A;  2FA5 A;  4NHJ A;  1TQP A;  4EM1 A;  1BBY A;  4DQ2 A;  2DQL A;  4UVC A;  2VC1 A;  1P92 A;  4ZZL A;  1YS6 A;  1SMT A;  4A6D A;  4UNO A;  4BHB A;  4B09 A;  3BRO A;  3KP6 A;  2A6H F;  4EJW A;  1FX7 A;  4ZZD A;  4EQQ A;  1Z1D A;  2K7L A;  2JSC A;  2IA0 A;  3HRS A;  3ZMD A;  3DPT A;  1LQ1 A;  3WE3 A;  2HYG D;  2PQ8 A;  2NNN A;  3RPU A;  5LGN A;  2XVC A;  2E7W A;  2L01 A;  3KP7 A;  1T39 A;  1XSD A;  3QOP A;  1FOK A;  2HS5 A;  1KYW A;  5LEJ A;  2M45 A;  5DUK A;  2CGP A;  3CLO A;  4FT8 A;  3RJP A;  2EFO A;  2R3S A;  4KN7 X;  4MQV A;  3G73 A;  2HYF A;  4CO8 A;  4MGR A;  1IW7 F;  1D8J A;  1S7A A;  4LFU A;  2K4J A;  4AIK A;  3ZPL A;  1I1S A;  1HXD A;  1TNS A;  4XSZ F;  4NB5 A;  3P7N A;  4OU0 A;  2EFN A;  4WK8 F;  5KVR A;  3PQK A;  1LDJ A;  2M30 A;  4YFX F;  5FO5 A;  2P6T A;  3D5L A;  4U7D A;  2A68 F;  2IT0 A;  3V7S A;  3WTT C;  3K2Z A;  3WTZ A;  3I58 A;  3ZMU A;  2KKO A;  2D1V A;  3WGG A;  1PP7 U;  2P5L C;  5DV5 A;  2QYO A;  4RS8 A;  4RB1 A;  4GYG A;  3TGN A;  1SD5 A;  3I71 A;  3QP5 A;  1EH6 A;  1STZ A;  4N9I A;  1FWZ A;  1TW2 A;  2YPR A;  4GYI A;  2IA1 A;  2IP2 A;  3ULQ B;  4KIC A;  2XGX A;  1P4A A;  3E5Q A;  4CZZ A;  4OIR F;  2KIM A;  4P55 A;  4WXH A;  3JSP A;  5HVQ C;  2IRF G;  4IHT A;  2HTJ A;  3CDH A;  4ZYD A;  2D1H A;  2QQ9 A;  2NRA C;  3KZZ A;  4XLP F;  1O3S A;  5ICE A;  4ENN A;  2FF4 A;  3MFK A;  5FFX A;  1FYL A;  4LJZ F;  2L3D A;  2EA2 A;  2STT A;  5DCM B;  1XSV A;  1IAW A;  3F8N A;  4UVA A;  4OOI A;  3HRM A;  3WTW C;  3K69 A;  3ZMT A;  3KEO A;  4HLY A;  5D6E A;  4A5N A;  1T98 A;  2RV8 A;  3FWE A;  5CVU A;  2KIF A;  3CUQ C;  2BGC A;  4IHS A;  2PMH A;  4FHT A;  5FD5 A;  1JHH A;  1H9G A;  3GEZ A;  3HHG A;  5HS7 A;  2W24 A;  1QO0 D;  3JSO A;  5DD4 A;  3BJA A;  3ABU A;  4S04 A;  4U7B A;  3F22 A;  4R79 A;  2IA2 A;  5ILS A;  4GO1 A;  1LDK B;  1ON1 A;  4P9U A;  3ISP A;  4P5O A;  3PFI A;  3DEU A;  3JAM K;  2EWN A;  4QWQ A;  1QZZ A;  4YIF A;  2P7C B;  3DV8 A;  3BPV A;  3JAM Z;  2UWM A;  3F72 A;  2G7H A;  4HF1 A;  2G9W A;  5DUI A;  1DPR A;  3QRF F;  1ZG3 A;  1UHM A;  2XAH A;  1O3Q A;  3ECH A;  2V1D A;  1SAX A;  1XGO A;  4WCG A;  1FSH A;  1KU2 A;  3RPQ A;  1JHF A;  2HGC A;  3VB2 A;  2P5V A;  3DPL C;  3FZV A;  1K78 B;  2QWW A;  3HTU A;  4PZJ A;  3GXO A;  1BM9 A;  4BXU A;  3RI4 A;  2Z99 A;  3LA2 A;  3D0S A;  4G6Q A;  2KRF A;  3WTU C;  1O57 A;  4ESB A;  1ON2 A;  5DYM A;  4Y15 A;  4I2O A;  3L7W A;  2XKO A;  1R22 A;  4DNC A;  3F8M A;  1NHA A;  4HDV A;  1XN7 A;  2HTS A;  5CLS A;  4G8X A;  1J9I A;  3WU1 B;  4A5M A;  1R36 A;  1BI0 A;  1Z6R A;  3V7C A;  4KIG A;  1T0F A;  3F3X A;  2MH2 A;  2W25 A;  3F21 A;  4MHG A;  5CVI A;  3GX4 X;  2NS0 A;  2P8T A;  4ENK A;  4LGW A;  1G3Y A;  5LHH A;  4M9Z A;  3E6M A;  1K79 A;  3GFL A;  2H6C A;  4ENJ A;  2ZME B;  3H92 A;  2GZW A;  5TRD A;  1QGP A;  4A0X A;  4H0E A;  1I27 A;  2M1B A;  2BV6 A;  5D6F A;  1LDD A;  3QP6 A;  4Q5S F;  5LRS A;  1J7K A;  2XAG A;  1UFM A;  2K27 A;  1IRF A;  1BI3 A;  1JE8 A;  3KFW X;  1R5H A;  1FNN A;  1SD7 A;  1EH7 A;  5D8K B;  3KP3 A;  1ZRF A;  1TTY A;  2AS5 F;  2P4W A;  2ZXJ A;  1FC3 A;  2VOO A;  3T5X A;  4K2E A;  2YSR A;  4LMY A;  2PLY A;  4G7Z F;  2BBY A;  2ZME A;  1ZAO A;  4M72 A;  3V8J A;  2CG4 A;  5D5V B;  4JK1 X;  3IRR A;  1K7A A;  3EQL F;  1YYV A;  1G3T A;  3CTA A;  1DP7 P;  3JTH A;  2GAU A;  5D5U B;  5E8I A;  2W84 A;  5J6X A;  1FZP B;  4A0Z A;  1KQ8 A;  3FHZ A;  3P9I A;  4N9H A;  1V4R A;  4GCV A;  1XDS A;  5J8C A;  3GFI A;  1F1Z A;  3B02 A;  4YFN F;  2V6C A;  5F1R A;  1XGN A;  2ESN A;  1YS7 A;  4HQM A;  2FNA A;  1IF1 A;  2J5P A;  3KLO A;  3IKV A;  2FBI A;  3VEP A;  2ISY A;  3I64 A;  1A04 A;  3BOQ A;  3HRT A;  1IN5 A;  4CYD A;  3ZN0 A;  3F6O A;  4A12 A;  2JZY A;  4KIB A;  5BS6 A;  2FBH A;  4MTD A;  3DQV C;  2R7F A;  2IPQ X;  1Z91 A;  1MDM B;  2F5E A;  1WQ2 A;  5ILV A;  2EV6 A;  4CHU A;  5L3D A;  1H0M A;  3E6D A;  2Z3Y A;  1W7P A;  2L4M A;  4G9Y A;  3TDU C;  5JR3 A;  5D5X B;  3IWF A;  1XDU A;  4HBL A;  4ESF A;  2H6B A;  1V3F A;  4UV8 A;  4XSX F;  2X4H A;  2HWV A;  4O6J A;  2K86 A;  4IXA A;  3MZH A;  2DBB A;  1J2X A;  1R5G A;  4ESJ A;  1IN8 A;  2CW0 F;  1OPC A;  3K0L A;  2CFX A;  2FNP A;  3QPT A;  4G7H F;  1HBX G;  4OIP F;  1FBQ A;  2Q2E A;  4BHC A;  3K1P A;  5L3E A;  3JW4 A;  3LQQ A;  5ED4 A;  3KZY A;  4Q48 A;  4PDK A;  3SHF A;  1IN4 A;  3PQJ A;  2RVC A;  1L3L A;  1B9M A;  3RIR A;  4PCQ A;  5A2Q Z;  2KJB A;  2CO5 A;  2X0L A;  2D2W A;  3S2W A;  4OMY A;  3KP2 A;  1OKR A;  1JGS A;  3TO7 A;  2CWE A;  1IRG A;  2GIV A;  3I53 A;  4OIN F;  1QQI A;  1HKS A;  4HX4 A;  1QNT A;  4Q4Z F;  3TOA A;  2Y75 A;  3CUQ B;  3KE2 A;  4XLN F;  1G4D A;  2E1C A;  4G7O F;  1TW3 A;  1BN5 A;  5CVJ A;  1YW8 A;  1FBS A;  1ZGJ A;  3ABT A;  5FD6 A;  2VC0 A;  5A2Q K;  3J81 K;  3FM5 A;  4PGG A;  2V1X A;  2VN2 A;  4RAY A;  4G6D A;  1JXS A;  3BPX A;  4QLC U;  1R23 A;  5F64 A;  3BJ6 A;  1U5T B;  3E3V A;  1GXQ A;  3I54 A;  3Q9S A;  3HUG A;  3RKY A;  1HKQ A;  1SFU A;  4XBF A;  1X3U A;  3JTG A;  2IJL A;  4KYW A;  2FQ3 A;  3HSE A;  1ONV A;  2PFB A;  3QU3 A;  1R1T A;  3WTY C;  4HV6 A;  1U5T A;  2FBK A;  2QEN A;  2ACJ A;  3HSR A;  3GYH X;  2ZJ2 A;  4LLG F;  4ASN A;  2DTR A;  4BQA A;  1ZG5 A;  3ML6 A;  1MZB A;  4R8H A;  1ZG1 A;  5FLX Z;  3HRU A;  3C7J A;  1OYW A;  1J59 A;  3GW2 A;  1LVA A;  2KJC A;  1RUO A;  1XGM A;  3C18 A;  2H94 A;  4UUV A;  1XGS A;  1J75 A;  5ICF A;  4HYE A;  3FMR A;  3ZQ7 A;  3MQ0 A;  4KN4 X;  2DFI A;  1USS A;  5ERI A;  4L9J A;  2VBX A;  2FML A;  2VBW A;  3CO7 C;  3RTR A;  4WF2 A;  2ADU A;  3L09 A;  2O03 A;  1XMK A;  3T8T A;  1BIB A;  4EV0 A;  2O3F A;  4JQF A;  4AD9 A;  2YX7 A;  1AWC A;  3R4K A;  1HW5 A;  2ZKZ A;  3R6S A;  3EUH A;  4ZH4 F;  5J8F A;  1I6X A;  2PBI A;  5ILU A;  2QM3 A;  5ICC A;  4LLN A;  3IWZ A;  4AIJ A;  4I01 A;  1Z9C A;  2XAS A;  3REO A;  4GGG A;  1T2K A;  4LG0 A;  5L3G A;  1TBX A;  3L2C A;  4I98 B;  4A6E A;  4CDG A;  5LHG A;  1K78 A;  2ZO4 A;  1MJB A;  3CO6 C;  3ZMV A;  2VXZ A;  2NAZ A;  4LD5 A;  3F8F A;  2PMU A;  4L18 B;  3RKW A;  1ZLK A;  3QPH A;  1KQ0 A;  2DI3 A;  1LB2 A;  5DCM A;  1SD6 A;  3HOS A;  2KIU A;  3WOD F;  1Z05 A;  3B73 A;  4I0B A;  3U9G A;  1MKM A;  3LAP A;  1S29 A;  4RB0 A;  1PUE E;  4KNY A;  5HOO A;  3E97 A;  4O5V A;  2LF8 A;  3TO9 A;  3VOD A;  3U2R A;  4EM2 A;  3E6C C;  3WGI A;  2K4B A;  1B9N A;  4EJO A;  4GXO A;  1YG2 A;  2QBY B;  4RGU A;  3L00 A;  4HX8 A;  4YG2 F;  4OMZ A;  2QUF A;  3DFG A;  3E5U A;  3WGH A;  4UXN A;  5HDK A;  4Y17 A;  1MGT A;  2RKH A;  4L5J A;  2DU9 A;  3H3Z A;  4KUM A;  5E8G A;  1LEB A;  5D5W B;  2JTV A;  2WWY A;  4EMS A;  4KMU X;  4E70 A;  1HW1 A;  1ZLJ A;  2M87 A;  4TV7 A;  1E17 A;  2H27 A;  4FX4 A;  3O3K A;  1YW7 A;  1SFE A;  1MJA A;  2ISZ A;  4LG0 B;  3G3Z A;  2HFH A;  1S8N A;  4RGX A;  1ULY A;  2F5F A;  2GQQ A;  1LNW A;  5LRR A;  5BOX A;  5JHU A;  1RNL A;  2MA3 A;  4YFK F;  2LNB A;  5L3C A;  4HA8 A;  2P6S A;  3V8L A;  2RQP A;  3T1B A;  2O0Y A;  3DF8 A;  5H6R A;  2ZFW A;  2GWR A;  4U0V A;  2BEO A;  3RKX A;  1TQI A;  1I5Z A;  4HOB A;  3N4M A;  2WTE A;  5K5O A;  2HKX A;  2ZNZ A;  1T38 A;  1R00 A;  2QVO A;  2AXL A;  4AIH A;  5E1X A;  4U88 A;  4BNC A;  1YLF A;  5LEK A;  2XKP A;  3F8B A;  1B59 A;  3F23 A;  3HTS B;  4EJU A;  1HST A;  3O6B B;  4M71 A;  5EEG A;  2ZCW A;  1ZHF A;  4I7H A;  1HQC A;  1LJ9 A;  2DT5 A;  3LAJ A;  3TQN A;  2VOD A;  1CGP A;  5CVV A;  2OD5 A;  1BI1 A;  4HF0 A;  1ZGA A;  1SD4 A;  3U1D A;  4HV5 A;  3K1N A;  3J80 Z;  3LQR A;  2EFP A;  1FY7 A;  1QZY A;  2JRT A;  3I4P A;  1DUX C;  2L02 A;  2OU2 A;  3R60 A;  4HQE A;  1LEA A;  3T8R A;  2TDX A;  4IRG A;  1RUN A;  2VT3 A;  1W5S A;  5E18 F;  2HR3 A;  1YQA A;  2XAQ A;  2HKO A;  3N97 A;  2V79 A;  1D8K A;  1S7O A;  2BE5 F;  3SZP A;  5DDG A;  2Z33 A;  5CVR A;  5FB2 A;  1P4X A;  1ZYR F;  3R61 A;  1FYM A;  3W6J B;  1BC7 C;  1E2X A;  4I09 A;  1O3R A;  3NQO A;  5EEH A;  2DLL A;  1K6O A;  1U8R A;  1L0O C;  2E7X A;  4O3M A;  4I0A A;  3ZMZ A;  1MJ9 A;  1HW2 A;  1BJA A;  4ZYE A;  2A5Y B;  1KA8 A;  3DKW A;  1U3E M;  2M5W A;  5HLI A;  1UHW A;  4EGY A;  1FSE A;  1HSJ A;  5LBQ A;  3EYI A;  2ETH A;  3FXU A;  2VE9 A;  3FM3 A;  2PN6 A;  1U2W A;  3GO5 A;  2F5D A;  3E6B A;  3EET A;  2MH9 A;  2QZ8 A;  2EFQ A;  3H3U A;  3IHU A;  3LFK A;  5K1Y A;  3GWZ A;  1KQ9 A;  5HDG A;  1UCR A;  2O8X A;  3NRV A;  4BYY A;  1TLH B;  2ESH A;  1Q1H A;  2V9V A;  1F4K A;  1Y0U A;  4S05 A;  5D4R A;  3RYR A;  4IJA A;  4P9F A;  4D0P A;  1GHC A;  1MD0 A;  3OV8 A;  1DDN A;  2IVM A;  5IT3 A;  2Q8K A;  3I5U A;  5BPD A;  4HDU A;  5AON A;  3MAJ A;  2UXN A;  2XIG A;  5H6Q A;  5LHI A;  1OR7 A;  3M1E A;  3L9F A;  4YII A;  2F5C A;  2QQA A;  4ON0 A;  1IXS B;  1P4W A;  1IN6 A;  3WU0 A;  4KMF A;  1KU3 A;  3DP7 A;  3V7R A;  4ZYH A;  1KYZ A;  2W85 A;  1AOY A;  2FU4 A;  2EV5 A;  4EJV A;  1TQM A;  2XUB A;  2LKP A;  4WX9 A;  2JPC A;  2RDP A;  2GA1 A;  3FXQ A;  3TO6 A;  5H20 A;  4OIO F;  4G94 A;  2K02 A;  2OBP A;  3LA7 A;  2ELH A;  1C0W A;  2CSO A;  3RYP A;  1ZAR A;  3W6K B;  3CJN A;  3FF5 A;  4UVB A;  1GXP A;  1SMY F;  2XHK A;  2OQG A;  3T0Y A;  1OMI A;  3WTX C;  1WRJ A;  3HIF A;  2UXX A;  1DPU A;  4HZF A;  1XCV A;  2VOP A;  1J5Y A;  4LK0 F;  1R1V A;  1XCB A;  3KEQ A;  1IXC A;  1FP1 D;  1YFH A;  1YO5 C;  1U78 A;  4MEY F;  3LWF A;  2HQR A;  3TOB A;  1XMA A;  5IT9 Z;  2OA4 A;  4BH9 A;  2JPB A;  3M9A A;  3EYY A;  3GUD A;  3P9C A;  4HF2 A;  1VTN C;  3BWG A;  4FX0 A;  4BAY A;  3WTV C;  3KP5 A;  2DO7 A;  2XRN A;  1FBU A;  2VBZ A;  2MLK A;  3SXY A;  3CUO A;  3GFM A;  4KA4 A;  3MZY A;  3O2P E;  5LGU A;  5E17 F;  3TDZ C;  1REP C;  4XRF A;  1P2F A;  4L0Z B;  2LF7 A;  1T6S A;  3IKT A;  5TJJ A;  1XB4 A;  4IF4 A;  4N0B A;  3HSF A;  3CUQ A;  4F7Z A;  3KLN A;  5E1Z B;  5BPI A;  4EGZ A;  3VOE A;  4CXF A;  4IVN A;  4Q47 A;  2RC4 A;  5L3B A;  4MNU A;  1EH8 A;  3ELK A;  1ODD A;  3GVA A;  2HEO A;  3M8E A;  3BDD A;  2YR2 A;  3K1M A;  4LB6 B;  1S3J A;  1OYI A;  1BOA A;  1HKT A;  3ECO A;  3R0A A;  2DPD A;  2B0L A;  4B8X A;  2L54 A;  5LLQ A;  3MEX A;  2Y0M A;  4AVP A;  2STW A;  4WWC A;  2QBY A;  1XSX A;  4WXD A;  3GFJ A;  3GZ6 A;  1BC8 C;  1ZRD A;  3LST A;  3DXJ F;  1O3T A;  3IL2 A;  2Q0O A;  5BQT A;  3V4G A;  3J80 K;  2Z9O A;  3SQN A;  2QQB A;  1KU9 A;  4RGR A;  3SFZ A;  3MWM A;  4IPA A;  2VON A;  2FOK A;  2LSO A;  2WC2 A;  3COA C;  1OYY A;  1F5T A;  2MBF A;  5ICG A;  3FMQ A;  2VT2 A;  2EFW A;  2G7U A;  1XD7 A;  4RAZ A;  2VE8 A;  1J0R A;  3Q9V A;  1B6A A;  3FXR A;  1WI9 A;  3FMS A;  3QAH A;  1FT9 A;  2DK5 A;  4ZYG A;  2UZK A;  4LB5 A;  2YU3 A;  1RIO H;  1R1U A;  5FGM A;  2A3S A;  3BZ6 A;  4RB2 C;  1YIO A;  4UHT A;  3J81 Z;  4EVI A;  1IZ1 A;  3R0J A;  4KT5 C;  4L5I A;  5LGT A;  1KU7 A;  2FE3 A;  1W7P D;  3HYI A;  3KP4 A;  2E1N A;  1G3S A;  4M6Y A;  2XRO A;  2DPU A;  3Q5F A;  3ZMS A;  5BMZ A;  5JVT A;  1IN7 A;  4EM0 B;  5HDN A;  4M73 A;  4EJT A;  4R1H A;  2PJP A;  2C6Y A;  5DD8 A;  3I59 A;  2A69 F;  1SFX A;  4M74 A;  4M6X A;  3V8K A;  1W7P B;  2P5K A;  4IRI A;  3ZP5 A;  4P96 A;  5F6F A;  2FXA A;  4ENM A;  3EDP A;  1W4M A;  4WXC A;  2EA4 A;  1P6R A;  3M8F A;  3HOT A;  2P7V B;  1I1G A;  1O7L A;  4IRH A;  1QPM A;  3ERE D;  3LA3 A;  3C1D A;  2FMY A;  3WG9 A;  2NYX A;  4HAM A;  4RGS A;  3AAF A;  2EB7 A;  2OZU A;  3M7G A;  2CQK A;  4A0Y A;  4KDP A;  4LLL A;  3TKY A;  2RNJ A;  2CYY A;  2GA2 A;  2Z5U A;  2MD5 A;  2R7D A;  1W5T A;  1RZ4 A;  4Z2Y A;  3BP8 A;  3I59 B;  3FX3 A;  4L9T A;  5FFZ A;  1H9T A;  3KET A;  3I0T A;  3GZ5 A;  3HHH A;  2PEX A;  2W57 A;  1IUY A;  2YX4 A;  1U6G A;  1ZN2 A;  1BIA A;  5CJ9 A;  2DQR A;  3SZT A;  3F6V A;  1Z7U A;  5L3F A;  2XAJ A;  2WV0 A;  2OQR A;  5E20 A;  5KK1 A;  5HLH A;  1IXR C;  2LDU A;  5DCF A;  3P9K A;  4U0W A;  2COM A;  3IRQ A;  1UB9 A;  2GXG A;  3E5X A;  2HOE A;  3J7A O;  1QBJ A;  1PP8 F;  4BHP A;  2ZBK A;  2OAZ A;  5HS9 A;  2GXB A;  1O7F A;  1YTY A;  4M9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...