1BC7C

Serum response factor accessory protein 1a (sap-1)/dna complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
93
structure length
93
Chain Sequence
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*AP*CP*AP*GP*GP*AP*TP*GP*TP*G)-3')
publication title Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 24
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 1998-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bc7C00
1B59A 2P8TA 4M72A 2ZBKA 1U5TA 4O3MA 4F7ZA 1BOAA 2O3FA 3SZTA 4PZJA 2WWYA 3K1NA 2L4MA 2GXGA 1TNSA 1GHCA 3WGIA 1BI2A 1K79A 3MAJA 4RGSA 4L9NA 2D1HA 4M9XA 2EFPA 3OOPA 5DD8A 4HLXA 3E5UA 3RTRA 3ZMVA 3EETA 2GWRA 1SMYF 3AAFA 3BPXA 4L5JA 2R7FA 3ZN0A 5CLSA 3R61A 3VODA 3T5XA 4ZZLA 2NNNA 2WTEA 3B73A 2PEXA 1J75A 3M8EA 3ZN1A 1DPUA 2BBYA 5LHGA 5LGTA 3V4GA 3T8RA 3VFZA 3WGHA 1YO5C 2COMA 1I27A 2XKPA 3RKXA 5CVVA 1RIOH 5L3EA 2KJCA 2GQQA 4ZH4F 2RC4A 1EV7A 3ZQ7A 3HRMA 2MLKA 2STWA 1XSVA 2VOOA 2HR3A 3BJAA 3KLNA 3LQQA 2DI3A 1DUXC 3B02A 4EJWA 4EJTA 3RKYA 3QP5A 4LD5A 1FT9A 1FWZA 2VN2A 1QO0D 2E1NA 6PAXA 2EA4A 2V6CA 3IL2A 1O3SA 4ASNA 3T8TA 2VE8A 2CGPA 4HAMA 4CYDA 4CO8A 1ZG1A 3FF5A 4I02A 5DCFA 3LA2A 3R0JA 3NQOA 3N4MA 5DCMA 4HDUA 4YFNF 1O7LA 3D0SA 2ZKZA 1F1ZA 3GF2A 1F5TA 1K6OA 3ELKA 3J81K 1S3JA 3L2CA 1J9IA 4WXDA 3ERED 1KU9A 4MGRA 5DYMA 3C1DA 4JBAA 2NRAC 4BHCA 3K69A 2FBKA 5F6FA 1IXSB 4HQEA 4HLYA 2P7CB 1XDUA 4HX7A 4L0YB 2VOPA 1YYVA 4M71A 1S7AA 2G9WA 3E5XA 3V7CA 2QM3A 2CO5A 5E1XA 5ICFA 4BAYA 2XRNA 1U6GA 1IN7A 2D2WA 3O6BB 3IRRA 3DPTA 2UXNA 1A04A 2IA0A 2XUBA 3BY6A 4IVNA 3SHFA 5KK1A 3L7WA 4KFCA 4DNCA 5FD6A 1BC8C 2IP2A 1Y0UA 5DV5A 1TBXA 2DPUA 4OIPF 5LRRA 1G3TA 1SFXA 2MLGA 4N9IA 1XCVA 5J6XA 2Z3YA 2F5DA 1HSTA 1L3LA 2P5LC 3JW4A 5D6EA 1MJAA 1IAWA 2QBYB 4G7ZF 3WTSC 3F8BA 3KFWX 4IF4A 4M74A 1J0RA 3GEZA 1D5VA 1ZLKA 3NRVA 3TDZC 1H0MA 1JHHA 4Y13A 3N97A 1JGSA 2NYXA 3ZMSA 2P5KA 1KQ8A 4G94A 4NQWA 2RV8A 1WI9A 5E8IA 1XGMA 4OOIA 4KUMA 1QQIA 2ISZA 2Z99A 3WTYC 3GLXA 4U0WA 2L01A 4U7DA 5LGUA 3F72A 4EGYA 5HVQC 1SAXA 3QPHA 2HS5A 3W6KB 4ENNA 3KP6A 1T98A 2IRFG 2RQPA 5LRSA 1LDJA 2XROA 4ZYEA 3FWEA 3BOQA 2QVOA 2IJLA 5TRDA 4ESJA 3FX3A 5ICGA 1I1GA 2M87A 3MCZA 1GVJA 4JQFA 1Q1HA 4AIJA 1ZLJA 3REOA 2Q0OA 2M1BA 2IPQX 3RKWA 1B4AA 2QLZA 1HW5A 5D8KB 5D5VB 1FYLA 4BNCA 4WK8F 2L54A 4IRIA 2PN6A 2C6YA 1Z6RA 1P4XA 4RGXA 1Z6TA 1SFEA 1TW3A 4OIQF 4KN7X 3H3ZA 1U2WA 2O61A 2FNAA 3H92A 4AWXB 4AIHA 2AS5F 2OA4A 5TJJA 4KIFA 3TKYA 4LGWA 3QU6A 3QP6A 4IRGA 1FY7A 1O7FA 2HYGD 3BZ6A 2OZ6A 2HQRA 2OAZA 3LFKA 4WCGA 4OIRF 4P96A 1FPQA 2HOEA 1PDNC 2M30A 2W24A 3BJOA 2XVCA 4LK0F 2VC1A 1W7PA 1U78A 4HV6A 3RI4A 3T0YA 4L0ZB 2QZ8A 5F64A 4L9VA 1J2XA 5E20A 1T6SA 1R00A 4MHGA 4UVBA 4KIBA 4YG2F 3FMSA 1Z7UA 4FX4A 4M6XA 5DUIA 3JSPA 3HHHA 1J7KA 1AOYA 4GO1A 1BI3A 4HF0A 2Y75A 4IPAA 1IRFA 1GXQA 3F8MA 2F5FA 4LLNA 3HYIA 2CG4A 2O0YA 2FOKA 1UHWA 1DPRA 1ON2A 4UVAA 4I7HA 2FXAA 3CDHA 3TQNA 2WV0A 3K1MA 2ZMEB 5J8FA 4G7HF 1EH8A 4XBFA 1ON1A 1O3RA 3LAPA 3R0AA 1LDKB 1HW2A 3WU0A 2STTA 3M7GA 1LNWA 3KEQA 1H9GA 1JE8A 5HLHA 2GAUA 1R5GA 2M8EA 4R8HA 4YFKF 5D5XB 2GIVA 3CTAA 3I53A 1S7OA 3TO9A 1O3QA 1W5TA 3VEPA 1P4WA 4RS8A 3GO5A 2G7UA 2HTSA 2P6SA 3MEXA 3J7AO 4S04A 1WRJA 3QU3A 1IUYA 3GX4X 2PMHA 4LG0B 3EQLF 4K2EA 1BIBA 2WC2A 2ZNZA 1ODDA 2K27A 3LA7A 2LSOA 1Z1DA 1FBQA 3E6DA 4XLNF 3RPUA 2V79A 1DDNA 2HKXA 1S29A 2KIMA 2FBIA 2CW0F 4R1HA 1BI1A 4TV7A 2EV5A 4CDGA 2J5OA 2VBXA 4U0YA 5L3FA 3E6MA 1IN5A 4M6YA 3BWGA 5IT3A 3RYPA 1ZH5A 5ICCA 5EEHA 1HXDA 1SMTA 2FBHA 3MQ0A 3FMQA 3BDDA 1OPCA 3P9IA 4LG0A 3DEUA 2Z5UA 3MZHA 1KQ0A 2JZYA 2MH9A 3CJNA 4KICA 3EYYA 4XSZF 1BC7C 1J5YA 4RAZA 1KU7A 2JTVA 3L09A 2NNYA 4I2OA 1B9NA 1YS6A 4XSXF 4LB6B 4HBLA 5HLGA 2VBZA 1ZG3A 2PQ8A 3GW2A 4MTDA 2BGCA 2H6BA 1FBSA 5JHUA 5K5QA 5FGMA 3CO6C 4IJAA 1SD5A 2A61A 4KMFA 4B8XA 2B0LA 2G7HA 4KNYA 1XGOA 5CVRA 5CVJA 2F5EA 3JAMK 1YW8A 2EWNA 1V3FA 3DP7A 3KP7A 2HEOA 4ZZDA 2IT0A 3KLOA 2FMLA 1QPMA 3V7SA 2FU4A 3DQVC 2TDXA 4UV8A 2IA2A 4A0ZA 1IZ1A 3ZPLA 1F4KA 5DCMB 4A0YA 1XGSA 2E7WA 3IWFA 4EVIA 2A68F 2QQ9A 1U8RA 3BJ6A 1SD4A 4RGUA 2ZO4A 2QQAA 3V8KA 1HKSA 4BXUA 3F8CA 5L3BA 3IC7A 2O6GE 1RI7A 3WE3A 4BYYA 2IW5A 3FM5A 5E8GA 2MC3A 2L4AA 2PMUA 4BHPA 2DFIA 5LGNA 2MBFA 3CUQC 2JRTA 3E5QA 1UCRA 3H3UA 5EEGA 2Y0MA 4JK1X 4P9FA 1CGPA 4HOBA 2EFWA 3FM3A 5ICEA 4QWQA 4Y15A 2HZTA 1QZYA 4R79A 5LEKA 2ESNA 4UVCA 4RB3C 3F21A 1FP2A 4GYGA 2Q8KA 3ECOA 3RYRA 2H27A 3S2WA 5DUKA 4ENJA 4G6DA 3F6OA 5JFRA 1T0FA 4GGGA 3CO7C 5ERIA 4HF2A 1D8KA 2L3DA 2VT2A 1FZPB 1J59A 4L18B 4IRHA 1ONVA 2OZUA 4EM0B 2XGXA 5LLQA 1FOKA 4ESFA 1UHMA 4U88A 4PDKA 4DQ2A 2VONA 2L02A 1SFUA 4PGGA 3U9GA 1XGNA 1HQCA 3QOPA 2VE9A 5AIPA 3ML6A 1XMKA 3M9AA 4FT8A 3I4PA 3EDPA 1IN4A 2CSOA 1BI0A 3JAMZ 1FC3A 2Z33A 2M5WA 1UB9A 3HSFA 3DXJF 3BP8A 4FX0A 4G6QA 3K1PA 1E17A 1XB4A 3HRSA 4G8XA 1IXCA 4D0PA 2K4JA 3OV8A 4HV5A 4NB5A 5HS8A 5DDGA 5L3DA 4M9ZA 4OIOF 5JI6A 2YR2A 3WTTC 4EJUA 1HKQA 1KU3A 1O3TA 4KYWA 2QQBA 2YU3A 3TOBA 3FZVA 1Z91A 3WGGA 5BMZA 3KCCA 3I5UA 4MEXF 3CUQA 3QRFF 3QAHA 1ZHFA 4LLLA 3FMRA 3GZ6A 2VODA 3V8JA 1U3EM 1H9TA 5FFZA 1R22A 2PG4A 5ED4A 5H6QA 4KN4X 4Y17A 3I59B 4BH9A 1DP7P 3V7RA 3E3VA 3Q9SA 3IRQA 2RDPA 3KP5A 3F22A 1EH7A 3F6VA 1BJAA 3E6CC 3DKWA 2YX4A 2PI0A 2VC0A 4A0XA 3J81Z 1R36A 2DO7A 5DD4A 1K78B 4BQAA 2VXZA 3ZMZA 1IN6A 5E1WA 4UHTA 4WF2A 3I59A 2RGVA 1XCBA 2RVCA 2EFQA 1JHFA 1HSJA 3HIFA 5AONA 5LHIA 1RNLA 2A6EF 3V8LA 3LAJA 3Q9VA 4S05A 1G3SA 5ILVA 1F9NA 1K78A 1LB2A 1PP7U 1V4RA 5DEQA 4LK1F 1R1UA 1YS7A 1PUEE 2EJRA 2A6HF 3GYHX 2EA2A 3MZYA 3G3ZA 4HX4A 1W7PB 4HDVA 4P55A 2XAQA 2XV4S 4U0VA 1XMAA 3CLOA 1GXPA 3I64A 2ACJA 3I58A 1ZREA 1PP8F 2KJBA 5D6FA 3P7NA 3VB2A 3WTZA 5H20A 5E1ZB 3QPTA 2P6TA 4YFXF 2EFNA 4UV9A 3HSRA 1RUNA 3M8FA 1Z05A 1STZA 2PJPA 4G9YA 1L0OC 1FSHA 3DFGA 4OINF 3I71A 5JR3A 2OQRA 3TO6A 5FFXA 4O6JA 2RN7A 1IXRC 3TO7A 2PLYA 1KYWA 1D3YA 5BPIA 4GCVA 2E7XA 1NHAA 5CVUA 2X4HA 1FBUA 1I5ZA 1ZRCA 2LKPA 5FD5A 4MTEA 3IKVA 3U2RA 4GYIA 3R60A 3TGNA 2EV6A 1FYKA 2MD5A 4XLPF 2FSWA 5E18F 4CGZA 3EUHA 4HA8A 2ETHA 2HGCA 1KYZA 1P6RA 1KU2A 4ZYGA 1LQ1A 1I6XA 4E70A 2EFOA 4MEYF 1W7PD 1MGTA 3WODF 1USTA 1QBJA 1G4DA 4L5IA 3C18A 1G3WA 4FHTA 4HYEA 2O8XA 5BQTA 3ABTA 5F1RA 2YPRA 3WU1B 1XD7A 4PGHA 2ZXJA 1AWCA 4WX9A 4AVPA 4WXHA 1WQ2A 3DPLC 1MDMA 2QUFA 1YQAA 4Z2YA 1FSEA 3VOEA 1LEBA 2JSCA 2OBPA 3FXUA 2MA3A 1IF1A 2EV0A 5D5WB 4ZYDA 1FNNA 3LWFA 1ZARA 1ZG5A 5HS9A 3IHUA 4HZFA 4I98B 1LEAA 4RB1A 5BS6A 1LJ9A 3W6JB 3ZMTA 2A69F 2NAZA 1OKRA 5HDKA 5H6RA 3E6BA 1R1VA 5JVTA 1BBYA 5HDGA 1WKMA 4L9JA 1R58A 5HLIA 4MQ9F 2VBYA 3WTWC 2MH2A 2RNJA 2K86A 4ON0A 2GXBA 3GWZA 1YIOA 2EK5A 4MQVA 4N0BA 5LEJA 5D4RA 3K2ZA 2ESHA 1CF7A 5D4SA 3COAC 4HW0A 3R6SA 2ZCWA 3HTSB 1G6NA 4Q48A 1LDDA 5ILUA 2DBBA 4HQMA 2KIFA 4LB5A 5K1YA 2D45A 2XKOA 1KQ9A 2DK8A 3BROA 2YSRA 4KA4A 2ZFWA 2CQKA 3PQJA 4N9HA 2EB7A 2CWEA 2FEZA 3SFZA 2AXLA 2Y48A 2F5CA 2CFXA 3C7JA 3FXQA 1MKMA 4XRFA 4EQQA 1R5HA 3ABUA 2OU2A 1RUOA 2XHKA 2GA2A 2GA1A 1REPC 4RB2C 1FYMA 3RIRA 1LVAA 3J80K 4UNOA 2ISYA 2W85A 2JPCA 2W25A 2XASA 3K0LA 1BIAA 1T2KA 5CVIA 4IHSA 1S8NA 4P5OA 3MWMA 3ZMUA 4EJOA 3ZMDA 1VTNC 1BN5A 1ZRFA 4EMSA 1TLHB 1TNTA 2P7VB 3E97A 1XN7A 1WSUA 4BHBA 2NS0A 3LQRA 2A3SA 2DAOA 2KRFA 3HRTA 3ISPA 4LMYA 1XSDA 4ESBA 2Z9OA 2XAFA 5CJ9A 2DPDA 4UUVA 2UZKA 3P9CA 1TQMA 2DQRA 3HRUA 4H0EA 1HW1A 2A5YB 5AIQA 3ULQB 1QGPA 1HBXG 2XAJA 4ZYHA 2P5VA 2LNBA 3DF8A 4EV0A 1TQIA 3KZZA 2XAGA 3WTVC 2ZJ2A 2FMYA 2W57A 3HOSA 2H94A 3KE2A 4OMYA 2HTJA 3GUDA 3JSOA 4EGZA 1BM9A 2BYVE 2J5PA 4U7BA 2M45A 3HTUA 3Q5FA 1IRGA 3WE2A 1OYIA 1T39A 2FA5A 2BEOA 3EYIA 2HQNA 3SXYA 1FX7A 1S6LA 4A5MA 1USSA 2IVMA 2O03A 2Q2EA 2HWVA 4CHUA 3CUQB 1G3YA 5FLXK 1T38A 5HDNA 5ILSA 3J80Z 1B1BA 2HFHA 3HOTA 4KIGA 1KGSA 4WXCA 2OQGA 2IA1A 3TDUC 2DTRA 2HDCA 1ULYA 2DLLA 2HYFA 1R23A 1B9MA 2V1UA 5KVRA 4QLCU 3RDIA 4YIFA 3F23A 2ZNYA 2BE5F 4AD9A 2K4BA 4RAYA 1TTYA 1ZAOA 4ENMA 2UWMA 5E17F 1R1TA 1K7AA 1JXSA 3D5LA 4M9SA 3M1EA 4M73A 1XSXA 4L9TA 3RJPA 2LF7A 1ZGAA 5D5UB 5A2QK 1SD6A 4GXOA 1TW2A 5LBQA 3LA3A 3SZPA 5HOOA 4I01A 1P2FA 1HKTA 1XDSA 2P4WA 3GFIA 4UXNA 2QBYA 1FLIA 3CUOA 1TQPA 5IT9K 5CYVA 4B09A 4Q5SF 3O3KA 3O2PE 4LJZF 2W84A 3IKTA 1ZGJA 3T1BA 3LSTA 1WWXA 3TOAA 5J8CA 4OU0A 2UXXA 3ZP5A 4AIKA 2CYYA 5HS7A 3ROUA 4A6EA 2DU9A 2GZWA 3GZ5A 4LLGF 3FXRA 2VBWA 1MD0A 3IWZA 4CZZA 4Q47A 3P9KA 4A12A 3RPQA 1I1SA 3HHGA 4IHTA 2FNPA 4EM1A 5LHHA 3GVAA 4A2UA 1P4AA 2JPBA 2KIUA 1O57A 4EM2A 1MJ9A 1IW7F 1E2XA 5FO5A 5D8LB 5FLXZ 2BV6A 2PFBA 5L3GA 1YG2A 1OYYA 3PFIA 4I0BA 4I09A 1P92A 1B6AA 4IXAA 5BOXA 4KT5C 2FE3A 4OMZA 2R3SA 2FF4A 1MZBA 4HX8A 2LDUA 4A5NA 4RGRA 2PBIA 4MNUA 2ELHA 2V1DA 3MFKA 3F8NA 2D1VA 1C0WA 1W5SA 3KZYA 4RB0A 1EH6A 3GFMA 4EJVA 3KP3A 3I0TA 2H6CA 3BPVA 1YLFA 3F8FA 4YIIA 2QWWA 2VT3A 3HSEA 1YW7A 1ZN2A 2YX7A 4CXFA 5A2QZ 4NHJA 2FRHA 1D8JA 4ETSA 3I54A 1R7JA 3L00A 1U5TC 2V9VA 3JTGA 1MJBA 2E1CA 3WTXC 4KDPA 5IT9Z 3K9TA 2XAHA 4P9UA 2R7DA 3KP4A 3PQKA 2K7LA 2A07F 1SD7A 3ECHA 3KEOA 3G73A 1IN8A 1MDMB 2K02A 2KKOA 3F3XA 1KA8A 2DT5A 1YTYA 2DK5A 1QNTA 5L3CA 1YW9A 3L9FA 4LFUA 3KP2A 1YFHA 3DV8A 3NEUA 2RKHA 1X3UA 3FHZA 5FB2A 1UFMA 4KMUX 1OR7A 3GXOA 2DQLA 3JTHA 1OMIA 1Z9CA 2FQ3A 1ZYRF 1ZRDA 3C3WA 2F2EA 5K5OA 2ADUA 4Q4ZF 2ZMEA 2X0LA 3WG9A 1FP1D 1OYWA 4CICA 1QZZA 4PCQA 2QYOA 2OD5A 2QENA 3WTUC 1U5TB 3GFLA 2LF8A 4ENKA 3R4KA 1CF7B 4G7OF 4HF1A 2V1XA 2JT1A 2DW4A 3SQNA 4O5VA 1W4MA 2HKOA 4A6DA 3KETA 5BPDA 1RZ4A 4WWCA 5K5RA 2H09A 3GFJA 3U1DA 2XIGA 3HUGA 4I0AA
chains in the Genus database with same CATH superfamily
2BY1A 2E5NA 3S15J 1B59A 2P8TA 1NG7A 4RAGA 2HYJA 4M72A 2ZBKA 3TL4X 1U5TA 4BY7J 3OS0A 4O3MA 2Y69H 4F7ZA 1BOAA 2O3FA 1X1AA 3SZTA 4PZJA 2WWYA 3K1NA 4YEJA 1V5GA 4MO7A 2L4MA 3K10A 4FE4A 2GXGA 1TNSA 1A6QA 1NK3P 1FMWA 4BY1J 1ZGWA 1GHCA 3WGIA 1BI2A 1K79A 3MAJA 4RGSA 4L9NA 2D1HA 3P5JA 4M9XA 2EFPA 2E35A 3OOPA 5DD8A 4HLXA 1UG0A 2OCEA 3I4MJ 2K5CA 2WAEA 3E5UA 3RTRA 4DJAA 3ZMVA 5F1JA 3EETA 4NBQA 2BVLA 3PO2J 2GWRA 3K4LA 1SMYF 3HOUJ 3AAFA 3BQYA 3BPXA 4NC6A 4YIRX 4BU2A 4L5JA 1VI0A 2R7FA 3BQZA 3ZN0A 2JK3A 2KZVA 5CLSA 3QYFA 3R61A 3VODA 3T5XA 4ZZLA 3BCBA 2NNNA 2O8KA 2TRTA 4E7IA 2WTEA 3B73A 2VI6A 4W97A 4GDFA 2AQFA 2PEXA 1F43A 1J75A 4E7JA 3M8EA 3UKGA 3ZN1A 4Y52J 4A3BJ 1DPUA 2QGUA 2ELJA 2VJ5A 2BBYA 3VYSB 5LHGA 4JOMA 3G6EI 5LGTA 2BXYA 4UUSA 2JA6J 1IC8A 3V4GA 1WZ2A 3T8RA 1Z7LA 3VFZA 1OISA 3K4JA 4FCYA 2R93J 2VXDA 3WGHA 3S1NJ 1YO5C 5IPAA 2ZJRF 2COMA 1I27A 2XKPA 3RKXA 3BR3A 5CVVA 1RIOH 3FBNB 1F36A 3QYBA 3ZQQA 5L3EA 4AIDA 1I39A 2QCOA 2KJCA 1GV2A 2GQQA 2LR8A 3IH2A 4ZH4F 5EF6A 3OYMA 2RC4A 1EV7A 3ZQ7A 3HRMA 2MLKA 2STWA 1IV6A 1Y6IA 1XSVA 3H5AA 2VOOA 2DFFA 2TCTA 2JUGA 4UB6C 2HR3A 4RM3A 3MD2A 1GLNA 3BJAA 1FEXA 2L9RA 1ZKGA 2M4GA 3KLNA 5CKTA 3LQQA 2DI3A 1DUXC 2GM4A 3B02A 4EJWA 4EJTA 2XPWA 3W2VA 3BG6A 3RKYA 1WJAA 3VPRA 1TWHJ 3QP5A 2F4OB 4H4KC 4LD5A 3BG3A 1FT9A 1FWZA 1YX5A 1FIPA 4E7KA 2VN2A 1QO0D 2YS9A 2E1NA 3IAS2 3ERMA 6PAXA 2EA4A 2V6CA 2V4JC 4A93J 3GCMA 2E19A 3IL2A 1O3SA 3I56I 3PIPF 3CESA 2EH3A 2VPRA 4ASNA 4B44A 2D5VA 3T8TA 2VE8A 4ZJZA 1ETKA 1W0TA 3ZQHA 2CGPA 1VQ6I 4HAMA 4CYDA 1WH7A 4CO8A 3SEZA 2DXIA 1ZG1A 1W0UA 2B63J 3FF5A 2WB1N 4I02A 5DCFA 3WG7H 3LA2A 2KDOA 3IH3A 3R0JA 3NQOA 3N4MA 5DCMA 4HDUA 4BEHA 2V26A 4YFNF 2KP6A 1OCRH 1O7LA 1W5CC 3D0SA 2Y9YA 2ZKZA 1XMXA 1F1ZA 2VKVA 3GF2A 1F5TA 3ZQCA 1K6OA 4F91B 1WHUA 2OV7A 3ELKA 2XSDC 5FJ8J 4DZJA 2X6XA 3J81K 1S3JA 3KIOA 4F93B 3L2CA 3PIOF 3DU6A 2DA3A 3IAM2 2DA7A 2Q2EB 2X85A 1J9IA 4WXDA 1IDZA 3ERED 1KU9A 4MGRA 2LP0A 5DYMA 1E0EA 3C1DA 3RQIA 4JBAA 4XR6A 1MMAA 2NVUB 2NRAC 4BHCA 3OYAA 3K69A 2FBKA 5F6FA 1QU3A 2R7ZJ 1JKRC 5M3MJ 3BTJA 4HPQA 3SFIA 1SVLA 3IP4B 2ZC2A 1IXSB 4HQEA 4HLYA 2P7CB 3Q3SA 3BT9A 1APLC 1XDUA 2K3FA 2CRGA 4HX7A 5GP9A 4L0YB 2VOPA 1YYVA 3GMEA 4M71A 1S7AA 2H8WA 2G9WA 3E5XA 3Q0VA 1LPQA 1JTXA 3V7CA 2QM3A 2WY8Q 2CO5A 1Z67A 2M4KA 5E1XA 5ICFA 1HDPA 4C2UA 4BAYA 1UZCA 1V5EA 5FKMA 2XRNA 1U6GA 1IN7A 2D2WA 3M3YJ 5J40A 3O6BB 3IRRA 4U87A 2NS8A 2OPTA 2L9VA 3SDBA 1OJLA 3DPTA 2UXNA 2L7FP 1A04A 1ETVA 2E1MC 2IA0A 5IP9J 2XUBA 3BY6A 4IL6C 4IVNA 3SHFA 5KK1A 3L7WA 1FMVA 4KFCA 2K9QA 4DNCA 5FD6A 3MN2A 1BC8C 5BNGA 3AL0C 2IP2A 1Y0UA 5DV5A 1TBXA 2DPUA 4OIPF 5LRRA 1G3TA 1SFXA 1YIJI 2MLGA 2VPLA 3BZKA 4N9IA 2IS4A 1XCVA 5J6XA 3ZR8X 2Z3YA 5F0HA 2E2IJ 2F5DA 2QQ8A 1HSTA 1D0ZA 2P5LC 1L3LA 3JW4A 5D6EA 1MJAA 1IAWA 2QBYB 3I4NJ 2DMNA 4G7ZF 3WTSC 1K83J 3F8BA 1MSEC 2PJRA 1W1WE 3KFWX 4IF4A 4M74A 1J0RA 2HQ5A 3GEZA 2HVRA 1IUFA 1D5VA 1MH3A 3L1PA 1ZLKA 3OS1A 3NRVA 2BW3B 3OIPA 4E6KG 3TDZC 1H0MA 1XS9A 1JHHA 2MGQA 2L0KA 4Y13A 2ELKA 3N97A 2CUJA 3JRGA 3JR9A 2QSHX 1JGSA 2NYXA 4A3EJ 3ZMSA 2P5KA 3JRIA 1KQ8A 4G94A 3GLLA 1PYVA 4NQWA 2RV8A 1WI9A 4M3BA 5E8IA 4BACA 3CJTB 1XGMA 2K9NA 5M5WJ 4RM2A 4OOIA 4KUMA 1QQIA 5J1UA 2ISZA 2Z99A 3SJMA 3DBHB 4JP0A 3WTYC 3GLXA 4U0WA 1BR2A 3I55I 4RAFA 2L01A 4D9JA 1DQUA 3JCUC 4U7DA 3W2WA 5LGUA 1OLTA 3F72A 4EGYA 1FOWA 4CYCA 5HVQC 4QTRA 4OAYA 1SAXA 1VQPI 1VQ4I 3QPHA 2HS5A 3JRBA 3W6KB 4ENNA 4Y7NJ 4IHXA 3KP6A 3A02A 1T98A 5B1BH 2RQPA 2IRFG 3S1RJ 1P9QC 2LOOA 5LRSA 1LDJA 2XROA 2Z2SB 2DA4A 4ZYEA 3FWEA 2BZTA 3BOQA 2E1MB 2QVOA 2ZJQF 2IJLA 3LOCA 2XPUA 4BL0B 5TRDA 4ESJA 1U9OA 3FX3A 4MIMA 5ICGA 3DEEA 3AL0B 1ETWA 1I1GA 2M87A 2L7MP 3MCZA 1GVJA 2LYCA 4A3LJ 4JQFA 2ECCA 1Q1HA 5M3FJ 4AIJA 1ZLJA 3REOA 5IYDJ 4IOAF 3EPZA 2R7XA 2WAQN 2Q0OA 2M1BA 2IPQX 3RKWA 1B4AA 2QLZA 1HW5A 2QF7A 5D8KB 5IY5H 5D5VB 1FYLA 3PJRA 2K85A 4BNCA 1WJBA 2JQ7A 3FK7A 2LY1A 4CCKA 3MVPA 2M0CA 4WK8F 2L54A 4IRIA 1QVTA 2PN6A 2C6YA 1Z6RA 4XLEA 1P4XA 5CQGA 4DIQA 4ZDOA 3CP8A 3DCFA 4RGXA 1BJZA 1Z6TA 1SFEA 2OTLI 1TW3A 2I10A 2K9MA 2X9DA 4OIQF 4W1UA 3PUFA 4KN7X 1HC8A 3H3ZA 1U2WA 1SVMA 1AKHA 2O61A 2FNAA 3H92A 4AWXB 2MABA 4PUSA 1RPWA 1PUFB 4AIHA 1ACIA 2AS5F 2OA4A 5TJJA 5CPRB 1H88C 4KIFA 3TKYA 2XC7A 4LGWA 3QU6A 3QP6A 1S9HA 4IRGA 1FY7A 2R5ZB 5M5YJ 1O7FA 1PJRA 2HYGD 3BZ6A 1MIJA 2HQRA 2OZ6A 4PSXA 3ABLH 3OMYA 2OAZA 3LFKA 5M5XJ 4WCGA 5H2FC 3GTPJ 3E7LA 5GTHC 4OIRF 4P96A 2GIZA 1FPQA 2HOEA 1PDNC 1IRXA 3DU5A 2LLKA 2M30A 2DA1A 2W24A 1JI8A 4P1WA 3K7AJ 4UY8I 3BJOA 2XVCA 1ORKA 2LRDA 2EIMH 2K9SA 4LK0F 2A5WA 1W7PA 2VC1A 1U78A 3BLYA 4HV6A 5HNFA 3RI4A 1PUFA 3WHCA 3T0YA 5IOZA 4L0ZB 1XTAA 5FKNA 2QZ8A 5F64A 4L9VA 1J2XA 5IP6A 3OWTA 2XPVA 5E20A 1T6SA 4IEJA 3GTMJ 2L5QA 3ONQA 1R00A 1E3OC 4MHGA 2XSJC 3QODA 4UVBA 4KIBA 4YG2F 3J7ZI 3FMSA 1Z7UA 4FX4A 2OUMA 4BUPA 2DA2A 4M6XA 5DUIA 3JSPA 1S7EA 3VYUB 3HHHA 1B8IA 1J7KA 1AOYA 4GO1A 4X6AJ 2NVXJ 1BI3A 4HF0A 2Y75A 3MKLA 3ZOBA 4IPAA 3UR3C 3TMOA 2R7WA 1WJEA 1TC3C 5EZHA 1IRFA 1GXQA 1Z0XA 1T8IA 1ERDA 3F8MA 3K4KA 3OYNA 2F5FA 4LLNA 2F4MB 3HYIA 3S3OA 2CG4A 2O0YA 1G2HA 1I3QJ 3GZNB 2FOKA 4HNVA 1UHWA 2V6EA 1DPRA 2W82A 4DW6A 4JX5A 1ON2A 4Y3OA 4UVAA 4I7HA 2ZB9A 2FXAA 3I9V2 3CDHA 1YRNB 2P81A 3VSLA 3TQNA 4BS9A 2WV0A 3K1MA 4MFDA 1QHGA 2ZMEB 5K7ZA 5J8FA 5GPCA 3BG9A 4G7HF 4XMYA 1EH8A 2A05A 3BZCA 4XBFA 2MG4A 1ON1A 1O3RA 3LAPA 3R0AA 2IAIA 1LDKB 1MBGA 1HW2A 3H9JA 3WU0A 1RC9A 1Y0NA 2STTA 3M7GA 4E7SA 3ABMH 1LNWA 3KEQA 1X19A 1H9GA 1JE8A 5HLHA 2VQGA 2DMPA 2AXTC 2MW8A 2GAUA 1R5GA 2DMQA 2M8EA 3DLLF 4DBRA 4CH7A 4I6ZA 2CW7A 1RRJA 1MMDA 1YRNA 3JRHA 4R8HA 5TGTA 1X1BA 4YFKF 1BL0A 5D5XB 2XF5A 2R92J 2FUG2 2GIVA 3HUGB 3CTAA 2EPFA 3I53A 3DKYA 3DTKA 1S7OA 3TO9A 2FQ4A 1O3QA 3DTEA 1VQLI 1W5TA 4QSHA 2M8GX 3HG9A 3VEPA 1P4WA 4RS8A 3GO5A 1MBFA 2G7UA 2HTSA 2MC4A 5C3EJ 4F3QA 2P6SA 1JGGA 3MEXA 2HVQA 3J7AO 3H1CA 3DEWA 2XGEA 4S04A 1WRJA 3BR0A 3QU3A 1IUYA 3FDYA 3OYJA 3GX4X 2PMHA 1SAUA 4LG0B 4IOCF 4XM3A 3EQLF 4K2EA 1BIBA 1TWGJ 4DBQA 4HNTA 2WC2A 2ZNZA 4ABZA 1ZR4A 1ODDA 2K27A 3LA7A 2LSOA 3RZOJ 1Z1DA 1FBQA 3OYDA 3E6DA 4XLNF 3RPUA 3SEQA 2V79A 1DDNA 2HKXA 1S29A 2KIMA 2FBIA 4RLQA 4ZDPA 2CW0F 2E2HJ 4R1HA 1BI1A 2X6WA 4TV7A 2EV5A 3FKJA 4CDGA 2V1NA 2J5OA 2ID6A 2VBXA 4U0YA 1DGRM 3IUOA 4N4NB 3E6MA 3D5SC 5L3FA 1MMGA 2BY0A 1IN5A 3G71I 4M6YA 1JTYA 3BWGA 4XICA 2DA6A 5IT3A 3V42A 2ZFUA 1U0JA 5EEAA 3RYPA 1I3AA 3PNYA 4EEFG 5ICCA 5EEHA 1ZH5A 5F27A 2ZSIB 1HXDA 1SMTA 2FBHA 3MQ0A 3FMQA 3BDDA 3HGYA 3OL3A 1OPCA 3M1CA 3P9IA 4LG0A 1R49A 4UUSB 1FTTA 3DEUA 5C44J 2Z5UA 3MZHA 4UB8C 1JUMA 1KQ0A 2JZYA 2BHYA 2MH9A 3CJNA 4KICA 3GTGJ 4OAZA 5F0FA 2CS3A 3EYYA 4XSZF 2WY7Q 1BC7C 1WI3A 1XG1A 1J5YA 2EBIA 2CUEA 4RAZA 2LD5A 1KU7A 2JTVA 3L09A 5B3SH 3O8HA 2NNYA 4I2OA 2HXIA 3OIOA 2PMZA 1B9NA 3CJRB 1YS6A 2ID3A 2R7OA 2JN6A 4XSXF 4LB6B 1RKWA 4HBLA 1T0FC 5HLGA 4RMNA 4RBOA 2VBZA 1QVUA 1ZG3A 2PQ8A 3GW2A 4MTDA 2BGCA 2H6BA 1FBSA 3CCQI 1WCMJ 1V54H 5JHUA 3CCEI 5KCMA 3H3VK 3LL7A 5K5QA 5FGMA 2PX9A 3UNGC 3CO6C 4IJAA 3GTJJ 1SD5A 2EINH 2A61A 4KMFA 4B8XA 2B0LA 2JRMA 2G7HA 4IKFA 4KNYA 3QQAA 3K4BA 1UELB 1U9NA 5EJCA 1XGOA 3OYEA 3H9GA 2VJJA 3RZDJ 5CVRA 5CVJA 1RR7A 5EGOA 2F5EA 3JAMK 1VQ9I 1YW8A 4BQNA 2EWNA 1V3FA 2LREA 3DP7A 3KP7A 4XN3A 2ME6A 2HEOA 4ZZDA 2L7KA 4A3CJ 5CQEA 3KLOA 2IT0A 4RA2A 2FMLA 1QPMA 2NXNB 2UV1A 2ME0A 3V7SA 4Y33A 3JRCA 3F9KA 1E3PA 1ITYA 4JYKA 3CC4I 1D1AA 5B5EC 2FU4A 3FIWA 1P7JA 3GTLJ 1Z3XA 3DQVC 2TDXA 3B6CA 2IA2A 4UV8A 5IOYA 4A0ZA 1IZ1A 3S3NA 2DCEA 3ZPLA 2NVYJ 1D0YA 2Z1DA 2ZXHA 1F4KA 4ZC3A 2H8RA 5DCMB 4A0YA 4BEHB 3RQ4A 2I8DA 3S17J 1XGSA 2E7WA 3IWFA 2KLOA 4EVIA 4XKCA 2A68F 2QQ9A 1U8RA 3BJ6A 1SD4A 4RGUA 1PVEA 3HDDA 3BR6A 2ZO4A 4CCLA 2QSGX 2QQAA 3V8KA 1HKSA 1EKEA 4BXUA 3CCYA 3F8CA 2VKHA 3LFUA 2E2JJ 1IV8A 5L3BA 3ZXSA 4XKVA 4AYBA 3IC7A 1K4TA 2O6GE 1RKTA 1WFXA 2B9SA 1RI7A 3WE3A 4BYYA 5J4VA 2IW5A 2Y0SA 3FM5A 5EZGA 5E8GA 2MC3A 2L4AA 2ZSHB 5DTDA 2BY2A 1FOXA 1TT5B 2PMUA 4BHPA 3MKYB 2DFIA 1H8AC 5LGNA 2MBFA 3CUQC 2JRTA 2EZLA 3E5QA 1UCRA 3H3UA 5EEGA 2NS7A 2Y0MA 2X6YA 4JK1X 3CMMA 4P9FA 3TP3A 1CGPA 4HOBA 3S32A 3HM5A 2X1CA 3FISA 2EFWA 3KEYA 4ITVA 3FM3A 3ZQFA 4QWQA 4Y15A 5ICEA 2HZTA 1BW5A 1QZYA 3CCUI 4R79A 5LEKA 2ESNA 4UVCA 4RB3C 1Y8RB 3F21A 1FP2A 1X4OA 4GYGA 2Q8KA 3ECOA 2H1KA 3RYRA 3HL2A 2H27A 4M3DA 2WADA 3S2WA 1X4PA 5GAGJ 5DUKA 5J1RA 4ENJA 4G6DA 1UAAA 3E1SA 3F6OA 5JFRA 4BXXJ 1T0FA 4GGGA 4FASD 3CO7C 5ERIA 3LSJA 2HXOA 4E7LA 4HF2A 1D8KA 5FLVA 4B47A 1FIAA 1T08B 2WAFA 1WVRA 2L3DA 2VT2A 1MMSA 1FZPB 1J59A 4HSTA 1DU0A 2W00A 4IRHA 4L18B 1ONVA 2OZUA 4KT6A 2XGXA 4EM0B 2R7RA 4NC8A 5LLQA 1FOKA 1TT0A 2QA4I 4ESFA 1UHMA 5GADJ 4U88A 3DKXA 5GAHJ 4PDKA 1VF9A 3LSGA 4DQ2A 1SC7A 2VONA 2L02A 4B48A 1SFUA 4PGGA 2Y9ZA 3U9GA 1XGNA 1SFOJ 1HQCA 3BTLA 1OCCH 2CUFA 4FETA 1VQ8I 3QOPA 2PJRB 3M8JA 2VB6A 4XLHA 2VE9A 5AIPA 1B72A 3FXLA 3ML6A 1XMKA 2QSFX 3M9AA 1JT0A 4FT8A 3I4PA 1FTZA 3EDPA 2CFOA 2JA5J 1IN4A 4KJZA 3CCLI 2CSOA 4NC7A 1BI0A 3JAMZ 4DYQA 5FRMA 1FC3A 2Z33A 2M5WA 4G12A 3K4MA 3FXOA 1WJDA 4BXFA 4NQWB 1UB9A 3HSFA 4BKXA 4XRSA 3DXJF 2CU7A 3BP8A 4FX0A 2Q1ZB 3LNQA 2DMTA 4G6QA 3OYIA 3K1PA 1E17A 5J4YA 1YHQI 2L2OA 2JWTA 3AFHA 1XB4A 3HRSA 4G8XA 1IXCA 2KZGA 4D0PA 3OL4A 2K4JA 3OV8A 4HV5A 1VQNI 4NB5A 5L3DA 5DDGA 4M9ZA 5HS8A 1D5YA 1IG7A 4OIOF 1RETA 1LKXA 5JI6A 2YR2A 3WTTC 2KQRA 4XL9A 1JKOC 2KRHA 4CYCB 1KONA 4PSWA 4EJUA 1HKQA 1KU3A 1O3TA 4KYWA 2QQBA 2YU3A 3TOBA 3HEFA 3AG4H 4CCOA 3FZVA 1Z91A 3WGGA 5BMZA 3KCCA 3I5UA 4MEXF 3HOWJ 3CUQA 4QPQA 4LG3A 3W3CA 3QRFF 3W2AA 3ZGKA 3QAHA 2LBFA 2MD0A 1ZHFA 4LLLA 3LSIA 3FMRA 3QWLA 2CV1A 1K6YA 2CQ7A 3GZ6A 2DT7B 1Y39A 2VODA 5K7HA 3V8JA 1U3EM 1H9TA 4NUBA 4ZTJA 4ZDLA 1TZLA 1R6RA 5FFZA 1R22A 2PG4A 4HEA2 3JREA 4A3JJ 2R7TA 2XGDA 5ED4A 5KNLA 2COBA 5H6QA 4KN4X 5C4XJ 4Y17A 3I59B 5EYRA 4BH9A 3EUAA 3V7RA 1DP7P 3E3VA 4ANJA 2FOWA 3DBRB 2XAUA 3Q9SA 3C2BA 3GTQJ 3IRQA 2RDPA 2QEXI 3KP5A 3F22A 2RREA 4L5EA 4B3AA 1EH7A 3HPGA 3ZQGA 3F6VA 1BJAA 4BBRJ 3E6CC 2EZKA 3DKWA 2YX4A 2PI0A 4NDLA 2VC0A 4A0XA 3J81Z 2RNGA 1MBEA 3CMYA 1R36A 2DO7A 1HOMA 4C2MJ 2IXSA 5DD4A 1K78B 4BQAA 1EF4A 3B6AA 2VXZA 4YELA 1W36C 3ZMZA 3OR2C 1Q1VA 2Y31A 3L2RA 1IN6A 5E1WA 4E4HA 4UHTA 3K70C 3OSFA 1Y8QB 5JLWA 5E3MA 4WF2A 2MYSA 3HZJA 2KDZA 2OC6A 3LSHA 3I59A 1CQTA 3NWTA 2F4IA 1MBKA 2BY3A 2RGVA 3A4CA 5C4JJ 2H1LA 1AKHB 1XCBA 2RVCA 2EFQA 1JHFA 2DDBA 1HSJA 3HIFA 2LMDA 5AONA 5LHIA 1RNLA 1VQMI 4M3EA 2A6EF 5EDNA 1S5LC 3V8LA 3AKZA 3LAJA 2DT6A 3Q9VA 1ETOA 4S05A 4LIVA 1BOBA 1G3SA 1XC5A 1Z3YA 4HSRA 4CCMA 1UJ8A 5ILVA 1F9NA 1K78A 1LB2A 2ZJPF 3CCMI 1NG6A 1PP7U 4M6VA 1V4RA 2E1OA 5DEQA 4B1RA 4LK1F 1R1UA 1YS7A 1PUEE 2M7BA 2EJRA 3K2AA 1QA6A 2A6HF 2DOAA 2A6TA 4DZPA 2X6OA 3VYRB 2XRLA 1VZ0A 4PJJA 3J7AY 3GYHX 2EA2A 3MZYA 2E5ZA 3G3ZA 1GV5A 2W48A 4HX4A 5E3NA 1W7PB 4HDVA 4V2FA 4P55A 2JA7J 2XAQA 3QPSA 1N25A 2XV4S 4U0VA 1XMAA 3CMEI 1WH5A 1YI2I 4FE7A 3CLOA 3LSKA 1R71A 1GXPA 3I64A 2ACJA 3I58A 1ZREA 1PP8F 2KJBA 5D6FA 4D7MA 3P7NA 3VB2A 2KRCA 3WTZA 5H20A 5E1ZB 3QPTA 2P6TA 4YFXF 1HF0A 1IGNA 4M3FA 3VSKA 5KAFC 3CQZJ 1MNMC 2LK2A 3J7YJ 4XK4A 2EFNA 2ICWG 3MKZA 4UV9A 3HSRA 2ECBA 1B8IB 1DGWY 2PMZN 4E7ZA 1RUNA 3M8FA 1Z05A 5FKLA 2R0QC 1STZA 2PJPA 2HQAA 3CDIA 4G9YA 2HVSA 1DP3A 1L0OC 1E3HA 4E7HA 2IBDA 2KT0A 3DFGA 3GTKJ 1FSHA 3CCRI 4F52A 3OYHA 4A3FJ 3S3MA 4OINF 3M4OJ 3I71A 5J3LA 2OJED 5JR3A 4A3MJ 2OQRA 1Z21A 3TO6A 5FFXA 2LTPA 1A5JA 5GTIC 4O6JA 2RN7A 1WPKA 4D7NA 4V19K 2XB0X 2RAEA 5E3LA 1IXRC 3TO7A 3PM1A 2PLYA 3Q0UA 1KYWA 3FBIB 1D3YA 5BPIA 4GCVA 2LVSA 3CC7I 2E7XA 1NHAA 2CQXA 4C30A 5CVUA 5DS9A 4DOZA 2X4HA 1TP4A 3CDLA 1FBUA 1D1BA 3TW7A 1I5ZA 1ZRCA 2LKPA 5FD5A 3CMAI 4CZCA 4MTEA 3IKVA 3U2RA 4GYIA 3CD6I 3R60A 3TGNA 3OIQA 1G59A 2EV6A 4D5CA 1FYKA 2MD5A 3FK6A 4XLPF 2FSWA 5E18F 4CGZA 2V9PA 1XPXA 3EUHA 4HA8A 2ETHA 4A3GJ 2X1EA 2HGCA 1KYZA 2IGNA 1P6RA 3SZGA 2K40A 1JUPA 2F48A 3PSIA 1KU2A 1OCZH 4ZYGA 1LQ1A 3U1KA 4C3IJ 3OS2A 1X3ZB 4PFOA 1I6XA 4E70A 4XOPA 1YJNI 2EFOA 4MEYF 1W7PD 4DGWB 3D1NI 1MGTA 3WODF 1USTA 1QBJA 4AYBN 2E60A 2KL4A 1G4DA 4L5IA 3C18A 2JMWA 3M07A 1K4SA 1G3WA 4FHTA 1ZELA 4HYEA 2O8XA 5BQTA 3ABTA 2Y0SN 5F1RA 2YPRA 2R5YB 2CQNA 4IX7A 2VKEA 3CZ6A 3WU1B 4IQ4A 1XD7A 4PGHA 2EIKH 2ZXJA 3BG5A 1AWCA 1EA3A 4WX9A 4A3IJ 4AVPA 4WXHA 1JJ8C 1WQ2A 3DPLC 2HOAA 2X51A 1ETXA 1MDMA 2QUFA 1YQAA 4Z2YA 5HODA 2DFHA 2M0MA 4F92B 4BBSJ 1FSEA 3VOEA 1LEBA 2JSCA 2OBPA 3FXUA 2MA3A 1IF1A 4I76A 2JJ7A 1HLVA 2EV0A 2R7SA 3CCJI 5D5WB 4IHYA 4ZYDA 1Y1VJ 1FNNA 3LWFA 4MLOA 1AU7A 2K9LA 2R5YA 1ZARA 4NNJA 1ZG5A 3AG2H 5HS9A 4XKBA 3IHUA 4HZFA 3OY9A 4I98B 1LEAA 4RB1A 5BS6A 1LJ9A 2WV1A 1ZR2A 3KZIC 3L2WA 3OOUA 3W6JB 3BR2A 2W1OA 3ZMTA 3D5RC 2VKDA 2A69F 2LC2A 2EZIA 2NAZA 1OKRA 5FKOA 5HDKA 2HOTA 2DA5A 1IDYA 5H6RA 3E6BA 1YJ9I 2L7ZA 2KIQA 4GRIA 1R1VA 5JVTA 1BBYA 5HDGA 4XLCA 1WKMA 2GOMA 4L9JA 3CF5F 1NTCA 2LG4A 2XF6A 1R58A 4XLAA 5HLIA 4MQ9F 2VBYA 3HB9A 4XRSG 4RDUA 3WTWC 2MH2A 5FKKA 1TWFJ 2NVQJ 1R4NB 5F0CA 2RNJA 2K86A 4ON0A 4BJ6C 1N77A 2GXBA 3GWZA 1YIOA 3HOXJ 2EK5A 4MQVA 1D1CA 3QPLA 4N0BA 3VDXA 5LEJA 3FXJA 5D4RA 3K2ZA 2VQCA 2ESHA 1AHDP 1R9TJ 1T95A 1CF7A 4PJ0C 3RSNA 4BE0A 3TBIA 5D4SA 3H0DA 1IRZA 2L9NA 3COAC 2DMUA 4HW0A 5J1YA 2CW8A 4HG2A 2ZCWA 2M9HA 3E0JB 3O8GA 3R6SA 4BQOA 1IJWC 4X1EA 4HRIA 3CLQA 4XORA 5EGOB 3HTSB 1G6NA 4Q48A 1LDDA 5ILUA 2DBBA 4B43A 4AC0A 3MKWB 1XX5A 4HQMA 5F08A 3S14J 1X3WB 3GBGA 2KIFA 2IGKA 4LB5A 2VJ4A 5K1YA 2D45A 2OTJI 2WA0A 4KISA 2XKOA 1KQ9A 2DK8A 3MMYB 3BROA 2YSRA 4KA4A 2BVMA 2ZFWA 1RR8C 2CQKA 3PQJA 2GLOA 4N9HA 2EB7A 3HOZJ 2CWEA 2FEZA 3SFZA 3RPUD 1D0XA 1K61A 1X1PA 2KFDA 2VIXA 1HCRA 2AXLA 2Y48A 1YOVB 4J00A 3A0HC 4EATA 1KZHA 3A01B 1SVOA 2IEKA 2F5CA 4CSWA 2RQQA 2CFXA 3A2KA 3C7JA 3KPHA 3FXQA 1MKMA 4XRFA 4EQQA 1R5HA 3ABUA 2EQRA 3H0GJ 2VUMJ 2OU2A 1RUOA 3OSGA 2XHKA 4XNFA 1S72I 2GA2A 2GA1A 1REPC 4RB2C 3RKQA 2JA8J 1FYMA 3C2GA 2MFZA 1NK2P 3RIRA 1LVAA 5KAIC 3J80K 2FD5A 1NH3A 4UNOA 2ISYA 2M34A 4JX6A 2BHZA 4IZZA 2W85A 1A35A 4OWRB 1J09A 1YX3A 2JPCA 2W25A 2XASA 3K0LA 3OYKA 5LD2C 1SANA 2L9SA 5JVGF 1LFBA 1BIAA 1T2KA 3LSMA 5CVIA 3A01A 3HPHA 4C9YA 1MMNA 1X1CA 5FLMJ 3KYDB 4IHSA 4BJTA 1S8NA 4P5OA 4ZYAA 3MWMA 1IO2A 3ZMUA 4XKWA 4EJOA 4MFEA 4D1QA 3ZMDA 1VTNC 2OF7A 3BTCA 1BN5A 2HPMA 4DYRA 1ZRFA 3C2HA 4EMSA 1TLHB 4XOTA 5B66C 1TNTA 3HC7A 1YITI 2X48A 2P7VB 5DM6F 1UMQA 2M7AA 3E97A 1XN7A 3DLAA 2DYRH 4BHBA 1WSUA 4IQJA 4I99C 2NS0A 3LQRA 2A3SA 2DAOA 3H5NA 4XQFA 2CUZA 2KRFA 1TWCJ 4XONA 1TWAJ 1LFPA 3HOVJ 3HRTA 2V7FA 1R5ID 3ISPA 3A0BC 4LMYA 1XSDA 3ZQIA 4ESBA 2Z9OA 4PFPA 2XAFA 5CJ9A 1X1DA 1VNDA 2EIJH 2DPDA 4UUVA 3CP2A 2UZKA 3S2DJ 2YUSA 2K3PA 4ZTFA 3OYLA 5JHFA 3P9CA 1TQMA 1UHSA 2DQRA 3HRUA 1LFUP 4H0EA 3QYEA 9ANTA 1HW1A 3G1MA 2IGMA 4G6TB 3S1QJ 2A5YB 1ZK8A 5AIQA 3ULQB 4IO9F 1QGPA 1HBXG 4YRVA 2XAJA 2B7EA 2O9LA 1B72B 3ZCOA 4ZYHA 3IV5A 1QZEA 2P5VA 2LNBA 3DF8A 4EV0A 1TQIA 3KZZA 1WGXA 2XAGA 1EJ9A 3PUBA 4AU7A 1TL8A 2DYSH 3WTVC 2M2EA 3JRAA 2ZJ2A 2HOSA 3Q0WA 2FMYA 3FXMA 3EUKL 2W57A 3ABKH 3H5RA 4Z6YA 3HOSA 2IS6A 2H94A 3KE2A 4OMYA 2HTJA 3GUDA 2E36A 3JSOA 4EGZA 1BM9A 4CCNA 2BYVE 2FJ1A 4A3KJ 2J5PA 4U7BA 2M45A 3HTUA 3TP0A 3H36A 1A31A 3Q5FA 3ZQLA 1Y56A 3PNTA 4JX4A 1IRGA 3WE2A 1JUSA 1OYIA 3IH4A 1T39A 3ASNH 3L2QA 4LOCA 2FA5A 5F04A 2XDVA 1YJWI 3S1MJ 2BEOA 1LVKA 3EYIA 2CMPA 2HQNA 1O4XA 1BR1A 3SXYA 4X0GA 1FX7A 1S6LA 4A5MA 1USSA 3A1YA 1QHHD 2DFEA 2IVMA 3LSRA 1WJ5A 3QOEA 2HPIA 5JLXA 2O03A 2Q2EA 2HWVA 4CHUA 5TISC 4PJLA 3CUQB 1G3YA 2JUCA 1T38A 5FLXK 5IYBJ 1G8XA 2JA2A 3FKIJ 2LBFB 2KHMA 2JSPA 5HDNA 5ILSA 3J80Z 3AG1H 4II3A 1GVDA 1B1BA 4GFBA 2HFHA 3HOTA 4KIGA 1KGSA 3BR5A 4WXCA 4BE1A 1I50J 3JRDA 2OQGA 2IA1A 3TDUC 2BXZA 3HXLA 2DTRA 2HDCA 1ULYA 2DLLA 4PJMA 2HYFA 1R23A 1B9MA 2V1UA 3S2HJ 5KVRA 3PO3J 1VFCA 1OFCX 1H89C 1MBHA 4QLCU 2XGCA 2QKMB 3RDIA 1V55H 4XIDA 2HNHA 2Z16A 1GUUA 3GTOJ 2NOGA 2AQEA 1V5FA 2EZHA 4YIFA 3F23A 1MNDA 2ZNYA 3X2QH 1ETYA 2BE5F 4AD9A 1LE8B 2K4BA 2W4SA 4RAYA 3PSFA 1TTYA 1ZAOA 3WU2C 4ENMA 2UWMA 5E17F 1R1TA 3HOYJ 1K7AA 1JXSA 3DPUA 4KITB 3D5LA 4M9SA 3M1EA 4M73A 1XSXA 3ESWB 4L9TA 2DJNA 3RJPA 2LF7A 1ZGAA 5D5UB 5A2QK 1JJ6C 5HNHA 1SD6A 4GXOA 1TW2A 5LBQA 2HU9A 3LA3A 3SZPA 3WHBA 5HOOA 5GAEJ 1JKQC 4FTHA 4I01A 1P2FA 1HKTA 1XDSA 3I3LA 2P4WA 4D5FA 3GFIA 4UXNA 2QBYA 1FLIA 4DYCA 3CUOA 3TW6A 3NAUA 1TQPA 4IHWA 2GOXB 2AHQA 5IT9K 1WJCA 3DWLE 5CYVA 4AM3A 1LE8A 4B09A 2JVGA 4Q5SF 4B4CA 4M3GA 4QIWN 3O3KA 3O2PE 4S0HB 2BW3A 2WBMA 1RESA 3CJQB 4RLFA 4LJZF 3VYTB 1X58A 4BDZA 2W84A 3IKTA 1ZGJA 4II2A 1UG2A 3T1BA 1ENHA 1OCPA 2F6CA 3LSTA 1WWXA 3U21A 4BE2A 3TOAA 1JT6A 3F0CA 5J8CA 1HA8A 2CH0A 2OCCH 4OU0A 2UXXA 5IP7J 3HBLA 1OQYA 1HDDC 3ZP5A 3EUHC 2XB5A 3SDGA 4AIKA 2CYYA 5HS7A 3ROUA 4AVZA 4A6EA 2DU9A 2O5RA 3OYFA 2GZWA 2GXAA 3GZ5A 4LLGF 3FXRA 2VBWA 2DOEA 1MD0A 1VQKI 3IWZA 3NARA 1U8BA 4CZZA 3HKZN 2LKXA 4Q47A 2XF7A 2CV2A 3P9KA 2WB1A 4A12A 1OCOH 3K4NA 3RPQA 3BG7A 3BC8A 3HHGA 3SYTA 3L2VA 4IHTA 1I1SA 5LFAA 2Y30A 5B1AH 2FNPA 4EM1A 2I5UA 2ZXWH 3G1LA 5LHHA 1VQOI 4CA0A 3GVAA 4A2UA 2IS1A 2DJIA 5GPAA 1P4AA 2JPBA 1DU6A 2ZXIA 4A3DJ 2KIUA 1WJFA 1O57A 4EM2A 1MJ9A 1YE9A 1IW7F 4B3XA 4IHVA 1E2XA 1OR7C 3KYLA 4AUXA 4C2TA 5FO5A 2HDDA 1SFKA 2QKLB 5D8LB 2DN0A 5FLXZ 5FRNA 2BV6A 2PFBA 3K4CA 5L3GA 2E34A 2VASA 1QPIA 1YG2A 3BR1A 2P0WA 1OYYA 5E3OA 3PFIA 1GDTA 4I0BA 4I09A 1X2NA 3VWBA 1P92A 1B6AA 4IXAA 5BOXA 4KT5C 2R7QA 1ZQ3P 2FE3A 4OMZA 2R3SA 1T33A 3BTIA 1POGA 2GBYA 3MZ8A 4XRMA 1FOYA 2FF4A 1MZBA 4HX8A 2LDUA 3G2BA 4A5NA 2R4GA 4RGRA 1OCTC 2ZMEC 3HJEA 3FXKA 3CC2I 2PBIA 4LIUA 2F5VA 4MNUA 4PJNA 3DTIA 4F55A 5J47A 3OR1C 2DOFA 2E71A 4C3HJ 2ELHA 4V2GA 2V1DA 1AA7A 3MFKA 3F8NA 4UUTA 2LKSA 2VQLA 2NVTJ 2D1VA 3BCAA 2NOJB 5KHDA 1C0WA 2HI3A 3KYCB 2JVHA 3NWSA 3OYGA 4BJ5C 2KISA 1W5SA 1BR4A 3KZYA 3AG3H 2MSYA 3H35A 4RB0A 1MH4A 1EH6A 2VQHA 3GFMA 4EJVA 1FJLA 3KP3A 3I0TA 2H6CA 2VLAA 3OYCA 1MNEA 3BPVA 4FISA 1YLFA 3F8FA 1A6IA 4BDYA 1T56A 2DTZA 3N05A 2QWWA 2M3AA 4YIIA 2VT3A 3HSEA 1YW7A 1ZN2A 3RCOA 2YX7A 1MBJA 2DDAA 4C3JJ 2IGOA 2CV0A 4XN0A 2VL8A 4CUGA 4CXFA 5A2QZ 4NHJA 5IYCJ 2FRHA 5DM7F 2G0EA 2LH9A 1D8JA 1P7IA 2R7VA 4ETSA 3I54A 2R5ZA 2R7UA 5E79C 1R7JA 3PL8A 3L00A 3G1OA 2V9KA 1U5TC 2W7NA 2V9VA 3JTGA 1MJBA 2E1CA 3WTXC 2CJJA 3CCSI 4KDPA 5IT9Z 1Y1WJ 3K9TA 2XAHA 2EILH 3S16J 1N75A 4P9UA 4BGDA 2R7DA 5HLTA 4J19A 3KP4A 3PQKA 2K7LA 3S93A 2A07F 1GT0C 1SD7A 3ECHA 3KEOA 3G73A 5EG0B 1IN8A 1MDMB 4BQQA 1A36A 2K02A 3PNVA 1MSFC 2KKOA 2HDWA 3F3XA 1KA8A 2DT5A 1YTYA 2DK5A 1QNTA 4PK4A 5L3CA 1YW9A 4J01A 3CCVI 1JKPC 3L9FA 4LITA 2DODA 2BOLA 2VJIA 3HGGA 2KMUA 1MW7A 4LFUA 3G4SI 3KP2A 1YFHA 3DV8A 3OYBA 1BA5A 2LFBA 4Y4RA 2AO9A 2UUZA 3LSPA 3NEUA 2RKHA 3KX2A 1X3UA 4QPOA 3FHZA 5FB2A 2CQQA 1UFMA 4KMUX 3L2UA 4A69C 3LMMA 1OR7A 3H9QA 2O7OA 3TEDA 3GXOA 3JRFA 3ZRGA 3ASOH 2DQLA 5EG0A 3JTHA 1OMIA 1SEUA 1VQ5I 2HZDA 1Z9CA 2FQ3A 1W36D 1VQ7I 1ZYRF 1ETQA 2YU9J 2LY9A 1ZRDA 2LY2A 3CF2A 3K70D 3C3WA 4XLFA 2F2EA 5K5OA 1I6HJ 1X2MA 4HNUA 3K6GA 1R4MB 3S8PA 2ADUA 2Y2ZA 4Q4ZF 2N8GA 3FHNA 2ZMEA 2X0LA 4N4OB 3WG9A 5FROA 1FP1D 2FX0A 3A03A 1OYWA 5K7FA 1Z77A 4CICA 1M1EB 1QZZA 4PCQA 2QYOA 2OD5A 1QRYA 3HKZA 2QENA 3WTUC 1U5TB 3GFLA 2LF8A 1LUJB 4ENKA 1ZTRA 3R4KA 3PFYA 1CF7B 4G7OF 4HF1A 4CCJA 2WAQA 2V1XA 2JT1A 1N78A 2DW4A 3SQNA 4O5VA 1W4MA 2HKOA 2X1DA 4A6DA 3DBLB 3KETA 5BPDA 1RZ4A 2KPMA 4WWCA 5K5RA 2H09A 3GFJA 3U1DA 4FQGA 1BW6A 2XIGA 3HUGA 2IS2A 3W6VA 4I0AA
chains in the Genus database with same CATH topology
1B59A 2P8TA 4M72A 2ZBKA 1U5TA 4O3MA 4F7ZA 1BOAA 2O3FA 3SZTA 4PZJA 2WWYA 3K1NA 2L4MA 2GXGA 1TNSA 1GHCA 3WGIA 1BI2A 1K79A 3MAJA 4RGSA 4L9NA 2D1HA 4M9XA 2EFPA 3OOPA 5DD8A 4HLXA 3E5UA 3RTRA 3ZMVA 3EETA 2GWRA 1SMYF 3AAFA 3BPXA 4L5JA 2R7FA 3ZN0A 5CLSA 3R61A 3VODA 3T5XA 4ZZLA 2NNNA 2WTEA 3B73A 2PEXA 1J75A 3M8EA 3ZN1A 1DPUA 2BBYA 5LHGA 5LGTA 3V4GA 3T8RA 3VFZA 3WGHA 1YO5C 2COMA 1I27A 2XKPA 3RKXA 5CVVA 1RIOH 5L3EA 2KJCA 2GQQA 4ZH4F 2RC4A 1EV7A 3ZQ7A 3HRMA 2MLKA 2STWA 1XSVA 2VOOA 2HR3A 3BJAA 3KLNA 3LQQA 2DI3A 1DUXC 3B02A 4EJWA 4EJTA 3RKYA 3QP5A 4LD5A 1FT9A 1FWZA 2VN2A 1QO0D 2E1NA 6PAXA 2EA4A 2V6CA 3IL2A 1O3SA 4ASNA 3T8TA 2VE8A 2CGPA 4HAMA 4CYDA 4CO8A 1ZG1A 3FF5A 4I02A 5DCFA 3LA2A 3R0JA 3NQOA 3N4MA 5DCMA 4HDUA 4YFNF 1O7LA 3D0SA 2ZKZA 1F1ZA 3GF2A 1F5TA 1K6OA 3ELKA 3J81K 1S3JA 3L2CA 1J9IA 4WXDA 3ERED 1KU9A 4MGRA 5DYMA 3C1DA 4JBAA 2NRAC 4BHCA 3K69A 2FBKA 5F6FA 1IXSB 4HQEA 4HLYA 2P7CB 1XDUA 4HX7A 4L0YB 2VOPA 1YYVA 4M71A 1S7AA 2G9WA 3E5XA 3V7CA 2QM3A 2CO5A 5E1XA 5ICFA 4BAYA 2XRNA 1U6GA 1IN7A 2D2WA 3O6BB 3IRRA 3DPTA 2UXNA 1A04A 2IA0A 2XUBA 3BY6A 4IVNA 3SHFA 5KK1A 3L7WA 4KFCA 4DNCA 5FD6A 1BC8C 2IP2A 1Y0UA 5DV5A 1TBXA 2DPUA 4OIPF 5LRRA 1G3TA 1SFXA 2MLGA 4N9IA 1XCVA 5J6XA 2Z3YA 2F5DA 1HSTA 1L3LA 2P5LC 3JW4A 5D6EA 1MJAA 1IAWA 2QBYB 4G7ZF 3WTSC 3F8BA 3KFWX 4IF4A 4M74A 1J0RA 3GEZA 1D5VA 1ZLKA 3NRVA 3TDZC 1H0MA 1JHHA 4Y13A 3N97A 1JGSA 2NYXA 3ZMSA 2P5KA 1KQ8A 4G94A 4NQWA 2RV8A 1WI9A 5E8IA 1XGMA 4OOIA 4KUMA 1QQIA 2ISZA 2Z99A 3WTYC 3GLXA 4U0WA 2L01A 4U7DA 5LGUA 3F72A 4EGYA 5HVQC 1SAXA 3QPHA 2HS5A 3W6KB 4ENNA 3KP6A 1T98A 2IRFG 2RQPA 5LRSA 1LDJA 2XROA 4ZYEA 3FWEA 3BOQA 2QVOA 2IJLA 5TRDA 4ESJA 3FX3A 5ICGA 1I1GA 2M87A 3MCZA 1GVJA 4JQFA 1Q1HA 4AIJA 1ZLJA 3REOA 2Q0OA 2M1BA 2IPQX 3RKWA 1B4AA 2QLZA 1HW5A 5D8KB 5D5VB 1FYLA 4BNCA 4WK8F 2L54A 4IRIA 2PN6A 2C6YA 1Z6RA 1P4XA 4RGXA 1Z6TA 1SFEA 1TW3A 4OIQF 4KN7X 3H3ZA 1U2WA 2O61A 2FNAA 3H92A 4AWXB 4AIHA 2AS5F 2OA4A 5TJJA 4KIFA 3TKYA 4LGWA 3QU6A 3QP6A 4IRGA 1FY7A 1O7FA 2HYGD 3BZ6A 2OZ6A 2HQRA 2OAZA 3LFKA 4WCGA 4OIRF 4P96A 1FPQA 2HOEA 1PDNC 2M30A 2W24A 3BJOA 2XVCA 4LK0F 2VC1A 1W7PA 1U78A 4HV6A 3RI4A 3T0YA 4L0ZB 2QZ8A 5F64A 4L9VA 1J2XA 5E20A 1T6SA 1R00A 4MHGA 4UVBA 4KIBA 4YG2F 3FMSA 1Z7UA 4FX4A 4M6XA 5DUIA 3JSPA 3HHHA 1J7KA 1AOYA 4GO1A 1BI3A 4HF0A 2Y75A 4IPAA 1IRFA 1GXQA 3F8MA 2F5FA 4LLNA 3HYIA 2CG4A 2O0YA 2FOKA 1UHWA 1DPRA 1ON2A 4UVAA 4I7HA 2FXAA 3CDHA 3TQNA 2WV0A 3K1MA 2ZMEB 5J8FA 4G7HF 1EH8A 4XBFA 1ON1A 1O3RA 3LAPA 3R0AA 1LDKB 1HW2A 3WU0A 2STTA 3M7GA 1LNWA 3KEQA 1H9GA 1JE8A 5HLHA 2GAUA 1R5GA 2M8EA 4R8HA 4YFKF 5D5XB 2GIVA 3CTAA 3I53A 1S7OA 3TO9A 1O3QA 1W5TA 3VEPA 1P4WA 4RS8A 3GO5A 2G7UA 2HTSA 2P6SA 3MEXA 3J7AO 4S04A 1WRJA 3QU3A 1IUYA 3GX4X 2PMHA 4LG0B 3EQLF 4K2EA 1BIBA 2WC2A 2ZNZA 1ODDA 2K27A 3LA7A 2LSOA 1Z1DA 1FBQA 3E6DA 4XLNF 3RPUA 2V79A 1DDNA 2HKXA 1S29A 2KIMA 2FBIA 2CW0F 4R1HA 1BI1A 4TV7A 2EV5A 4CDGA 2J5OA 2VBXA 4U0YA 5L3FA 3E6MA 1IN5A 4M6YA 3BWGA 5IT3A 3RYPA 1ZH5A 5ICCA 5EEHA 1HXDA 1SMTA 2FBHA 3MQ0A 3FMQA 3BDDA 1OPCA 3P9IA 4LG0A 3DEUA 2Z5UA 3MZHA 1KQ0A 2JZYA 2MH9A 3CJNA 4KICA 3EYYA 4XSZF 1BC7C 1J5YA 4RAZA 1KU7A 2JTVA 3L09A 2NNYA 4I2OA 1B9NA 1YS6A 4XSXF 4LB6B 4HBLA 5HLGA 2VBZA 1ZG3A 2PQ8A 3GW2A 4MTDA 2BGCA 2H6BA 1FBSA 5JHUA 5K5QA 5FGMA 3CO6C 4IJAA 1SD5A 2A61A 4KMFA 4B8XA 2B0LA 2G7HA 4KNYA 1XGOA 5CVRA 5CVJA 2F5EA 3JAMK 1YW8A 2EWNA 1V3FA 3DP7A 3KP7A 2HEOA 4ZZDA 2IT0A 3KLOA 2FMLA 1QPMA 3V7SA 2FU4A 3DQVC 2TDXA 4UV8A 2IA2A 4A0ZA 1IZ1A 3ZPLA 1F4KA 5DCMB 4A0YA 1XGSA 2E7WA 3IWFA 4EVIA 2A68F 2QQ9A 1U8RA 3BJ6A 1SD4A 4RGUA 2ZO4A 2QQAA 3V8KA 1HKSA 4BXUA 3F8CA 5L3BA 3IC7A 2O6GE 1RI7A 3WE3A 4BYYA 2IW5A 3FM5A 5E8GA 2MC3A 2L4AA 2PMUA 4BHPA 2DFIA 5LGNA 2MBFA 3CUQC 2JRTA 3E5QA 1UCRA 3H3UA 5EEGA 2Y0MA 4JK1X 4P9FA 1CGPA 4HOBA 2EFWA 3FM3A 5ICEA 4QWQA 4Y15A 2HZTA 1QZYA 4R79A 5LEKA 2ESNA 4UVCA 4RB3C 3F21A 1FP2A 4GYGA 2Q8KA 3ECOA 3RYRA 2H27A 3S2WA 5DUKA 4ENJA 4G6DA 3F6OA 5JFRA 1T0FA 4GGGA 3CO7C 5ERIA 4HF2A 1D8KA 2L3DA 2VT2A 1FZPB 1J59A 4L18B 4IRHA 1ONVA 2OZUA 4EM0B 2XGXA 5LLQA 1FOKA 4ESFA 1UHMA 4U88A 4PDKA 4DQ2A 2VONA 2L02A 1SFUA 4PGGA 3U9GA 1XGNA 1HQCA 3QOPA 2VE9A 5AIPA 3ML6A 1XMKA 3M9AA 4FT8A 3I4PA 3EDPA 1IN4A 2CSOA 1BI0A 3JAMZ 1FC3A 2Z33A 2M5WA 1UB9A 3HSFA 3DXJF 3BP8A 4FX0A 4G6QA 3K1PA 1E17A 1XB4A 3HRSA 4G8XA 1IXCA 4D0PA 2K4JA 3OV8A 4HV5A 4NB5A 5HS8A 5DDGA 5L3DA 4M9ZA 4OIOF 5JI6A 2YR2A 3WTTC 4EJUA 1HKQA 1KU3A 1O3TA 4KYWA 2QQBA 2YU3A 3TOBA 3FZVA 1Z91A 3WGGA 5BMZA 3KCCA 3I5UA 4MEXF 3CUQA 3QRFF 3QAHA 1ZHFA 4LLLA 3FMRA 3GZ6A 2VODA 3V8JA 1U3EM 1H9TA 5FFZA 1R22A 2PG4A 5ED4A 5H6QA 4KN4X 4Y17A 3I59B 4BH9A 1DP7P 3V7RA 3E3VA 3Q9SA 3IRQA 2RDPA 3KP5A 3F22A 1EH7A 3F6VA 1BJAA 3E6CC 3DKWA 2YX4A 2PI0A 2VC0A 4A0XA 3J81Z 1R36A 2DO7A 5DD4A 1K78B 4BQAA 2VXZA 3ZMZA 1IN6A 5E1WA 4UHTA 4WF2A 3I59A 2RGVA 1XCBA 2RVCA 2EFQA 1JHFA 1HSJA 3HIFA 5AONA 5LHIA 1RNLA 2A6EF 3V8LA 3LAJA 3Q9VA 4S05A 1G3SA 5ILVA 1F9NA 1K78A 1LB2A 1PP7U 1V4RA 5DEQA 4LK1F 1R1UA 1YS7A 1PUEE 2EJRA 2A6HF 3GYHX 2EA2A 3MZYA 3G3ZA 4HX4A 1W7PB 4HDVA 4P55A 2XAQA 2XV4S 4U0VA 1XMAA 3CLOA 1GXPA 3I64A 2ACJA 3I58A 1ZREA 1PP8F 2KJBA 5D6FA 3P7NA 3VB2A 3WTZA 5H20A 5E1ZB 3QPTA 2P6TA 4YFXF 2EFNA 4UV9A 3HSRA 1RUNA 3M8FA 1Z05A 1STZA 2PJPA 4G9YA 1L0OC 1FSHA 3DFGA 4OINF 3I71A 5JR3A 2OQRA 3TO6A 5FFXA 4O6JA 2RN7A 1IXRC 3TO7A 2PLYA 1KYWA 1D3YA 5BPIA 4GCVA 2E7XA 1NHAA 5CVUA 2X4HA 1FBUA 1I5ZA 1ZRCA 2LKPA 5FD5A 4MTEA 3IKVA 3U2RA 4GYIA 3R60A 3TGNA 2EV6A 1FYKA 2MD5A 4XLPF 2FSWA 5E18F 4CGZA 3EUHA 4HA8A 2ETHA 2HGCA 1KYZA 1P6RA 1KU2A 4ZYGA 1LQ1A 1I6XA 4E70A 2EFOA 4MEYF 1W7PD 1MGTA 3WODF 1USTA 1QBJA 1G4DA 4L5IA 3C18A 1G3WA 4FHTA 4HYEA 2O8XA 5BQTA 3ABTA 5F1RA 2YPRA 3WU1B 1XD7A 4PGHA 2ZXJA 1AWCA 4WX9A 4AVPA 4WXHA 1WQ2A 3DPLC 1MDMA 2QUFA 1YQAA 4Z2YA 1FSEA 3VOEA 1LEBA 2JSCA 2OBPA 3FXUA 2MA3A 1IF1A 2EV0A 5D5WB 4ZYDA 1FNNA 3LWFA 1ZARA 1ZG5A 5HS9A 3IHUA 4HZFA 4I98B 1LEAA 4RB1A 5BS6A 1LJ9A 3W6JB 3ZMTA 2A69F 2NAZA 1OKRA 5HDKA 5H6RA 3E6BA 1R1VA 5JVTA 1BBYA 5HDGA 1WKMA 4L9JA 1R58A 5HLIA 4MQ9F 2VBYA 3WTWC 2MH2A 2RNJA 2K86A 4ON0A 2GXBA 3GWZA 1YIOA 2EK5A 4MQVA 4N0BA 5LEJA 5D4RA 3K2ZA 2ESHA 1CF7A 5D4SA 3COAC 4HW0A 3R6SA 2ZCWA 3HTSB 1G6NA 4Q48A 1LDDA 5ILUA 2DBBA 4HQMA 2KIFA 4LB5A 5K1YA 2D45A 2XKOA 1KQ9A 2DK8A 3BROA 2YSRA 4KA4A 2ZFWA 2CQKA 3PQJA 4N9HA 2EB7A 2CWEA 2FEZA 3SFZA 2AXLA 2Y48A 2F5CA 2CFXA 3C7JA 3FXQA 1MKMA 4XRFA 4EQQA 1R5HA 3ABUA 2OU2A 1RUOA 2XHKA 2GA2A 2GA1A 1REPC 4RB2C 1FYMA 3RIRA 1LVAA 3J80K 4UNOA 2ISYA 2W85A 2JPCA 2W25A 2XASA 3K0LA 1BIAA 1T2KA 5CVIA 4IHSA 1S8NA 4P5OA 3MWMA 3ZMUA 4EJOA 3ZMDA 1VTNC 1BN5A 1ZRFA 4EMSA 1TLHB 1TNTA 2P7VB 3E97A 1XN7A 1WSUA 4BHBA 2NS0A 3LQRA 2A3SA 2DAOA 2KRFA 3HRTA 3ISPA 4LMYA 1XSDA 4ESBA 2Z9OA 2XAFA 5CJ9A 2DPDA 4UUVA 2UZKA 3P9CA 1TQMA 2DQRA 3HRUA 4H0EA 1HW1A 2A5YB 5AIQA 3ULQB 1QGPA 1HBXG 2XAJA 4ZYHA 2P5VA 2LNBA 3DF8A 4EV0A 1TQIA 3KZZA 2XAGA 3WTVC 2ZJ2A 2FMYA 2W57A 3HOSA 2H94A 3KE2A 4OMYA 2HTJA 3GUDA 3JSOA 4EGZA 1BM9A 2BYVE 2J5PA 4U7BA 2M45A 3HTUA 3Q5FA 1IRGA 3WE2A 1OYIA 1T39A 2FA5A 2BEOA 3EYIA 2HQNA 3SXYA 1FX7A 1S6LA 4A5MA 1USSA 2IVMA 2O03A 2Q2EA 2HWVA 4CHUA 3CUQB 1G3YA 5FLXK 1T38A 5HDNA 5ILSA 3J80Z 1B1BA 2HFHA 3HOTA 4KIGA 1KGSA 4WXCA 2OQGA 2IA1A 3TDUC 2DTRA 2HDCA 1ULYA 2DLLA 2HYFA 1R23A 1B9MA 2V1UA 5KVRA 4QLCU 3RDIA 4YIFA 3F23A 2ZNYA 2BE5F 4AD9A 2K4BA 4RAYA 1TTYA 1ZAOA 4ENMA 2UWMA 5E17F 1R1TA 1K7AA 1JXSA 3D5LA 4M9SA 3M1EA 4M73A 1XSXA 4L9TA 3RJPA 2LF7A 1ZGAA 5D5UB 5A2QK 1SD6A 4GXOA 1TW2A 5LBQA 3LA3A 3SZPA 5HOOA 4I01A 1P2FA 1HKTA 1XDSA 2P4WA 3GFIA 4UXNA 2QBYA 1FLIA 3CUOA 1TQPA 5IT9K 5CYVA 4B09A 4Q5SF 3O3KA 3O2PE 4LJZF 2W84A 3IKTA 1ZGJA 3T1BA 3LSTA 1WWXA 3TOAA 5J8CA 4OU0A 2UXXA 3ZP5A 4AIKA 2CYYA 5HS7A 3ROUA 4A6EA 2DU9A 2GZWA 3GZ5A 4LLGF 3FXRA 2VBWA 1MD0A 3IWZA 4CZZA 4Q47A 3P9KA 4A12A 3RPQA 1I1SA 3HHGA 4IHTA 2FNPA 4EM1A 5LHHA 3GVAA 4A2UA 1P4AA 2JPBA 2KIUA 1O57A 4EM2A 1MJ9A 1IW7F 1E2XA 5FO5A 5D8LB 5FLXZ 2BV6A 2PFBA 5L3GA 1YG2A 1OYYA 3PFIA 4I0BA 4I09A 1P92A 1B6AA 4IXAA 5BOXA 4KT5C 2FE3A 4OMZA 2R3SA 2FF4A 1MZBA 4HX8A 2LDUA 4A5NA 4RGRA 2PBIA 4MNUA 2ELHA 2V1DA 3MFKA 3F8NA 2D1VA 1C0WA 1W5SA 3KZYA 4RB0A 1EH6A 3GFMA 4EJVA 3KP3A 3I0TA 2H6CA 3BPVA 1YLFA 3F8FA 4YIIA 2QWWA 2VT3A 3HSEA 1YW7A 1ZN2A 2YX7A 4CXFA 5A2QZ 4NHJA 2FRHA 1D8JA 4ETSA 3I54A 1R7JA 3L00A 1U5TC 2V9VA 3JTGA 1MJBA 2E1CA 3WTXC 4KDPA 5IT9Z 3K9TA 2XAHA 4P9UA 2R7DA 3KP4A 3PQKA 2K7LA 2A07F 1SD7A 3ECHA 3KEOA 3G73A 1IN8A 1MDMB 2K02A 2KKOA 3F3XA 1KA8A 2DT5A 1YTYA 2DK5A 1QNTA 5L3CA 1YW9A 3L9FA 4LFUA 3KP2A 1YFHA 3DV8A 3NEUA 2RKHA 1X3UA 3FHZA 5FB2A 1UFMA 4KMUX 1OR7A 3GXOA 2DQLA 3JTHA 1OMIA 1Z9CA 2FQ3A 1ZYRF 1ZRDA 3C3WA 2F2EA 5K5OA 2ADUA 4Q4ZF 2ZMEA 2X0LA 3WG9A 1FP1D 1OYWA 4CICA 1QZZA 4PCQA 2QYOA 2OD5A 2QENA 3WTUC 1U5TB 3GFLA 2LF8A 4ENKA 3R4KA 1CF7B 4G7OF 4HF1A 2V1XA 2JT1A 2DW4A 3SQNA 4O5VA 1W4MA 2HKOA 4A6DA 3KETA 5BPDA 1RZ4A 4WWCA 5K5RA 2H09A 3GFJA 3U1DA 2XIGA 3HUGA 4I0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B59 A;  2P8T A;  4M72 A;  2ZBK A;  1U5T A;  4O3M A;  4F7Z A;  1BOA A;  2O3F A;  3SZT A;  4PZJ A;  2WWY A;  3K1N A;  2L4M A;  2GXG A;  1TNS A;  1GHC A;  3WGI A;  1BI2 A;  1K79 A;  3MAJ A;  4RGS A;  4L9N A;  2D1H A;  4M9X A;  2EFP A;  3OOP A;  5DD8 A;  4HLX A;  3E5U A;  3RTR A;  3ZMV A;  3EET A;  2GWR A;  1SMY F;  3AAF A;  3BPX A;  4L5J A;  2R7F A;  3ZN0 A;  5CLS A;  3R61 A;  3VOD A;  3T5X A;  4ZZL A;  2NNN A;  2WTE A;  3B73 A;  2PEX A;  1J75 A;  3M8E A;  3ZN1 A;  1DPU A;  2BBY A;  5LHG A;  5LGT A;  3V4G A;  3T8R A;  3VFZ A;  3WGH A;  1YO5 C;  2COM A;  1I27 A;  2XKP A;  3RKX A;  5CVV A;  1RIO H;  5L3E A;  2KJC A;  2GQQ A;  4ZH4 F;  2RC4 A;  1EV7 A;  3ZQ7 A;  3HRM A;  2MLK A;  2STW A;  1XSV A;  2VOO A;  2HR3 A;  3BJA A;  3KLN A;  3LQQ A;  2DI3 A;  1DUX C;  3B02 A;  4EJW A;  4EJT A;  3RKY A;  3QP5 A;  4LD5 A;  1FT9 A;  1FWZ A;  2VN2 A;  1QO0 D;  2E1N A;  6PAX A;  2EA4 A;  2V6C A;  3IL2 A;  1O3S A;  4ASN A;  3T8T A;  2VE8 A;  2CGP A;  4HAM A;  4CYD A;  4CO8 A;  1ZG1 A;  3FF5 A;  4I02 A;  5DCF A;  3LA2 A;  3R0J A;  3NQO A;  3N4M A;  5DCM A;  4HDU A;  4YFN F;  1O7L A;  3D0S A;  2ZKZ A;  1F1Z A;  3GF2 A;  1F5T A;  1K6O A;  3ELK A;  3J81 K;  1S3J A;  3L2C A;  1J9I A;  4WXD A;  3ERE D;  1KU9 A;  4MGR A;  5DYM A;  3C1D A;  4JBA A;  2NRA C;  4BHC A;  3K69 A;  2FBK A;  5F6F A;  1IXS B;  4HQE A;  4HLY A;  2P7C B;  1XDU A;  4HX7 A;  4L0Y B;  2VOP A;  1YYV A;  4M71 A;  1S7A A;  2G9W A;  3E5X A;  3V7C A;  2QM3 A;  2CO5 A;  5E1X A;  5ICF A;  4BAY A;  2XRN A;  1U6G A;  1IN7 A;  2D2W A;  3O6B B;  3IRR A;  3DPT A;  2UXN A;  1A04 A;  2IA0 A;  2XUB A;  3BY6 A;  4IVN A;  3SHF A;  5KK1 A;  3L7W A;  4KFC A;  4DNC A;  5FD6 A;  1BC8 C;  2IP2 A;  1Y0U A;  5DV5 A;  1TBX A;  2DPU A;  4OIP F;  5LRR A;  1G3T A;  1SFX A;  2MLG A;  4N9I A;  1XCV A;  5J6X A;  2Z3Y A;  2F5D A;  1HST A;  1L3L A;  2P5L C;  3JW4 A;  5D6E A;  1MJA A;  1IAW A;  2QBY B;  4G7Z F;  3WTS C;  3F8B A;  3KFW X;  4IF4 A;  4M74 A;  1J0R A;  3GEZ A;  1D5V A;  1ZLK A;  3NRV A;  3TDZ C;  1H0M A;  1JHH A;  4Y13 A;  3N97 A;  1JGS A;  2NYX A;  3ZMS A;  2P5K A;  1KQ8 A;  4G94 A;  4NQW A;  2RV8 A;  1WI9 A;  5E8I A;  1XGM A;  4OOI A;  4KUM A;  1QQI A;  2ISZ A;  2Z99 A;  3WTY C;  3GLX A;  4U0W A;  2L01 A;  4U7D A;  5LGU A;  3F72 A;  4EGY A;  5HVQ C;  1SAX A;  3QPH A;  2HS5 A;  3W6K B;  4ENN A;  3KP6 A;  1T98 A;  2IRF G;  2RQP A;  5LRS A;  1LDJ A;  2XRO A;  4ZYE A;  3FWE A;  3BOQ A;  2QVO A;  2IJL A;  5TRD A;  4ESJ A;  3FX3 A;  5ICG A;  1I1G A;  2M87 A;  3MCZ A;  1GVJ A;  4JQF A;  1Q1H A;  4AIJ A;  1ZLJ A;  3REO A;  2Q0O A;  2M1B A;  2IPQ X;  3RKW A;  1B4A A;  2QLZ A;  1HW5 A;  5D8K B;  5D5V B;  1FYL A;  4BNC A;  4WK8 F;  2L54 A;  4IRI A;  2PN6 A;  2C6Y A;  1Z6R A;  1P4X A;  4RGX A;  1Z6T A;  1SFE A;  1TW3 A;  4OIQ F;  4KN7 X;  3H3Z A;  1U2W A;  2O61 A;  2FNA A;  3H92 A;  4AWX B;  4AIH A;  2AS5 F;  2OA4 A;  5TJJ A;  4KIF A;  3TKY A;  4LGW A;  3QU6 A;  3QP6 A;  4IRG A;  1FY7 A;  1O7F A;  2HYG D;  3BZ6 A;  2OZ6 A;  2HQR A;  2OAZ A;  3LFK A;  4WCG A;  4OIR F;  4P96 A;  1FPQ A;  2HOE A;  1PDN C;  2M30 A;  2W24 A;  3BJO A;  2XVC A;  4LK0 F;  2VC1 A;  1W7P A;  1U78 A;  4HV6 A;  3RI4 A;  3T0Y A;  4L0Z B;  2QZ8 A;  5F64 A;  4L9V A;  1J2X A;  5E20 A;  1T6S A;  1R00 A;  4MHG A;  4UVB A;  4KIB A;  4YG2 F;  3FMS A;  1Z7U A;  4FX4 A;  4M6X A;  5DUI A;  3JSP A;  3HHH A;  1J7K A;  1AOY A;  4GO1 A;  1BI3 A;  4HF0 A;  2Y75 A;  4IPA A;  1IRF A;  1GXQ A;  3F8M A;  2F5F A;  4LLN A;  3HYI A;  2CG4 A;  2O0Y A;  2FOK A;  1UHW A;  1DPR A;  1ON2 A;  4UVA A;  4I7H A;  2FXA A;  3CDH A;  3TQN A;  2WV0 A;  3K1M A;  2ZME B;  5J8F A;  4G7H F;  1EH8 A;  4XBF A;  1ON1 A;  1O3R A;  3LAP A;  3R0A A;  1LDK B;  1HW2 A;  3WU0 A;  2STT A;  3M7G A;  1LNW A;  3KEQ A;  1H9G A;  1JE8 A;  5HLH A;  2GAU A;  1R5G A;  2M8E A;  4R8H A;  4YFK F;  5D5X B;  2GIV A;  3CTA A;  3I53 A;  1S7O A;  3TO9 A;  1O3Q A;  1W5T A;  3VEP A;  1P4W A;  4RS8 A;  3GO5 A;  2G7U A;  2HTS A;  2P6S A;  3MEX A;  3J7A O;  4S04 A;  1WRJ A;  3QU3 A;  1IUY A;  3GX4 X;  2PMH A;  4LG0 B;  3EQL F;  4K2E A;  1BIB A;  2WC2 A;  2ZNZ A;  1ODD A;  2K27 A;  3LA7 A;  2LSO A;  1Z1D A;  1FBQ A;  3E6D A;  4XLN F;  3RPU A;  2V79 A;  1DDN A;  2HKX A;  1S29 A;  2KIM A;  2FBI A;  2CW0 F;  4R1H A;  1BI1 A;  4TV7 A;  2EV5 A;  4CDG A;  2J5O A;  2VBX A;  4U0Y A;  5L3F A;  3E6M A;  1IN5 A;  4M6Y A;  3BWG A;  5IT3 A;  3RYP A;  1ZH5 A;  5ICC A;  5EEH A;  1HXD A;  1SMT A;  2FBH A;  3MQ0 A;  3FMQ A;  3BDD A;  1OPC A;  3P9I A;  4LG0 A;  3DEU A;  2Z5U A;  3MZH A;  1KQ0 A;  2JZY A;  2MH9 A;  3CJN A;  4KIC A;  3EYY A;  4XSZ F;  1BC7 C;  1J5Y A;  4RAZ A;  1KU7 A;  2JTV A;  3L09 A;  2NNY A;  4I2O A;  1B9N A;  1YS6 A;  4XSX F;  4LB6 B;  4HBL A;  5HLG A;  2VBZ A;  1ZG3 A;  2PQ8 A;  3GW2 A;  4MTD A;  2BGC A;  2H6B A;  1FBS A;  5JHU A;  5K5Q A;  5FGM A;  3CO6 C;  4IJA A;  1SD5 A;  2A61 A;  4KMF A;  4B8X A;  2B0L A;  2G7H A;  4KNY A;  1XGO A;  5CVR A;  5CVJ A;  2F5E A;  3JAM K;  1YW8 A;  2EWN A;  1V3F A;  3DP7 A;  3KP7 A;  2HEO A;  4ZZD A;  2IT0 A;  3KLO A;  2FML A;  1QPM A;  3V7S A;  2FU4 A;  3DQV C;  2TDX A;  4UV8 A;  2IA2 A;  4A0Z A;  1IZ1 A;  3ZPL A;  1F4K A;  5DCM B;  4A0Y A;  1XGS A;  2E7W A;  3IWF A;  4EVI A;  2A68 F;  2QQ9 A;  1U8R A;  3BJ6 A;  1SD4 A;  4RGU A;  2ZO4 A;  2QQA A;  3V8K A;  1HKS A;  4BXU A;  3F8C A;  5L3B A;  3IC7 A;  2O6G E;  1RI7 A;  3WE3 A;  4BYY A;  2IW5 A;  3FM5 A;  5E8G A;  2MC3 A;  2L4A A;  2PMU A;  4BHP A;  2DFI A;  5LGN A;  2MBF A;  3CUQ C;  2JRT A;  3E5Q A;  1UCR A;  3H3U A;  5EEG A;  2Y0M A;  4JK1 X;  4P9F A;  1CGP A;  4HOB A;  2EFW A;  3FM3 A;  5ICE A;  4QWQ A;  4Y15 A;  2HZT A;  1QZY A;  4R79 A;  5LEK A;  2ESN A;  4UVC A;  4RB3 C;  3F21 A;  1FP2 A;  4GYG A;  2Q8K A;  3ECO A;  3RYR A;  2H27 A;  3S2W A;  5DUK A;  4ENJ A;  4G6D A;  3F6O A;  5JFR A;  1T0F A;  4GGG A;  3CO7 C;  5ERI A;  4HF2 A;  1D8K A;  2L3D A;  2VT2 A;  1FZP B;  1J59 A;  4L18 B;  4IRH A;  1ONV A;  2OZU A;  4EM0 B;  2XGX A;  5LLQ A;  1FOK A;  4ESF A;  1UHM A;  4U88 A;  4PDK A;  4DQ2 A;  2VON A;  2L02 A;  1SFU A;  4PGG A;  3U9G A;  1XGN A;  1HQC A;  3QOP A;  2VE9 A;  5AIP A;  3ML6 A;  1XMK A;  3M9A A;  4FT8 A;  3I4P A;  3EDP A;  1IN4 A;  2CSO A;  1BI0 A;  3JAM Z;  1FC3 A;  2Z33 A;  2M5W A;  1UB9 A;  3HSF A;  3DXJ F;  3BP8 A;  4FX0 A;  4G6Q A;  3K1P A;  1E17 A;  1XB4 A;  3HRS A;  4G8X A;  1IXC A;  4D0P A;  2K4J A;  3OV8 A;  4HV5 A;  4NB5 A;  5HS8 A;  5DDG A;  5L3D A;  4M9Z A;  4OIO F;  5JI6 A;  2YR2 A;  3WTT C;  4EJU A;  1HKQ A;  1KU3 A;  1O3T A;  4KYW A;  2QQB A;  2YU3 A;  3TOB A;  3FZV A;  1Z91 A;  3WGG A;  5BMZ A;  3KCC A;  3I5U A;  4MEX F;  3CUQ A;  3QRF F;  3QAH A;  1ZHF A;  4LLL A;  3FMR A;  3GZ6 A;  2VOD A;  3V8J A;  1U3E M;  1H9T A;  5FFZ A;  1R22 A;  2PG4 A;  5ED4 A;  5H6Q A;  4KN4 X;  4Y17 A;  3I59 B;  4BH9 A;  1DP7 P;  3V7R A;  3E3V A;  3Q9S A;  3IRQ A;  2RDP A;  3KP5 A;  3F22 A;  1EH7 A;  3F6V A;  1BJA A;  3E6C C;  3DKW A;  2YX4 A;  2PI0 A;  2VC0 A;  4A0X A;  3J81 Z;  1R36 A;  2DO7 A;  5DD4 A;  1K78 B;  4BQA A;  2VXZ A;  3ZMZ A;  1IN6 A;  5E1W A;  4UHT A;  4WF2 A;  3I59 A;  2RGV A;  1XCB A;  2RVC A;  2EFQ A;  1JHF A;  1HSJ A;  3HIF A;  5AON A;  5LHI A;  1RNL A;  2A6E F;  3V8L A;  3LAJ A;  3Q9V A;  4S05 A;  1G3S A;  5ILV A;  1F9N A;  1K78 A;  1LB2 A;  1PP7 U;  1V4R A;  5DEQ A;  4LK1 F;  1R1U A;  1YS7 A;  1PUE E;  2EJR A;  2A6H F;  3GYH X;  2EA2 A;  3MZY A;  3G3Z A;  4HX4 A;  1W7P B;  4HDV A;  4P55 A;  2XAQ A;  2XV4 S;  4U0V A;  1XMA A;  3CLO A;  1GXP A;  3I64 A;  2ACJ A;  3I58 A;  1ZRE A;  1PP8 F;  2KJB A;  5D6F A;  3P7N A;  3VB2 A;  3WTZ A;  5H20 A;  5E1Z B;  3QPT A;  2P6T A;  4YFX F;  2EFN A;  4UV9 A;  3HSR A;  1RUN A;  3M8F A;  1Z05 A;  1STZ A;  2PJP A;  4G9Y A;  1L0O C;  1FSH A;  3DFG A;  4OIN F;  3I71 A;  5JR3 A;  2OQR A;  3TO6 A;  5FFX A;  4O6J A;  2RN7 A;  1IXR C;  3TO7 A;  2PLY A;  1KYW A;  1D3Y A;  5BPI A;  4GCV A;  2E7X A;  1NHA A;  5CVU A;  2X4H A;  1FBU A;  1I5Z A;  1ZRC A;  2LKP A;  5FD5 A;  4MTE A;  3IKV A;  3U2R A;  4GYI A;  3R60 A;  3TGN A;  2EV6 A;  1FYK A;  2MD5 A;  4XLP F;  2FSW A;  5E18 F;  4CGZ A;  3EUH A;  4HA8 A;  2ETH A;  2HGC A;  1KYZ A;  1P6R A;  1KU2 A;  4ZYG A;  1LQ1 A;  1I6X A;  4E70 A;  2EFO A;  4MEY F;  1W7P D;  1MGT A;  3WOD F;  1UST A;  1QBJ A;  1G4D A;  4L5I A;  3C18 A;  1G3W A;  4FHT A;  4HYE A;  2O8X A;  5BQT A;  3ABT A;  5F1R A;  2YPR A;  3WU1 B;  1XD7 A;  4PGH A;  2ZXJ A;  1AWC A;  4WX9 A;  4AVP A;  4WXH A;  1WQ2 A;  3DPL C;  1MDM A;  2QUF A;  1YQA A;  4Z2Y A;  1FSE A;  3VOE A;  1LEB A;  2JSC A;  2OBP A;  3FXU A;  2MA3 A;  1IF1 A;  2EV0 A;  5D5W B;  4ZYD A;  1FNN A;  3LWF A;  1ZAR A;  1ZG5 A;  5HS9 A;  3IHU A;  4HZF A;  4I98 B;  1LEA A;  4RB1 A;  5BS6 A;  1LJ9 A;  3W6J B;  3ZMT A;  2A69 F;  2NAZ A;  1OKR A;  5HDK A;  5H6R A;  3E6B A;  1R1V A;  5JVT A;  1BBY A;  5HDG A;  1WKM A;  4L9J A;  1R58 A;  5HLI A;  4MQ9 F;  2VBY A;  3WTW C;  2MH2 A;  2RNJ A;  2K86 A;  4ON0 A;  2GXB A;  3GWZ A;  1YIO A;  2EK5 A;  4MQV A;  4N0B A;  5LEJ A;  5D4R A;  3K2Z A;  2ESH A;  1CF7 A;  5D4S A;  3COA C;  4HW0 A;  3R6S A;  2ZCW A;  3HTS B;  1G6N A;  4Q48 A;  1LDD A;  5ILU A;  2DBB A;  4HQM A;  2KIF A;  4LB5 A;  5K1Y A;  2D45 A;  2XKO A;  1KQ9 A;  2DK8 A;  3BRO A;  2YSR A;  4KA4 A;  2ZFW A;  2CQK A;  3PQJ A;  4N9H A;  2EB7 A;  2CWE A;  2FEZ A;  3SFZ A;  2AXL A;  2Y48 A;  2F5C A;  2CFX A;  3C7J A;  3FXQ A;  1MKM A;  4XRF A;  4EQQ A;  1R5H A;  3ABU A;  2OU2 A;  1RUO A;  2XHK A;  2GA2 A;  2GA1 A;  1REP C;  4RB2 C;  1FYM A;  3RIR A;  1LVA A;  3J80 K;  4UNO A;  2ISY A;  2W85 A;  2JPC A;  2W25 A;  2XAS A;  3K0L A;  1BIA A;  1T2K A;  5CVI A;  4IHS A;  1S8N A;  4P5O A;  3MWM A;  3ZMU A;  4EJO A;  3ZMD A;  1VTN C;  1BN5 A;  1ZRF A;  4EMS A;  1TLH B;  1TNT A;  2P7V B;  3E97 A;  1XN7 A;  1WSU A;  4BHB A;  2NS0 A;  3LQR A;  2A3S A;  2DAO A;  2KRF A;  3HRT A;  3ISP A;  4LMY A;  1XSD A;  4ESB A;  2Z9O A;  2XAF A;  5CJ9 A;  2DPD A;  4UUV A;  2UZK A;  3P9C A;  1TQM A;  2DQR A;  3HRU A;  4H0E A;  1HW1 A;  2A5Y B;  5AIQ A;  3ULQ B;  1QGP A;  1HBX G;  2XAJ A;  4ZYH A;  2P5V A;  2LNB A;  3DF8 A;  4EV0 A;  1TQI A;  3KZZ A;  2XAG A;  3WTV C;  2ZJ2 A;  2FMY A;  2W57 A;  3HOS A;  2H94 A;  3KE2 A;  4OMY A;  2HTJ A;  3GUD A;  3JSO A;  4EGZ A;  1BM9 A;  2BYV E;  2J5P A;  4U7B A;  2M45 A;  3HTU A;  3Q5F A;  1IRG A;  3WE2 A;  1OYI A;  1T39 A;  2FA5 A;  2BEO A;  3EYI A;  2HQN A;  3SXY A;  1FX7 A;  1S6L A;  4A5M A;  1USS A;  2IVM A;  2O03 A;  2Q2E A;  2HWV A;  4CHU A;  3CUQ B;  1G3Y A;  5FLX K;  1T38 A;  5HDN A;  5ILS A;  3J80 Z;  1B1B A;  2HFH A;  3HOT A;  4KIG A;  1KGS A;  4WXC A;  2OQG A;  2IA1 A;  3TDU C;  2DTR A;  2HDC A;  1ULY A;  2DLL A;  2HYF A;  1R23 A;  1B9M A;  2V1U A;  5KVR A;  4QLC U;  3RDI A;  4YIF A;  3F23 A;  2ZNY A;  2BE5 F;  4AD9 A;  2K4B A;  4RAY A;  1TTY A;  1ZAO A;  4ENM A;  2UWM A;  5E17 F;  1R1T A;  1K7A A;  1JXS A;  3D5L A;  4M9S A;  3M1E A;  4M73 A;  1XSX A;  4L9T A;  3RJP A;  2LF7 A;  1ZGA A;  5D5U B;  5A2Q K;  1SD6 A;  4GXO A;  1TW2 A;  5LBQ A;  3LA3 A;  3SZP A;  5HOO A;  4I01 A;  1P2F A;  1HKT A;  1XDS A;  2P4W A;  3GFI A;  4UXN A;  2QBY A;  1FLI A;  3CUO A;  1TQP A;  5IT9 K;  5CYV A;  4B09 A;  4Q5S F;  3O3K A;  3O2P E;  4LJZ F;  2W84 A;  3IKT A;  1ZGJ A;  3T1B A;  3LST A;  1WWX A;  3TOA A;  5J8C A;  4OU0 A;  2UXX A;  3ZP5 A;  4AIK A;  2CYY A;  5HS7 A;  3ROU A;  4A6E A;  2DU9 A;  2GZW A;  3GZ5 A;  4LLG F;  3FXR A;  2VBW A;  1MD0 A;  3IWZ A;  4CZZ A;  4Q47 A;  3P9K A;  4A12 A;  3RPQ A;  1I1S A;  3HHG A;  4IHT A;  2FNP A;  4EM1 A;  5LHH A;  3GVA A;  4A2U A;  1P4A A;  2JPB A;  2KIU A;  1O57 A;  4EM2 A;  1MJ9 A;  1IW7 F;  1E2X A;  5FO5 A;  5D8L B;  5FLX Z;  2BV6 A;  2PFB A;  5L3G A;  1YG2 A;  1OYY A;  3PFI A;  4I0B A;  4I09 A;  1P92 A;  1B6A A;  4IXA A;  5BOX A;  4KT5 C;  2FE3 A;  4OMZ A;  2R3S A;  2FF4 A;  1MZB A;  4HX8 A;  2LDU A;  4A5N A;  4RGR A;  2PBI A;  4MNU A;  2ELH A;  2V1D A;  3MFK A;  3F8N A;  2D1V A;  1C0W A;  1W5S A;  3KZY A;  4RB0 A;  1EH6 A;  3GFM A;  4EJV A;  3KP3 A;  3I0T A;  2H6C A;  3BPV A;  1YLF A;  3F8F A;  4YII A;  2QWW A;  2VT3 A;  3HSE A;  1YW7 A;  1ZN2 A;  2YX7 A;  4CXF A;  5A2Q Z;  4NHJ A;  2FRH A;  1D8J A;  4ETS A;  3I54 A;  1R7J A;  3L00 A;  1U5T C;  2V9V A;  3JTG A;  1MJB A;  2E1C A;  3WTX C;  4KDP A;  5IT9 Z;  3K9T A;  2XAH A;  4P9U A;  2R7D A;  3KP4 A;  3PQK A;  2K7L A;  2A07 F;  1SD7 A;  3ECH A;  3KEO A;  3G73 A;  1IN8 A;  1MDM B;  2K02 A;  2KKO A;  3F3X A;  1KA8 A;  2DT5 A;  1YTY A;  2DK5 A;  1QNT A;  5L3C A;  1YW9 A;  3L9F A;  4LFU A;  3KP2 A;  1YFH A;  3DV8 A;  3NEU A;  2RKH A;  1X3U A;  3FHZ A;  5FB2 A;  1UFM A;  4KMU X;  1OR7 A;  3GXO A;  2DQL A;  3JTH A;  1OMI A;  1Z9C A;  2FQ3 A;  1ZYR F;  1ZRD A;  3C3W A;  2F2E A;  5K5O A;  2ADU A;  4Q4Z F;  2ZME A;  2X0L A;  3WG9 A;  1FP1 D;  1OYW A;  4CIC A;  1QZZ A;  4PCQ A;  2QYO A;  2OD5 A;  2QEN A;  3WTU C;  1U5T B;  3GFL A;  2LF8 A;  4ENK A;  3R4K A;  1CF7 B;  4G7O F;  4HF1 A;  2V1X A;  2JT1 A;  2DW4 A;  3SQN A;  4O5V A;  1W4M A;  2HKO A;  4A6D A;  3KET A;  5BPD A;  1RZ4 A;  4WWC A;  5K5R A;  2H09 A;  3GFJ A;  3U1D A;  2XIG A;  3HUG A;  4I0A A; 
#chains in the Genus database with same CATH topology
 2BY1 A;  2E5N A;  3S15 J;  1B59 A;  2P8T A;  1NG7 A;  4RAG A;  2HYJ A;  4M72 A;  2ZBK A;  3TL4 X;  1U5T A;  4BY7 J;  3OS0 A;  4O3M A;  2Y69 H;  4F7Z A;  1BOA A;  2O3F A;  1X1A A;  3SZT A;  4PZJ A;  2WWY A;  3K1N A;  4YEJ A;  1V5G A;  4MO7 A;  2L4M A;  3K10 A;  4FE4 A;  2GXG A;  1TNS A;  1A6Q A;  1NK3 P;  1FMW A;  4BY1 J;  1ZGW A;  1GHC A;  3WGI A;  1BI2 A;  1K79 A;  3MAJ A;  4RGS A;  4L9N A;  2D1H A;  3P5J A;  4M9X A;  2EFP A;  2E35 A;  3OOP A;  5DD8 A;  4HLX A;  1UG0 A;  2OCE A;  3I4M J;  2K5C A;  2WAE A;  3E5U A;  3RTR A;  4DJA A;  3ZMV A;  5F1J A;  3EET A;  4NBQ A;  2BVL A;  3PO2 J;  2GWR A;  3K4L A;  1SMY F;  3HOU J;  3AAF A;  3BQY A;  3BPX A;  4NC6 A;  4YIR X;  4BU2 A;  4L5J A;  1VI0 A;  2R7F A;  3BQZ A;  3ZN0 A;  2JK3 A;  2KZV A;  5CLS A;  3QYF A;  3R61 A;  3VOD A;  3T5X A;  4ZZL A;  3BCB A;  2NNN A;  2O8K A;  2TRT A;  4E7I A;  2WTE A;  3B73 A;  2VI6 A;  4W97 A;  4GDF A;  2AQF A;  2PEX A;  1F43 A;  1J75 A;  4E7J A;  3M8E A;  3UKG A;  3ZN1 A;  4Y52 J;  4A3B J;  1DPU A;  2QGU A;  2ELJ A;  2VJ5 A;  2BBY A;  3VYS B;  5LHG A;  4JOM A;  3G6E I;  5LGT A;  2BXY A;  4UUS A;  2JA6 J;  1IC8 A;  3V4G A;  1WZ2 A;  3T8R A;  1Z7L A;  3VFZ A;  1OIS A;  3K4J A;  4FCY A;  2R93 J;  2VXD A;  3WGH A;  3S1N J;  1YO5 C;  5IPA A;  2ZJR F;  2COM A;  1I27 A;  2XKP A;  3RKX A;  3BR3 A;  5CVV A;  1RIO H;  3FBN B;  1F36 A;  3QYB A;  3ZQQ A;  5L3E A;  4AID A;  1I39 A;  2QCO A;  2KJC A;  1GV2 A;  2GQQ A;  2LR8 A;  3IH2 A;  4ZH4 F;  5EF6 A;  3OYM A;  2RC4 A;  1EV7 A;  3ZQ7 A;  3HRM A;  2MLK A;  2STW A;  1IV6 A;  1Y6I A;  1XSV A;  3H5A A;  2VOO A;  2DFF A;  2TCT A;  2JUG A;  4UB6 C;  2HR3 A;  4RM3 A;  3MD2 A;  1GLN A;  3BJA A;  1FEX A;  2L9R A;  1ZKG A;  2M4G A;  3KLN A;  5CKT A;  3LQQ A;  2DI3 A;  1DUX C;  2GM4 A;  3B02 A;  4EJW A;  4EJT A;  2XPW A;  3W2V A;  3BG6 A;  3RKY A;  1WJA A;  3VPR A;  1TWH J;  3QP5 A;  2F4O B;  4H4K C;  4LD5 A;  3BG3 A;  1FT9 A;  1FWZ A;  1YX5 A;  1FIP A;  4E7K A;  2VN2 A;  1QO0 D;  2YS9 A;  2E1N A;  3IAS 2;  3ERM A;  6PAX A;  2EA4 A;  2V6C A;  2V4J C;  4A93 J;  3GCM A;  2E19 A;  3IL2 A;  1O3S A;  3I56 I;  3PIP F;  3CES A;  2EH3 A;  2VPR A;  4ASN A;  4B44 A;  2D5V A;  3T8T A;  2VE8 A;  4ZJZ A;  1ETK A;  1W0T A;  3ZQH A;  2CGP A;  1VQ6 I;  4HAM A;  4CYD A;  1WH7 A;  4CO8 A;  3SEZ A;  2DXI A;  1ZG1 A;  1W0U A;  2B63 J;  3FF5 A;  2WB1 N;  4I02 A;  5DCF A;  3WG7 H;  3LA2 A;  2KDO A;  3IH3 A;  3R0J A;  3NQO A;  3N4M A;  5DCM A;  4HDU A;  4BEH A;  2V26 A;  4YFN F;  2KP6 A;  1OCR H;  1O7L A;  1W5C C;  3D0S A;  2Y9Y A;  2ZKZ A;  1XMX A;  1F1Z A;  2VKV A;  3GF2 A;  1F5T A;  3ZQC A;  1K6O A;  4F91 B;  1WHU A;  2OV7 A;  3ELK A;  2XSD C;  5FJ8 J;  4DZJ A;  2X6X A;  3J81 K;  1S3J A;  3KIO A;  4F93 B;  3L2C A;  3PIO F;  3DU6 A;  2DA3 A;  3IAM 2;  2DA7 A;  2Q2E B;  2X85 A;  1J9I A;  4WXD A;  1IDZ A;  3ERE D;  1KU9 A;  4MGR A;  2LP0 A;  5DYM A;  1E0E A;  3C1D A;  3RQI A;  4JBA A;  4XR6 A;  1MMA A;  2NVU B;  2NRA C;  4BHC A;  3OYA A;  3K69 A;  2FBK A;  5F6F A;  1QU3 A;  2R7Z J;  1JKR C;  5M3M J;  3BTJ A;  4HPQ A;  3SFI A;  1SVL A;  3IP4 B;  2ZC2 A;  1IXS B;  4HQE A;  4HLY A;  2P7C B;  3Q3S A;  3BT9 A;  1APL C;  1XDU A;  2K3F A;  2CRG A;  4HX7 A;  5GP9 A;  4L0Y B;  2VOP A;  1YYV A;  3GME A;  4M71 A;  1S7A A;  2H8W A;  2G9W A;  3E5X A;  3Q0V A;  1LPQ A;  1JTX A;  3V7C A;  2QM3 A;  2WY8 Q;  2CO5 A;  1Z67 A;  2M4K A;  5E1X A;  5ICF A;  1HDP A;  4C2U A;  4BAY A;  1UZC A;  1V5E A;  5FKM A;  2XRN A;  1U6G A;  1IN7 A;  2D2W A;  3M3Y J;  5J40 A;  3O6B B;  3IRR A;  4U87 A;  2NS8 A;  2OPT A;  2L9V A;  3SDB A;  1OJL A;  3DPT A;  2UXN A;  2L7F P;  1A04 A;  1ETV A;  2E1M C;  2IA0 A;  5IP9 J;  2XUB A;  3BY6 A;  4IL6 C;  4IVN A;  3SHF A;  5KK1 A;  3L7W A;  1FMV A;  4KFC A;  2K9Q A;  4DNC A;  5FD6 A;  3MN2 A;  1BC8 C;  5BNG A;  3AL0 C;  2IP2 A;  1Y0U A;  5DV5 A;  1TBX A;  2DPU A;  4OIP F;  5LRR A;  1G3T A;  1SFX A;  1YIJ I;  2MLG A;  2VPL A;  3BZK A;  4N9I A;  2IS4 A;  1XCV A;  5J6X A;  3ZR8 X;  2Z3Y A;  5F0H A;  2E2I J;  2F5D A;  2QQ8 A;  1HST A;  1D0Z A;  2P5L C;  1L3L A;  3JW4 A;  5D6E A;  1MJA A;  1IAW A;  2QBY B;  3I4N J;  2DMN A;  4G7Z F;  3WTS C;  1K83 J;  3F8B A;  1MSE C;  2PJR A;  1W1W E;  3KFW X;  4IF4 A;  4M74 A;  1J0R A;  2HQ5 A;  3GEZ A;  2HVR A;  1IUF A;  1D5V A;  1MH3 A;  3L1P A;  1ZLK A;  3OS1 A;  3NRV A;  2BW3 B;  3OIP A;  4E6K G;  3TDZ C;  1H0M A;  1XS9 A;  1JHH A;  2MGQ A;  2L0K A;  4Y13 A;  2ELK A;  3N97 A;  2CUJ A;  3JRG A;  3JR9 A;  2QSH X;  1JGS A;  2NYX A;  4A3E J;  3ZMS A;  2P5K A;  3JRI A;  1KQ8 A;  4G94 A;  3GLL A;  1PYV A;  4NQW A;  2RV8 A;  1WI9 A;  4M3B A;  5E8I A;  4BAC A;  3CJT B;  1XGM A;  2K9N A;  5M5W J;  4RM2 A;  4OOI A;  4KUM A;  1QQI A;  5J1U A;  2ISZ A;  2Z99 A;  3SJM A;  3DBH B;  4JP0 A;  3WTY C;  3GLX A;  4U0W A;  1BR2 A;  3I55 I;  4RAF A;  2L01 A;  4D9J A;  1DQU A;  3JCU C;  4U7D A;  3W2W A;  5LGU A;  1OLT A;  3F72 A;  4EGY A;  1FOW A;  4CYC A;  5HVQ C;  4QTR A;  4OAY A;  1SAX A;  1VQP I;  1VQ4 I;  3QPH A;  2HS5 A;  3JRB A;  3W6K B;  4ENN A;  4Y7N J;  4IHX A;  3KP6 A;  3A02 A;  1T98 A;  5B1B H;  2RQP A;  2IRF G;  3S1R J;  1P9Q C;  2LOO A;  5LRS A;  1LDJ A;  2XRO A;  2Z2S B;  2DA4 A;  4ZYE A;  3FWE A;  2BZT A;  3BOQ A;  2E1M B;  2QVO A;  2ZJQ F;  2IJL A;  3LOC A;  2XPU A;  4BL0 B;  5TRD A;  4ESJ A;  1U9O A;  3FX3 A;  4MIM A;  5ICG A;  3DEE A;  3AL0 B;  1ETW A;  1I1G A;  2M87 A;  2L7M P;  3MCZ A;  1GVJ A;  2LYC A;  4A3L J;  4JQF A;  2ECC A;  1Q1H A;  5M3F J;  4AIJ A;  1ZLJ A;  3REO A;  5IYD J;  4IOA F;  3EPZ A;  2R7X A;  2WAQ N;  2Q0O A;  2M1B A;  2IPQ X;  3RKW A;  1B4A A;  2QLZ A;  1HW5 A;  2QF7 A;  5D8K B;  5IY5 H;  5D5V B;  1FYL A;  3PJR A;  2K85 A;  4BNC A;  1WJB A;  2JQ7 A;  3FK7 A;  2LY1 A;  4CCK A;  3MVP A;  2M0C A;  4WK8 F;  2L54 A;  4IRI A;  1QVT A;  2PN6 A;  2C6Y A;  1Z6R A;  4XLE A;  1P4X A;  5CQG A;  4DIQ A;  4ZDO A;  3CP8 A;  3DCF A;  4RGX A;  1BJZ A;  1Z6T A;  1SFE A;  2OTL I;  1TW3 A;  2I10 A;  2K9M A;  2X9D A;  4OIQ F;  4W1U A;  3PUF A;  4KN7 X;  1HC8 A;  3H3Z A;  1U2W A;  1SVM A;  1AKH A;  2O61 A;  2FNA A;  3H92 A;  4AWX B;  2MAB A;  4PUS A;  1RPW A;  1PUF B;  4AIH A;  1ACI A;  2AS5 F;  2OA4 A;  5TJJ A;  5CPR B;  1H88 C;  4KIF A;  3TKY A;  2XC7 A;  4LGW A;  3QU6 A;  3QP6 A;  1S9H A;  4IRG A;  1FY7 A;  2R5Z B;  5M5Y J;  1O7F A;  1PJR A;  2HYG D;  3BZ6 A;  1MIJ A;  2HQR A;  2OZ6 A;  4PSX A;  3ABL H;  3OMY A;  2OAZ A;  3LFK A;  5M5X J;  4WCG A;  5H2F C;  3GTP J;  3E7L A;  5GTH C;  4OIR F;  4P96 A;  2GIZ A;  1FPQ A;  2HOE A;  1PDN C;  1IRX A;  3DU5 A;  2LLK A;  2M30 A;  2DA1 A;  2W24 A;  1JI8 A;  4P1W A;  3K7A J;  4UY8 I;  3BJO A;  2XVC A;  1ORK A;  2LRD A;  2EIM H;  2K9S A;  4LK0 F;  2A5W A;  1W7P A;  2VC1 A;  1U78 A;  3BLY A;  4HV6 A;  5HNF A;  3RI4 A;  1PUF A;  3WHC A;  3T0Y A;  5IOZ A;  4L0Z B;  1XTA A;  5FKN A;  2QZ8 A;  5F64 A;  4L9V A;  1J2X A;  5IP6 A;  3OWT A;  2XPV A;  5E20 A;  1T6S A;  4IEJ A;  3GTM J;  2L5Q A;  3ONQ A;  1R00 A;  1E3O C;  4MHG A;  2XSJ C;  3QOD A;  4UVB A;  4KIB A;  4YG2 F;  3J7Z I;  3FMS A;  1Z7U A;  4FX4 A;  2OUM A;  4BUP A;  2DA2 A;  4M6X A;  5DUI A;  3JSP A;  1S7E A;  3VYU B;  3HHH A;  1B8I A;  1J7K A;  1AOY A;  4GO1 A;  4X6A J;  2NVX J;  1BI3 A;  4HF0 A;  2Y75 A;  3MKL A;  3ZOB A;  4IPA A;  3UR3 C;  3TMO A;  2R7W A;  1WJE A;  1TC3 C;  5EZH A;  1IRF A;  1GXQ A;  1Z0X A;  1T8I A;  1ERD A;  3F8M A;  3K4K A;  3OYN A;  2F5F A;  4LLN A;  2F4M B;  3HYI A;  3S3O A;  2CG4 A;  2O0Y A;  1G2H A;  1I3Q J;  3GZN B;  2FOK A;  4HNV A;  1UHW A;  2V6E A;  1DPR A;  2W82 A;  4DW6 A;  4JX5 A;  1ON2 A;  4Y3O A;  4UVA A;  4I7H A;  2ZB9 A;  2FXA A;  3I9V 2;  3CDH A;  1YRN B;  2P81 A;  3VSL A;  3TQN A;  4BS9 A;  2WV0 A;  3K1M A;  4MFD A;  1QHG A;  2ZME B;  5K7Z A;  5J8F A;  5GPC A;  3BG9 A;  4G7H F;  4XMY A;  1EH8 A;  2A05 A;  3BZC A;  4XBF A;  2MG4 A;  1ON1 A;  1O3R A;  3LAP A;  3R0A A;  2IAI A;  1LDK B;  1MBG A;  1HW2 A;  3H9J A;  3WU0 A;  1RC9 A;  1Y0N A;  2STT A;  3M7G A;  4E7S A;  3ABM H;  1LNW A;  3KEQ A;  1X19 A;  1H9G A;  1JE8 A;  5HLH A;  2VQG A;  2DMP A;  2AXT C;  2MW8 A;  2GAU A;  1R5G A;  2DMQ A;  2M8E A;  3DLL F;  4DBR A;  4CH7 A;  4I6Z A;  2CW7 A;  1RRJ A;  1MMD A;  1YRN A;  3JRH A;  4R8H A;  5TGT A;  1X1B A;  4YFK F;  1BL0 A;  5D5X B;  2XF5 A;  2R92 J;  2FUG 2;  2GIV A;  3HUG B;  3CTA A;  2EPF A;  3I53 A;  3DKY A;  3DTK A;  1S7O A;  3TO9 A;  2FQ4 A;  1O3Q A;  3DTE A;  1VQL I;  1W5T A;  4QSH A;  2M8G X;  3HG9 A;  3VEP A;  1P4W A;  4RS8 A;  3GO5 A;  1MBF A;  2G7U A;  2HTS A;  2MC4 A;  5C3E J;  4F3Q A;  2P6S A;  1JGG A;  3MEX A;  2HVQ A;  3J7A O;  3H1C A;  3DEW A;  2XGE A;  4S04 A;  1WRJ A;  3BR0 A;  3QU3 A;  1IUY A;  3FDY A;  3OYJ A;  3GX4 X;  2PMH A;  1SAU A;  4LG0 B;  4IOC F;  4XM3 A;  3EQL F;  4K2E A;  1BIB A;  1TWG J;  4DBQ A;  4HNT A;  2WC2 A;  2ZNZ A;  4ABZ A;  1ZR4 A;  1ODD A;  2K27 A;  3LA7 A;  2LSO A;  3RZO J;  1Z1D A;  1FBQ A;  3OYD A;  3E6D A;  4XLN F;  3RPU A;  3SEQ A;  2V79 A;  1DDN A;  2HKX A;  1S29 A;  2KIM A;  2FBI A;  4RLQ A;  4ZDP A;  2CW0 F;  2E2H J;  4R1H A;  1BI1 A;  2X6W A;  4TV7 A;  2EV5 A;  3FKJ A;  4CDG A;  2V1N A;  2J5O A;  2ID6 A;  2VBX A;  4U0Y A;  1DGR M;  3IUO A;  4N4N B;  3E6M A;  3D5S C;  5L3F A;  1MMG A;  2BY0 A;  1IN5 A;  3G71 I;  4M6Y A;  1JTY A;  3BWG A;  4XIC A;  2DA6 A;  5IT3 A;  3V42 A;  2ZFU A;  1U0J A;  5EEA A;  3RYP A;  1I3A A;  3PNY A;  4EEF G;  5ICC A;  5EEH A;  1ZH5 A;  5F27 A;  2ZSI B;  1HXD A;  1SMT A;  2FBH A;  3MQ0 A;  3FMQ A;  3BDD A;  3HGY A;  3OL3 A;  1OPC A;  3M1C A;  3P9I A;  4LG0 A;  1R49 A;  4UUS B;  1FTT A;  3DEU A;  5C44 J;  2Z5U A;  3MZH A;  4UB8 C;  1JUM A;  1KQ0 A;  2JZY A;  2BHY A;  2MH9 A;  3CJN A;  4KIC A;  3GTG J;  4OAZ A;  5F0F A;  2CS3 A;  3EYY A;  4XSZ F;  2WY7 Q;  1BC7 C;  1WI3 A;  1XG1 A;  1J5Y A;  2EBI A;  2CUE A;  4RAZ A;  2LD5 A;  1KU7 A;  2JTV A;  3L09 A;  5B3S H;  3O8H A;  2NNY A;  4I2O A;  2HXI A;  3OIO A;  2PMZ A;  1B9N A;  3CJR B;  1YS6 A;  2ID3 A;  2R7O A;  2JN6 A;  4XSX F;  4LB6 B;  1RKW A;  4HBL A;  1T0F C;  5HLG A;  4RMN A;  4RBO A;  2VBZ A;  1QVU A;  1ZG3 A;  2PQ8 A;  3GW2 A;  4MTD A;  2BGC A;  2H6B A;  1FBS A;  3CCQ I;  1WCM J;  1V54 H;  5JHU A;  3CCE I;  5KCM A;  3H3V K;  3LL7 A;  5K5Q A;  5FGM A;  2PX9 A;  3UNG C;  3CO6 C;  4IJA A;  3GTJ J;  1SD5 A;  2EIN H;  2A61 A;  4KMF A;  4B8X A;  2B0L A;  2JRM A;  2G7H A;  4IKF A;  4KNY A;  3QQA A;  3K4B A;  1UEL B;  1U9N A;  5EJC A;  1XGO A;  3OYE A;  3H9G A;  2VJJ A;  3RZD J;  5CVR A;  5CVJ A;  1RR7 A;  5EGO A;  2F5E A;  3JAM K;  1VQ9 I;  1YW8 A;  4BQN A;  2EWN A;  1V3F A;  2LRE A;  3DP7 A;  3KP7 A;  4XN3 A;  2ME6 A;  2HEO A;  4ZZD A;  2L7K A;  4A3C J;  5CQE A;  3KLO A;  2IT0 A;  4RA2 A;  2FML A;  1QPM A;  2NXN B;  2UV1 A;  2ME0 A;  3V7S A;  4Y33 A;  3JRC A;  3F9K A;  1E3P A;  1ITY A;  4JYK A;  3CC4 I;  1D1A A;  5B5E C;  2FU4 A;  3FIW A;  1P7J A;  3GTL J;  1Z3X A;  3DQV C;  2TDX A;  3B6C A;  2IA2 A;  4UV8 A;  5IOY A;  4A0Z A;  1IZ1 A;  3S3N A;  2DCE A;  3ZPL A;  2NVY J;  1D0Y A;  2Z1D A;  2ZXH A;  1F4K A;  4ZC3 A;  2H8R A;  5DCM B;  4A0Y A;  4BEH B;  3RQ4 A;  2I8D A;  3S17 J;  1XGS A;  2E7W A;  3IWF A;  2KLO A;  4EVI A;  4XKC A;  2A68 F;  2QQ9 A;  1U8R A;  3BJ6 A;  1SD4 A;  4RGU A;  1PVE A;  3HDD A;  3BR6 A;  2ZO4 A;  4CCL A;  2QSG X;  2QQA A;  3V8K A;  1HKS A;  1EKE A;  4BXU A;  3CCY A;  3F8C A;  2VKH A;  3LFU A;  2E2J J;  1IV8 A;  5L3B A;  3ZXS A;  4XKV A;  4AYB A;  3IC7 A;  1K4T A;  2O6G E;  1RKT A;  1WFX A;  2B9S A;  1RI7 A;  3WE3 A;  4BYY A;  5J4V A;  2IW5 A;  2Y0S A;  3FM5 A;  5EZG A;  5E8G A;  2MC3 A;  2L4A A;  2ZSH B;  5DTD A;  2BY2 A;  1FOX A;  1TT5 B;  2PMU A;  4BHP A;  3MKY B;  2DFI A;  1H8A C;  5LGN A;  2MBF A;  3CUQ C;  2JRT A;  2EZL A;  3E5Q A;  1UCR A;  3H3U A;  5EEG A;  2NS7 A;  2Y0M A;  2X6Y A;  4JK1 X;  3CMM A;  4P9F A;  3TP3 A;  1CGP A;  4HOB A;  3S32 A;  3HM5 A;  2X1C A;  3FIS A;  2EFW A;  3KEY A;  4ITV A;  3FM3 A;  3ZQF A;  4QWQ A;  4Y15 A;  5ICE A;  2HZT A;  1BW5 A;  1QZY A;  3CCU I;  4R79 A;  5LEK A;  2ESN A;  4UVC A;  4RB3 C;  1Y8R B;  3F21 A;  1FP2 A;  1X4O A;  4GYG A;  2Q8K A;  3ECO A;  2H1K A;  3RYR A;  3HL2 A;  2H27 A;  4M3D A;  2WAD A;  3S2W A;  1X4P A;  5GAG J;  5DUK A;  5J1R A;  4ENJ A;  4G6D A;  1UAA A;  3E1S A;  3F6O A;  5JFR A;  4BXX J;  1T0F A;  4GGG A;  4FAS D;  3CO7 C;  5ERI A;  3LSJ A;  2HXO A;  4E7L A;  4HF2 A;  1D8K A;  5FLV A;  4B47 A;  1FIA A;  1T08 B;  2WAF A;  1WVR A;  2L3D A;  2VT2 A;  1MMS A;  1FZP B;  1J59 A;  4HST A;  1DU0 A;  2W00 A;  4IRH A;  4L18 B;  1ONV A;  2OZU A;  4KT6 A;  2XGX A;  4EM0 B;  2R7R A;  4NC8 A;  5LLQ A;  1FOK A;  1TT0 A;  2QA4 I;  4ESF A;  1UHM A;  5GAD J;  4U88 A;  3DKX A;  5GAH J;  4PDK A;  1VF9 A;  3LSG A;  4DQ2 A;  1SC7 A;  2VON A;  2L02 A;  4B48 A;  1SFU A;  4PGG A;  2Y9Z A;  3U9G A;  1XGN A;  1SFO J;  1HQC A;  3BTL A;  1OCC H;  2CUF A;  4FET A;  1VQ8 I;  3QOP A;  2PJR B;  3M8J A;  2VB6 A;  4XLH A;  2VE9 A;  5AIP A;  1B72 A;  3FXL A;  3ML6 A;  1XMK A;  2QSF X;  3M9A A;  1JT0 A;  4FT8 A;  3I4P A;  1FTZ A;  3EDP A;  2CFO A;  2JA5 J;  1IN4 A;  4KJZ A;  3CCL I;  2CSO A;  4NC7 A;  1BI0 A;  3JAM Z;  4DYQ A;  5FRM A;  1FC3 A;  2Z33 A;  2M5W A;  4G12 A;  3K4M A;  3FXO A;  1WJD A;  4BXF A;  4NQW B;  1UB9 A;  3HSF A;  4BKX A;  4XRS A;  3DXJ F;  2CU7 A;  3BP8 A;  4FX0 A;  2Q1Z B;  3LNQ A;  2DMT A;  4G6Q A;  3OYI A;  3K1P A;  1E17 A;  5J4Y A;  1YHQ I;  2L2O A;  2JWT A;  3AFH A;  1XB4 A;  3HRS A;  4G8X A;  1IXC A;  2KZG A;  4D0P A;  3OL4 A;  2K4J A;  3OV8 A;  4HV5 A;  1VQN I;  4NB5 A;  5L3D A;  5DDG A;  4M9Z A;  5HS8 A;  1D5Y A;  1IG7 A;  4OIO F;  1RET A;  1LKX A;  5JI6 A;  2YR2 A;  3WTT C;  2KQR A;  4XL9 A;  1JKO C;  2KRH A;  4CYC B;  1KON A;  4PSW A;  4EJU A;  1HKQ A;  1KU3 A;  1O3T A;  4KYW A;  2QQB A;  2YU3 A;  3TOB A;  3HEF A;  3AG4 H;  4CCO A;  3FZV A;  1Z91 A;  3WGG A;  5BMZ A;  3KCC A;  3I5U A;  4MEX F;  3HOW J;  3CUQ A;  4QPQ A;  4LG3 A;  3W3C A;  3QRF F;  3W2A A;  3ZGK A;  3QAH A;  2LBF A;  2MD0 A;  1ZHF A;  4LLL A;  3LSI A;  3FMR A;  3QWL A;  2CV1 A;  1K6Y A;  2CQ7 A;  3GZ6 A;  2DT7 B;  1Y39 A;  2VOD A;  5K7H A;  3V8J A;  1U3E M;  1H9T A;  4NUB A;  4ZTJ A;  4ZDL A;  1TZL A;  1R6R A;  5FFZ A;  1R22 A;  2PG4 A;  4HEA 2;  3JRE A;  4A3J J;  2R7T A;  2XGD A;  5ED4 A;  5KNL A;  2COB A;  5H6Q A;  4KN4 X;  5C4X J;  4Y17 A;  3I59 B;  5EYR A;  4BH9 A;  3EUA A;  3V7R A;  1DP7 P;  3E3V A;  4ANJ A;  2FOW A;  3DBR B;  2XAU A;  3Q9S A;  3C2B A;  3GTQ J;  3IRQ A;  2RDP A;  2QEX I;  3KP5 A;  3F22 A;  2RRE A;  4L5E A;  4B3A A;  1EH7 A;  3HPG A;  3ZQG A;  3F6V A;  1BJA A;  4BBR J;  3E6C C;  2EZK A;  3DKW A;  2YX4 A;  2PI0 A;  4NDL A;  2VC0 A;  4A0X A;  3J81 Z;  2RNG A;  1MBE A;  3CMY A;  1R36 A;  2DO7 A;  1HOM A;  4C2M J;  2IXS A;  5DD4 A;  1K78 B;  4BQA A;  1EF4 A;  3B6A A;  2VXZ A;  4YEL A;  1W36 C;  3ZMZ A;  3OR2 C;  1Q1V A;  2Y31 A;  3L2R A;  1IN6 A;  5E1W A;  4E4H A;  4UHT A;  3K70 C;  3OSF A;  1Y8Q B;  5JLW A;  5E3M A;  4WF2 A;  2MYS A;  3HZJ A;  2KDZ A;  2OC6 A;  3LSH A;  3I59 A;  1CQT A;  3NWT A;  2F4I A;  1MBK A;  2BY3 A;  2RGV A;  3A4C A;  5C4J J;  2H1L A;  1AKH B;  1XCB A;  2RVC A;  2EFQ A;  1JHF A;  2DDB A;  1HSJ A;  3HIF A;  2LMD A;  5AON A;  5LHI A;  1RNL A;  1VQM I;  4M3E A;  2A6E F;  5EDN A;  1S5L C;  3V8L A;  3AKZ A;  3LAJ A;  2DT6 A;  3Q9V A;  1ETO A;  4S05 A;  4LIV A;  1BOB A;  1G3S A;  1XC5 A;  1Z3Y A;  4HSR A;  4CCM A;  1UJ8 A;  5ILV A;  1F9N A;  1K78 A;  1LB2 A;  2ZJP F;  3CCM I;  1NG6 A;  1PP7 U;  4M6V A;  1V4R A;  2E1O A;  5DEQ A;  4B1R A;  4LK1 F;  1R1U A;  1YS7 A;  1PUE E;  2M7B A;  2EJR A;  3K2A A;  1QA6 A;  2A6H F;  2DOA A;  2A6T A;  4DZP A;  2X6O A;  3VYR B;  2XRL A;  1VZ0 A;  4PJJ A;  3J7A Y;  3GYH X;  2EA2 A;  3MZY A;  2E5Z A;  3G3Z A;  1GV5 A;  2W48 A;  4HX4 A;  5E3N A;  1W7P B;  4HDV A;  4V2F A;  4P55 A;  2JA7 J;  2XAQ A;  3QPS A;  1N25 A;  2XV4 S;  4U0V A;  1XMA A;  3CME I;  1WH5 A;  1YI2 I;  4FE7 A;  3CLO A;  3LSK A;  1R71 A;  1GXP A;  3I64 A;  2ACJ A;  3I58 A;  1ZRE A;  1PP8 F;  2KJB A;  5D6F A;  4D7M A;  3P7N A;  3VB2 A;  2KRC A;  3WTZ A;  5H20 A;  5E1Z B;  3QPT A;  2P6T A;  4YFX F;  1HF0 A;  1IGN A;  4M3F A;  3VSK A;  5KAF C;  3CQZ J;  1MNM C;  2LK2 A;  3J7Y J;  4XK4 A;  2EFN A;  2ICW G;  3MKZ A;  4UV9 A;  3HSR A;  2ECB A;  1B8I B;  1DGW Y;  2PMZ N;  4E7Z A;  1RUN A;  3M8F A;  1Z05 A;  5FKL A;  2R0Q C;  1STZ A;  2PJP A;  2HQA A;  3CDI A;  4G9Y A;  2HVS A;  1DP3 A;  1L0O C;  1E3H A;  4E7H A;  2IBD A;  2KT0 A;  3DFG A;  3GTK J;  1FSH A;  3CCR I;  4F52 A;  3OYH A;  4A3F J;  3S3M A;  4OIN F;  3M4O J;  3I71 A;  5J3L A;  2OJE D;  5JR3 A;  4A3M J;  2OQR A;  1Z21 A;  3TO6 A;  5FFX A;  2LTP A;  1A5J A;  5GTI C;  4O6J A;  2RN7 A;  1WPK A;  4D7N A;  4V19 K;  2XB0 X;  2RAE A;  5E3L A;  1IXR C;  3TO7 A;  3PM1 A;  2PLY A;  3Q0U A;  1KYW A;  3FBI B;  1D3Y A;  5BPI A;  4GCV A;  2LVS A;  3CC7 I;  2E7X A;  1NHA A;  2CQX A;  4C30 A;  5CVU A;  5DS9 A;  4DOZ A;  2X4H A;  1TP4 A;  3CDL A;  1FBU A;  1D1B A;  3TW7 A;  1I5Z A;  1ZRC A;  2LKP A;  5FD5 A;  3CMA I;  4CZC A;  4MTE A;  3IKV A;  3U2R A;  4GYI A;  3CD6 I;  3R60 A;  3TGN A;  3OIQ A;  1G59 A;  2EV6 A;  4D5C A;  1FYK A;  2MD5 A;  3FK6 A;  4XLP F;  2FSW A;  5E18 F;  4CGZ A;  2V9P A;  1XPX A;  3EUH A;  4HA8 A;  2ETH A;  4A3G J;  2X1E A;  2HGC A;  1KYZ A;  2IGN A;  1P6R A;  3SZG A;  2K40 A;  1JUP A;  2F48 A;  3PSI A;  1KU2 A;  1OCZ H;  4ZYG A;  1LQ1 A;  3U1K A;  4C3I J;  3OS2 A;  1X3Z B;  4PFO A;  1I6X A;  4E70 A;  4XOP A;  1YJN I;  2EFO A;  4MEY F;  1W7P D;  4DGW B;  3D1N I;  1MGT A;  3WOD F;  1UST A;  1QBJ A;  4AYB N;  2E60 A;  2KL4 A;  1G4D A;  4L5I A;  3C18 A;  2JMW A;  3M07 A;  1K4S A;  1G3W A;  4FHT A;  1ZEL A;  4HYE A;  2O8X A;  5BQT A;  3ABT A;  2Y0S N;  5F1R A;  2YPR A;  2R5Y B;  2CQN A;  4IX7 A;  2VKE A;  3CZ6 A;  3WU1 B;  4IQ4 A;  1XD7 A;  4PGH A;  2EIK H;  2ZXJ A;  3BG5 A;  1AWC A;  1EA3 A;  4WX9 A;  4A3I J;  4AVP A;  4WXH A;  1JJ8 C;  1WQ2 A;  3DPL C;  2HOA A;  2X51 A;  1ETX A;  1MDM A;  2QUF A;  1YQA A;  4Z2Y A;  5HOD A;  2DFH A;  2M0M A;  4F92 B;  4BBS J;  1FSE A;  3VOE A;  1LEB A;  2JSC A;  2OBP A;  3FXU A;  2MA3 A;  1IF1 A;  4I76 A;  2JJ7 A;  1HLV A;  2EV0 A;  2R7S A;  3CCJ I;  5D5W B;  4IHY A;  4ZYD A;  1Y1V J;  1FNN A;  3LWF A;  4MLO A;  1AU7 A;  2K9L A;  2R5Y A;  1ZAR A;  4NNJ A;  1ZG5 A;  3AG2 H;  5HS9 A;  4XKB A;  3IHU A;  4HZF A;  3OY9 A;  4I98 B;  1LEA A;  4RB1 A;  5BS6 A;  1LJ9 A;  2WV1 A;  1ZR2 A;  3KZI C;  3L2W A;  3OOU A;  3W6J B;  3BR2 A;  2W1O A;  3ZMT A;  3D5R C;  2VKD A;  2A69 F;  2LC2 A;  2EZI A;  2NAZ A;  1OKR A;  5FKO A;  5HDK A;  2HOT A;  2DA5 A;  1IDY A;  5H6R A;  3E6B A;  1YJ9 I;  2L7Z A;  2KIQ A;  4GRI A;  1R1V A;  5JVT A;  1BBY A;  5HDG A;  4XLC A;  1WKM A;  2GOM A;  4L9J A;  3CF5 F;  1NTC A;  2LG4 A;  2XF6 A;  1R58 A;  4XLA A;  5HLI A;  4MQ9 F;  2VBY A;  3HB9 A;  4XRS G;  4RDU A;  3WTW C;  2MH2 A;  5FKK A;  1TWF J;  2NVQ J;  1R4N B;  5F0C A;  2RNJ A;  2K86 A;  4ON0 A;  4BJ6 C;  1N77 A;  2GXB A;  3GWZ A;  1YIO A;  3HOX J;  2EK5 A;  4MQV A;  1D1C A;  3QPL A;  4N0B A;  3VDX A;  5LEJ A;  3FXJ A;  5D4R A;  3K2Z A;  2VQC A;  2ESH A;  1AHD P;  1R9T J;  1T95 A;  1CF7 A;  4PJ0 C;  3RSN A;  4BE0 A;  3TBI A;  5D4S A;  3H0D A;  1IRZ A;  2L9N A;  3COA C;  2DMU A;  4HW0 A;  5J1Y A;  2CW8 A;  4HG2 A;  2ZCW A;  2M9H A;  3E0J B;  3O8G A;  3R6S A;  4BQO A;  1IJW C;  4X1E A;  4HRI A;  3CLQ A;  4XOR A;  5EGO B;  3HTS B;  1G6N A;  4Q48 A;  1LDD A;  5ILU A;  2DBB A;  4B43 A;  4AC0 A;  3MKW B;  1XX5 A;  4HQM A;  5F08 A;  3S14 J;  1X3W B;  3GBG A;  2KIF A;  2IGK A;  4LB5 A;  2VJ4 A;  5K1Y A;  2D45 A;  2OTJ I;  2WA0 A;  4KIS A;  2XKO A;  1KQ9 A;  2DK8 A;  3MMY B;  3BRO A;  2YSR A;  4KA4 A;  2BVM A;  2ZFW A;  1RR8 C;  2CQK A;  3PQJ A;  2GLO A;  4N9H A;  2EB7 A;  3HOZ J;  2CWE A;  2FEZ A;  3SFZ A;  3RPU D;  1D0X A;  1K61 A;  1X1P A;  2KFD A;  2VIX A;  1HCR A;  2AXL A;  2Y48 A;  1YOV B;  4J00 A;  3A0H C;  4EAT A;  1KZH A;  3A01 B;  1SVO A;  2IEK A;  2F5C A;  4CSW A;  2RQQ A;  2CFX A;  3A2K A;  3C7J A;  3KPH A;  3FXQ A;  1MKM A;  4XRF A;  4EQQ A;  1R5H A;  3ABU A;  2EQR A;  3H0G J;  2VUM J;  2OU2 A;  1RUO A;  3OSG A;  2XHK A;  4XNF A;  1S72 I;  2GA2 A;  2GA1 A;  1REP C;  4RB2 C;  3RKQ A;  2JA8 J;  1FYM A;  3C2G A;  2MFZ A;  1NK2 P;  3RIR A;  1LVA A;  5KAI C;  3J80 K;  2FD5 A;  1NH3 A;  4UNO A;  2ISY A;  2M34 A;  4JX6 A;  2BHZ A;  4IZZ A;  2W85 A;  1A35 A;  4OWR B;  1J09 A;  1YX3 A;  2JPC A;  2W25 A;  2XAS A;  3K0L A;  3OYK A;  5LD2 C;  1SAN A;  2L9S A;  5JVG F;  1LFB A;  1BIA A;  1T2K A;  3LSM A;  5CVI A;  3A01 A;  3HPH A;  4C9Y A;  1MMN A;  1X1C A;  5FLM J;  3KYD B;  4IHS A;  4BJT A;  1S8N A;  4P5O A;  4ZYA A;  3MWM A;  1IO2 A;  3ZMU A;  4XKW A;  4EJO A;  4MFE A;  4D1Q A;  3ZMD A;  1VTN C;  2OF7 A;  3BTC A;  1BN5 A;  2HPM A;  4DYR A;  1ZRF A;  3C2H A;  4EMS A;  1TLH B;  4XOT A;  5B66 C;  1TNT A;  3HC7 A;  1YIT I;  2X48 A;  2P7V B;  5DM6 F;  1UMQ A;  2M7A A;  3E97 A;  1XN7 A;  3DLA A;  2DYR H;  4BHB A;  1WSU A;  4IQJ A;  4I99 C;  2NS0 A;  3LQR A;  2A3S A;  2DAO A;  3H5N A;  4XQF A;  2CUZ A;  2KRF A;  1TWC J;  4XON A;  1TWA J;  1LFP A;  3HOV J;  3HRT A;  2V7F A;  1R5I D;  3ISP A;  3A0B C;  4LMY A;  1XSD A;  3ZQI A;  4ESB A;  2Z9O A;  4PFP A;  2XAF A;  5CJ9 A;  1X1D A;  1VND A;  2EIJ H;  2DPD A;  4UUV A;  3CP2 A;  2UZK A;  3S2D J;  2YUS A;  2K3P A;  4ZTF A;  3OYL A;  5JHF A;  3P9C A;  1TQM A;  1UHS A;  2DQR A;  3HRU A;  1LFU P;  4H0E A;  3QYE A;  9ANT A;  1HW1 A;  3G1M A;  2IGM A;  4G6T B;  3S1Q J;  2A5Y B;  1ZK8 A;  5AIQ A;  3ULQ B;  4IO9 F;  1QGP A;  1HBX G;  4YRV A;  2XAJ A;  2B7E A;  2O9L A;  1B72 B;  3ZCO A;  4ZYH A;  3IV5 A;  1QZE A;  2P5V A;  2LNB A;  3DF8 A;  4EV0 A;  1TQI A;  3KZZ A;  1WGX A;  2XAG A;  1EJ9 A;  3PUB A;  4AU7 A;  1TL8 A;  2DYS H;  3WTV C;  2M2E A;  3JRA A;  2ZJ2 A;  2HOS A;  3Q0W A;  2FMY A;  3FXM A;  3EUK L;  2W57 A;  3ABK H;  3H5R A;  4Z6Y A;  3HOS A;  2IS6 A;  2H94 A;  3KE2 A;  4OMY A;  2HTJ A;  3GUD A;  2E36 A;  3JSO A;  4EGZ A;  1BM9 A;  4CCN A;  2BYV E;  2FJ1 A;  4A3K J;  2J5P A;  4U7B A;  2M45 A;  3HTU A;  3TP0 A;  3H36 A;  1A31 A;  3Q5F A;  3ZQL A;  1Y56 A;  3PNT A;  4JX4 A;  1IRG A;  3WE2 A;  1JUS A;  1OYI A;  3IH4 A;  1T39 A;  3ASN H;  3L2Q A;  4LOC A;  2FA5 A;  5F04 A;  2XDV A;  1YJW I;  3S1M J;  2BEO A;  1LVK A;  3EYI A;  2CMP A;  2HQN A;  1O4X A;  1BR1 A;  3SXY A;  4X0G A;  1FX7 A;  1S6L A;  4A5M A;  1USS A;  3A1Y A;  1QHH D;  2DFE A;  2IVM A;  3LSR A;  1WJ5 A;  3QOE A;  2HPI A;  5JLX A;  2O03 A;  2Q2E A;  2HWV A;  4CHU A;  5TIS C;  4PJL A;  3CUQ B;  1G3Y A;  2JUC A;  1T38 A;  5FLX K;  5IYB J;  1G8X A;  2JA2 A;  3FKI J;  2LBF B;  2KHM A;  2JSP A;  5HDN A;  5ILS A;  3J80 Z;  3AG1 H;  4II3 A;  1GVD A;  1B1B A;  4GFB A;  2HFH A;  3HOT A;  4KIG A;  1KGS A;  3BR5 A;  4WXC A;  4BE1 A;  1I50 J;  3JRD A;  2OQG A;  2IA1 A;  3TDU C;  2BXZ A;  3HXL A;  2DTR A;  2HDC A;  1ULY A;  2DLL A;  4PJM A;  2HYF A;  1R23 A;  1B9M A;  2V1U A;  3S2H J;  5KVR A;  3PO3 J;  1VFC A;  1OFC X;  1H89 C;  1MBH A;  4QLC U;  2XGC A;  2QKM B;  3RDI A;  1V55 H;  4XID A;  2HNH A;  2Z16 A;  1GUU A;  3GTO J;  2NOG A;  2AQE A;  1V5F A;  2EZH A;  4YIF A;  3F23 A;  1MND A;  2ZNY A;  3X2Q H;  1ETY A;  2BE5 F;  4AD9 A;  1LE8 B;  2K4B A;  2W4S A;  4RAY A;  3PSF A;  1TTY A;  1ZAO A;  3WU2 C;  4ENM A;  2UWM A;  5E17 F;  1R1T A;  3HOY J;  1K7A A;  1JXS A;  3DPU A;  4KIT B;  3D5L A;  4M9S A;  3M1E A;  4M73 A;  1XSX A;  3ESW B;  4L9T A;  2DJN A;  3RJP A;  2LF7 A;  1ZGA A;  5D5U B;  5A2Q K;  1JJ6 C;  5HNH A;  1SD6 A;  4GXO A;  1TW2 A;  5LBQ A;  2HU9 A;  3LA3 A;  3SZP A;  3WHB A;  5HOO A;  5GAE J;  1JKQ C;  4FTH A;  4I01 A;  1P2F A;  1HKT A;  1XDS A;  3I3L A;  2P4W A;  4D5F A;  3GFI A;  4UXN A;  2QBY A;  1FLI A;  4DYC A;  3CUO A;  3TW6 A;  3NAU A;  1TQP A;  4IHW A;  2GOX B;  2AHQ A;  5IT9 K;  1WJC A;  3DWL E;  5CYV A;  4AM3 A;  1LE8 A;  4B09 A;  2JVG A;  4Q5S F;  4B4C A;  4M3G A;  4QIW N;  3O3K A;  3O2P E;  4S0H B;  2BW3 A;  2WBM A;  1RES A;  3CJQ B;  4RLF A;  4LJZ F;  3VYT B;  1X58 A;  4BDZ A;  2W84 A;  3IKT A;  1ZGJ A;  4II2 A;  1UG2 A;  3T1B A;  1ENH A;  1OCP A;  2F6C A;  3LST A;  1WWX A;  3U21 A;  4BE2 A;  3TOA A;  1JT6 A;  3F0C A;  5J8C A;  1HA8 A;  2CH0 A;  2OCC H;  4OU0 A;  2UXX A;  5IP7 J;  3HBL A;  1OQY A;  1HDD C;  3ZP5 A;  3EUH C;  2XB5 A;  3SDG A;  4AIK A;  2CYY A;  5HS7 A;  3ROU A;  4AVZ A;  4A6E A;  2DU9 A;  2O5R A;  3OYF A;  2GZW A;  2GXA A;  3GZ5 A;  4LLG F;  3FXR A;  2VBW A;  2DOE A;  1MD0 A;  1VQK I;  3IWZ A;  3NAR A;  1U8B A;  4CZZ A;  3HKZ N;  2LKX A;  4Q47 A;  2XF7 A;  2CV2 A;  3P9K A;  2WB1 A;  4A12 A;  1OCO H;  3K4N A;  3RPQ A;  3BG7 A;  3BC8 A;  3HHG A;  3SYT A;  3L2V A;  4IHT A;  1I1S A;  5LFA A;  2Y30 A;  5B1A H;  2FNP A;  4EM1 A;  2I5U A;  2ZXW H;  3G1L A;  5LHH A;  1VQO I;  4CA0 A;  3GVA A;  4A2U A;  2IS1 A;  2DJI A;  5GPA A;  1P4A A;  2JPB A;  1DU6 A;  2ZXI A;  4A3D J;  2KIU A;  1WJF A;  1O57 A;  4EM2 A;  1MJ9 A;  1YE9 A;  1IW7 F;  4B3X A;  4IHV A;  1E2X A;  1OR7 C;  3KYL A;  4AUX A;  4C2T A;  5FO5 A;  2HDD A;  1SFK A;  2QKL B;  5D8L B;  2DN0 A;  5FLX Z;  5FRN A;  2BV6 A;  2PFB A;  3K4C A;  5L3G A;  2E34 A;  2VAS A;  1QPI A;  1YG2 A;  3BR1 A;  2P0W A;  1OYY A;  5E3O A;  3PFI A;  1GDT A;  4I0B A;  4I09 A;  1X2N A;  3VWB A;  1P92 A;  1B6A A;  4IXA A;  5BOX A;  4KT5 C;  2R7Q A;  1ZQ3 P;  2FE3 A;  4OMZ A;  2R3S A;  1T33 A;  3BTI A;  1POG A;  2GBY A;  3MZ8 A;  4XRM A;  1FOY A;  2FF4 A;  1MZB A;  4HX8 A;  2LDU A;  3G2B A;  4A5N A;  2R4G A;  4RGR A;  1OCT C;  2ZME C;  3HJE A;  3FXK A;  3CC2 I;  2PBI A;  4LIU A;  2F5V A;  4MNU A;  4PJN A;  3DTI A;  4F55 A;  5J47 A;  3OR1 C;  2DOF A;  2E71 A;  4C3H J;  2ELH A;  4V2G A;  2V1D A;  1AA7 A;  3MFK A;  3F8N A;  4UUT A;  2LKS A;  2VQL A;  2NVT J;  2D1V A;  3BCA A;  2NOJ B;  5KHD A;  1C0W A;  2HI3 A;  3KYC B;  2JVH A;  3NWS A;  3OYG A;  4BJ5 C;  2KIS A;  1W5S A;  1BR4 A;  3KZY A;  3AG3 H;  2MSY A;  3H35 A;  4RB0 A;  1MH4 A;  1EH6 A;  2VQH A;  3GFM A;  4EJV A;  1FJL A;  3KP3 A;  3I0T A;  2H6C A;  2VLA A;  3OYC A;  1MNE A;  3BPV A;  4FIS A;  1YLF A;  3F8F A;  1A6I A;  4BDY A;  1T56 A;  2DTZ A;  3N05 A;  2QWW A;  2M3A A;  4YII A;  2VT3 A;  3HSE A;  1YW7 A;  1ZN2 A;  3RCO A;  2YX7 A;  1MBJ A;  2DDA A;  4C3J J;  2IGO A;  2CV0 A;  4XN0 A;  2VL8 A;  4CUG A;  4CXF A;  5A2Q Z;  4NHJ A;  5IYC J;  2FRH A;  5DM7 F;  2G0E A;  2LH9 A;  1D8J A;  1P7I A;  2R7V A;  4ETS A;  3I54 A;  2R5Z A;  2R7U A;  5E79 C;  1R7J A;  3PL8 A;  3L00 A;  3G1O A;  2V9K A;  1U5T C;  2W7N A;  2V9V A;  3JTG A;  1MJB A;  2E1C A;  3WTX C;  2CJJ A;  3CCS I;  4KDP A;  5IT9 Z;  1Y1W J;  3K9T A;  2XAH A;  2EIL H;  3S16 J;  1N75 A;  4P9U A;  4BGD A;  2R7D A;  5HLT A;  4J19 A;  3KP4 A;  3PQK A;  2K7L A;  3S93 A;  2A07 F;  1GT0 C;  1SD7 A;  3ECH A;  3KEO A;  3G73 A;  5EG0 B;  1IN8 A;  1MDM B;  4BQQ A;  1A36 A;  2K02 A;  3PNV A;  1MSF C;  2KKO A;  2HDW A;  3F3X A;  1KA8 A;  2DT5 A;  1YTY A;  2DK5 A;  1QNT A;  4PK4 A;  5L3C A;  1YW9 A;  4J01 A;  3CCV I;  1JKP C;  3L9F A;  4LIT A;  2DOD A;  2BOL A;  2VJI A;  3HGG A;  2KMU A;  1MW7 A;  4LFU A;  3G4S I;  3KP2 A;  1YFH A;  3DV8 A;  3OYB A;  1BA5 A;  2LFB A;  4Y4R A;  2AO9 A;  2UUZ A;  3LSP A;  3NEU A;  2RKH A;  3KX2 A;  1X3U A;  4QPO A;  3FHZ A;  5FB2 A;  2CQQ A;  1UFM A;  4KMU X;  3L2U A;  4A69 C;  3LMM A;  1OR7 A;  3H9Q A;  2O7O A;  3TED A;  3GXO A;  3JRF A;  3ZRG A;  3ASO H;  2DQL A;  5EG0 A;  3JTH A;  1OMI A;  1SEU A;  1VQ5 I;  2HZD A;  1Z9C A;  2FQ3 A;  1W36 D;  1VQ7 I;  1ZYR F;  1ETQ A;  2YU9 J;  2LY9 A;  1ZRD A;  2LY2 A;  3CF2 A;  3K70 D;  3C3W A;  4XLF A;  2F2E A;  5K5O A;  1I6H J;  1X2M A;  4HNU A;  3K6G A;  1R4M B;  3S8P A;  2ADU A;  2Y2Z A;  4Q4Z F;  2N8G A;  3FHN A;  2ZME A;  2X0L A;  4N4O B;  3WG9 A;  5FRO A;  1FP1 D;  2FX0 A;  3A03 A;  1OYW A;  5K7F A;  1Z77 A;  4CIC A;  1M1E B;  1QZZ A;  4PCQ A;  2QYO A;  2OD5 A;  1QRY A;  3HKZ A;  2QEN A;  3WTU C;  1U5T B;  3GFL A;  2LF8 A;  1LUJ B;  4ENK A;  1ZTR A;  3R4K A;  3PFY A;  1CF7 B;  4G7O F;  4HF1 A;  4CCJ A;  2WAQ A;  2V1X A;  2JT1 A;  1N78 A;  2DW4 A;  3SQN A;  4O5V A;  1W4M A;  2HKO A;  2X1D A;  4A6D A;  3DBL B;  3KET A;  5BPD A;  1RZ4 A;  2KPM A;  4WWC A;  5K5R A;  2H09 A;  3GFJ A;  3U1D A;  4FQG A;  1BW6 A;  2XIG A;  3HUG A;  2IS2 A;  3W6V A;  4I0A A; 
#chains in the Genus database with same CATH homology
 1B59 A;  2P8T A;  4M72 A;  2ZBK A;  1U5T A;  4O3M A;  4F7Z A;  1BOA A;  2O3F A;  3SZT A;  4PZJ A;  2WWY A;  3K1N A;  2L4M A;  2GXG A;  1TNS A;  1GHC A;  3WGI A;  1BI2 A;  1K79 A;  3MAJ A;  4RGS A;  4L9N A;  2D1H A;  4M9X A;  2EFP A;  3OOP A;  5DD8 A;  4HLX A;  3E5U A;  3RTR A;  3ZMV A;  3EET A;  2GWR A;  1SMY F;  3AAF A;  3BPX A;  4L5J A;  2R7F A;  3ZN0 A;  5CLS A;  3R61 A;  3VOD A;  3T5X A;  4ZZL A;  2NNN A;  2WTE A;  3B73 A;  2PEX A;  1J75 A;  3M8E A;  3ZN1 A;  1DPU A;  2BBY A;  5LHG A;  5LGT A;  3V4G A;  3T8R A;  3VFZ A;  3WGH A;  1YO5 C;  2COM A;  1I27 A;  2XKP A;  3RKX A;  5CVV A;  1RIO H;  5L3E A;  2KJC A;  2GQQ A;  4ZH4 F;  2RC4 A;  1EV7 A;  3ZQ7 A;  3HRM A;  2MLK A;  2STW A;  1XSV A;  2VOO A;  2HR3 A;  3BJA A;  3KLN A;  3LQQ A;  2DI3 A;  1DUX C;  3B02 A;  4EJW A;  4EJT A;  3RKY A;  3QP5 A;  4LD5 A;  1FT9 A;  1FWZ A;  2VN2 A;  1QO0 D;  2E1N A;  6PAX A;  2EA4 A;  2V6C A;  3IL2 A;  1O3S A;  4ASN A;  3T8T A;  2VE8 A;  2CGP A;  4HAM A;  4CYD A;  4CO8 A;  1ZG1 A;  3FF5 A;  4I02 A;  5DCF A;  3LA2 A;  3R0J A;  3NQO A;  3N4M A;  5DCM A;  4HDU A;  4YFN F;  1O7L A;  3D0S A;  2ZKZ A;  1F1Z A;  3GF2 A;  1F5T A;  1K6O A;  3ELK A;  3J81 K;  1S3J A;  3L2C A;  1J9I A;  4WXD A;  3ERE D;  1KU9 A;  4MGR A;  5DYM A;  3C1D A;  4JBA A;  2NRA C;  4BHC A;  3K69 A;  2FBK A;  5F6F A;  1IXS B;  4HQE A;  4HLY A;  2P7C B;  1XDU A;  4HX7 A;  4L0Y B;  2VOP A;  1YYV A;  4M71 A;  1S7A A;  2G9W A;  3E5X A;  3V7C A;  2QM3 A;  2CO5 A;  5E1X A;  5ICF A;  4BAY A;  2XRN A;  1U6G A;  1IN7 A;  2D2W A;  3O6B B;  3IRR A;  3DPT A;  2UXN A;  1A04 A;  2IA0 A;  2XUB A;  3BY6 A;  4IVN A;  3SHF A;  5KK1 A;  3L7W A;  4KFC A;  4DNC A;  5FD6 A;  1BC8 C;  2IP2 A;  1Y0U A;  5DV5 A;  1TBX A;  2DPU A;  4OIP F;  5LRR A;  1G3T A;  1SFX A;  2MLG A;  4N9I A;  1XCV A;  5J6X A;  2Z3Y A;  2F5D A;  1HST A;  1L3L A;  2P5L C;  3JW4 A;  5D6E A;  1MJA A;  1IAW A;  2QBY B;  4G7Z F;  3WTS C;  3F8B A;  3KFW X;  4IF4 A;  4M74 A;  1J0R A;  3GEZ A;  1D5V A;  1ZLK A;  3NRV A;  3TDZ C;  1H0M A;  1JHH A;  4Y13 A;  3N97 A;  1JGS A;  2NYX A;  3ZMS A;  2P5K A;  1KQ8 A;  4G94 A;  4NQW A;  2RV8 A;  1WI9 A;  5E8I A;  1XGM A;  4OOI A;  4KUM A;  1QQI A;  2ISZ A;  2Z99 A;  3WTY C;  3GLX A;  4U0W A;  2L01 A;  4U7D A;  5LGU A;  3F72 A;  4EGY A;  5HVQ C;  1SAX A;  3QPH A;  2HS5 A;  3W6K B;  4ENN A;  3KP6 A;  1T98 A;  2IRF G;  2RQP A;  5LRS A;  1LDJ A;  2XRO A;  4ZYE A;  3FWE A;  3BOQ A;  2QVO A;  2IJL A;  5TRD A;  4ESJ A;  3FX3 A;  5ICG A;  1I1G A;  2M87 A;  3MCZ A;  1GVJ A;  4JQF A;  1Q1H A;  4AIJ A;  1ZLJ A;  3REO A;  2Q0O A;  2M1B A;  2IPQ X;  3RKW A;  1B4A A;  2QLZ A;  1HW5 A;  5D8K B;  5D5V B;  1FYL A;  4BNC A;  4WK8 F;  2L54 A;  4IRI A;  2PN6 A;  2C6Y A;  1Z6R A;  1P4X A;  4RGX A;  1Z6T A;  1SFE A;  1TW3 A;  4OIQ F;  4KN7 X;  3H3Z A;  1U2W A;  2O61 A;  2FNA A;  3H92 A;  4AWX B;  4AIH A;  2AS5 F;  2OA4 A;  5TJJ A;  4KIF A;  3TKY A;  4LGW A;  3QU6 A;  3QP6 A;  4IRG A;  1FY7 A;  1O7F A;  2HYG D;  3BZ6 A;  2OZ6 A;  2HQR A;  2OAZ A;  3LFK A;  4WCG A;  4OIR F;  4P96 A;  1FPQ A;  2HOE A;  1PDN C;  2M30 A;  2W24 A;  3BJO A;  2XVC A;  4LK0 F;  2VC1 A;  1W7P A;  1U78 A;  4HV6 A;  3RI4 A;  3T0Y A;  4L0Z B;  2QZ8 A;  5F64 A;  4L9V A;  1J2X A;  5E20 A;  1T6S A;  1R00 A;  4MHG A;  4UVB A;  4KIB A;  4YG2 F;  3FMS A;  1Z7U A;  4FX4 A;  4M6X A;  5DUI A;  3JSP A;  3HHH A;  1J7K A;  1AOY A;  4GO1 A;  1BI3 A;  4HF0 A;  2Y75 A;  4IPA A;  1IRF A;  1GXQ A;  3F8M A;  2F5F A;  4LLN A;  3HYI A;  2CG4 A;  2O0Y A;  2FOK A;  1UHW A;  1DPR A;  1ON2 A;  4UVA A;  4I7H A;  2FXA A;  3CDH A;  3TQN A;  2WV0 A;  3K1M A;  2ZME B;  5J8F A;  4G7H F;  1EH8 A;  4XBF A;  1ON1 A;  1O3R A;  3LAP A;  3R0A A;  1LDK B;  1HW2 A;  3WU0 A;  2STT A;  3M7G A;  1LNW A;  3KEQ A;  1H9G A;  1JE8 A;  5HLH A;  2GAU A;  1R5G A;  2M8E A;  4R8H A;  4YFK F;  5D5X B;  2GIV A;  3CTA A;  3I53 A;  1S7O A;  3TO9 A;  1O3Q A;  1W5T A;  3VEP A;  1P4W A;  4RS8 A;  3GO5 A;  2G7U A;  2HTS A;  2P6S A;  3MEX A;  3J7A O;  4S04 A;  1WRJ A;  3QU3 A;  1IUY A;  3GX4 X;  2PMH A;  4LG0 B;  3EQL F;  4K2E A;  1BIB A;  2WC2 A;  2ZNZ A;  1ODD A;  2K27 A;  3LA7 A;  2LSO A;  1Z1D A;  1FBQ A;  3E6D A;  4XLN F;  3RPU A;  2V79 A;  1DDN A;  2HKX A;  1S29 A;  2KIM A;  2FBI A;  2CW0 F;  4R1H A;  1BI1 A;  4TV7 A;  2EV5 A;  4CDG A;  2J5O A;  2VBX A;  4U0Y A;  5L3F A;  3E6M A;  1IN5 A;  4M6Y A;  3BWG A;  5IT3 A;  3RYP A;  1ZH5 A;  5ICC A;  5EEH A;  1HXD A;  1SMT A;  2FBH A;  3MQ0 A;  3FMQ A;  3BDD A;  1OPC A;  3P9I A;  4LG0 A;  3DEU A;  2Z5U A;  3MZH A;  1KQ0 A;  2JZY A;  2MH9 A;  3CJN A;  4KIC A;  3EYY A;  4XSZ F;  1BC7 C;  1J5Y A;  4RAZ A;  1KU7 A;  2JTV A;  3L09 A;  2NNY A;  4I2O A;  1B9N A;  1YS6 A;  4XSX F;  4LB6 B;  4HBL A;  5HLG A;  2VBZ A;  1ZG3 A;  2PQ8 A;  3GW2 A;  4MTD A;  2BGC A;  2H6B A;  1FBS A;  5JHU A;  5K5Q A;  5FGM A;  3CO6 C;  4IJA A;  1SD5 A;  2A61 A;  4KMF A;  4B8X A;  2B0L A;  2G7H A;  4KNY A;  1XGO A;  5CVR A;  5CVJ A;  2F5E A;  3JAM K;  1YW8 A;  2EWN A;  1V3F A;  3DP7 A;  3KP7 A;  2HEO A;  4ZZD A;  2IT0 A;  3KLO A;  2FML A;  1QPM A;  3V7S A;  2FU4 A;  3DQV C;  2TDX A;  4UV8 A;  2IA2 A;  4A0Z A;  1IZ1 A;  3ZPL A;  1F4K A;  5DCM B;  4A0Y A;  1XGS A;  2E7W A;  3IWF A;  4EVI A;  2A68 F;  2QQ9 A;  1U8R A;  3BJ6 A;  1SD4 A;  4RGU A;  2ZO4 A;  2QQA A;  3V8K A;  1HKS A;  4BXU A;  3F8C A;  5L3B A;  3IC7 A;  2O6G E;  1RI7 A;  3WE3 A;  4BYY A;  2IW5 A;  3FM5 A;  5E8G A;  2MC3 A;  2L4A A;  2PMU A;  4BHP A;  2DFI A;  5LGN A;  2MBF A;  3CUQ C;  2JRT A;  3E5Q A;  1UCR A;  3H3U A;  5EEG A;  2Y0M A;  4JK1 X;  4P9F A;  1CGP A;  4HOB A;  2EFW A;  3FM3 A;  5ICE A;  4QWQ A;  4Y15 A;  2HZT A;  1QZY A;  4R79 A;  5LEK A;  2ESN A;  4UVC A;  4RB3 C;  3F21 A;  1FP2 A;  4GYG A;  2Q8K A;  3ECO A;  3RYR A;  2H27 A;  3S2W A;  5DUK A;  4ENJ A;  4G6D A;  3F6O A;  5JFR A;  1T0F A;  4GGG A;  3CO7 C;  5ERI A;  4HF2 A;  1D8K A;  2L3D A;  2VT2 A;  1FZP B;  1J59 A;  4L18 B;  4IRH A;  1ONV A;  2OZU A;  4EM0 B;  2XGX A;  5LLQ A;  1FOK A;  4ESF A;  1UHM A;  4U88 A;  4PDK A;  4DQ2 A;  2VON A;  2L02 A;  1SFU A;  4PGG A;  3U9G A;  1XGN A;  1HQC A;  3QOP A;  2VE9 A;  5AIP A;  3ML6 A;  1XMK A;  3M9A A;  4FT8 A;  3I4P A;  3EDP A;  1IN4 A;  2CSO A;  1BI0 A;  3JAM Z;  1FC3 A;  2Z33 A;  2M5W A;  1UB9 A;  3HSF A;  3DXJ F;  3BP8 A;  4FX0 A;  4G6Q A;  3K1P A;  1E17 A;  1XB4 A;  3HRS A;  4G8X A;  1IXC A;  4D0P A;  2K4J A;  3OV8 A;  4HV5 A;  4NB5 A;  5HS8 A;  5DDG A;  5L3D A;  4M9Z A;  4OIO F;  5JI6 A;  2YR2 A;  3WTT C;  4EJU A;  1HKQ A;  1KU3 A;  1O3T A;  4KYW A;  2QQB A;  2YU3 A;  3TOB A;  3FZV A;  1Z91 A;  3WGG A;  5BMZ A;  3KCC A;  3I5U A;  4MEX F;  3CUQ A;  3QRF F;  3QAH A;  1ZHF A;  4LLL A;  3FMR A;  3GZ6 A;  2VOD A;  3V8J A;  1U3E M;  1H9T A;  5FFZ A;  1R22 A;  2PG4 A;  5ED4 A;  5H6Q A;  4KN4 X;  4Y17 A;  3I59 B;  4BH9 A;  1DP7 P;  3V7R A;  3E3V A;  3Q9S A;  3IRQ A;  2RDP A;  3KP5 A;  3F22 A;  1EH7 A;  3F6V A;  1BJA A;  3E6C C;  3DKW A;  2YX4 A;  2PI0 A;  2VC0 A;  4A0X A;  3J81 Z;  1R36 A;  2DO7 A;  5DD4 A;  1K78 B;  4BQA A;  2VXZ A;  3ZMZ A;  1IN6 A;  5E1W A;  4UHT A;  4WF2 A;  3I59 A;  2RGV A;  1XCB A;  2RVC A;  2EFQ A;  1JHF A;  1HSJ A;  3HIF A;  5AON A;  5LHI A;  1RNL A;  2A6E F;  3V8L A;  3LAJ A;  3Q9V A;  4S05 A;  1G3S A;  5ILV A;  1F9N A;  1K78 A;  1LB2 A;  1PP7 U;  1V4R A;  5DEQ A;  4LK1 F;  1R1U A;  1YS7 A;  1PUE E;  2EJR A;  2A6H F;  3GYH X;  2EA2 A;  3MZY A;  3G3Z A;  4HX4 A;  1W7P B;  4HDV A;  4P55 A;  2XAQ A;  2XV4 S;  4U0V A;  1XMA A;  3CLO A;  1GXP A;  3I64 A;  2ACJ A;  3I58 A;  1ZRE A;  1PP8 F;  2KJB A;  5D6F A;  3P7N A;  3VB2 A;  3WTZ A;  5H20 A;  5E1Z B;  3QPT A;  2P6T A;  4YFX F;  2EFN A;  4UV9 A;  3HSR A;  1RUN A;  3M8F A;  1Z05 A;  1STZ A;  2PJP A;  4G9Y A;  1L0O C;  1FSH A;  3DFG A;  4OIN F;  3I71 A;  5JR3 A;  2OQR A;  3TO6 A;  5FFX A;  4O6J A;  2RN7 A;  1IXR C;  3TO7 A;  2PLY A;  1KYW A;  1D3Y A;  5BPI A;  4GCV A;  2E7X A;  1NHA A;  5CVU A;  2X4H A;  1FBU A;  1I5Z A;  1ZRC A;  2LKP A;  5FD5 A;  4MTE A;  3IKV A;  3U2R A;  4GYI A;  3R60 A;  3TGN A;  2EV6 A;  1FYK A;  2MD5 A;  4XLP F;  2FSW A;  5E18 F;  4CGZ A;  3EUH A;  4HA8 A;  2ETH A;  2HGC A;  1KYZ A;  1P6R A;  1KU2 A;  4ZYG A;  1LQ1 A;  1I6X A;  4E70 A;  2EFO A;  4MEY F;  1W7P D;  1MGT A;  3WOD F;  1UST A;  1QBJ A;  1G4D A;  4L5I A;  3C18 A;  1G3W A;  4FHT A;  4HYE A;  2O8X A;  5BQT A;  3ABT A;  5F1R A;  2YPR A;  3WU1 B;  1XD7 A;  4PGH A;  2ZXJ A;  1AWC A;  4WX9 A;  4AVP A;  4WXH A;  1WQ2 A;  3DPL C;  1MDM A;  2QUF A;  1YQA A;  4Z2Y A;  1FSE A;  3VOE A;  1LEB A;  2JSC A;  2OBP A;  3FXU A;  2MA3 A;  1IF1 A;  2EV0 A;  5D5W B;  4ZYD A;  1FNN A;  3LWF A;  1ZAR A;  1ZG5 A;  5HS9 A;  3IHU A;  4HZF A;  4I98 B;  1LEA A;  4RB1 A;  5BS6 A;  1LJ9 A;  3W6J B;  3ZMT A;  2A69 F;  2NAZ A;  1OKR A;  5HDK A;  5H6R A;  3E6B A;  1R1V A;  5JVT A;  1BBY A;  5HDG A;  1WKM A;  4L9J A;  1R58 A;  5HLI A;  4MQ9 F;  2VBY A;  3WTW C;  2MH2 A;  2RNJ A;  2K86 A;  4ON0 A;  2GXB A;  3GWZ A;  1YIO A;  2EK5 A;  4MQV A;  4N0B A;  5LEJ A;  5D4R A;  3K2Z A;  2ESH A;  1CF7 A;  5D4S A;  3COA C;  4HW0 A;  3R6S A;  2ZCW A;  3HTS B;  1G6N A;  4Q48 A;  1LDD A;  5ILU A;  2DBB A;  4HQM A;  2KIF A;  4LB5 A;  5K1Y A;  2D45 A;  2XKO A;  1KQ9 A;  2DK8 A;  3BRO A;  2YSR A;  4KA4 A;  2ZFW A;  2CQK A;  3PQJ A;  4N9H A;  2EB7 A;  2CWE A;  2FEZ A;  3SFZ A;  2AXL A;  2Y48 A;  2F5C A;  2CFX A;  3C7J A;  3FXQ A;  1MKM A;  4XRF A;  4EQQ A;  1R5H A;  3ABU A;  2OU2 A;  1RUO A;  2XHK A;  2GA2 A;  2GA1 A;  1REP C;  4RB2 C;  1FYM A;  3RIR A;  1LVA A;  3J80 K;  4UNO A;  2ISY A;  2W85 A;  2JPC A;  2W25 A;  2XAS A;  3K0L A;  1BIA A;  1T2K A;  5CVI A;  4IHS A;  1S8N A;  4P5O A;  3MWM A;  3ZMU A;  4EJO A;  3ZMD A;  1VTN C;  1BN5 A;  1ZRF A;  4EMS A;  1TLH B;  1TNT A;  2P7V B;  3E97 A;  1XN7 A;  1WSU A;  4BHB A;  2NS0 A;  3LQR A;  2A3S A;  2DAO A;  2KRF A;  3HRT A;  3ISP A;  4LMY A;  1XSD A;  4ESB A;  2Z9O A;  2XAF A;  5CJ9 A;  2DPD A;  4UUV A;  2UZK A;  3P9C A;  1TQM A;  2DQR A;  3HRU A;  4H0E A;  1HW1 A;  2A5Y B;  5AIQ A;  3ULQ B;  1QGP A;  1HBX G;  2XAJ A;  4ZYH A;  2P5V A;  2LNB A;  3DF8 A;  4EV0 A;  1TQI A;  3KZZ A;  2XAG A;  3WTV C;  2ZJ2 A;  2FMY A;  2W57 A;  3HOS A;  2H94 A;  3KE2 A;  4OMY A;  2HTJ A;  3GUD A;  3JSO A;  4EGZ A;  1BM9 A;  2BYV E;  2J5P A;  4U7B A;  2M45 A;  3HTU A;  3Q5F A;  1IRG A;  3WE2 A;  1OYI A;  1T39 A;  2FA5 A;  2BEO A;  3EYI A;  2HQN A;  3SXY A;  1FX7 A;  1S6L A;  4A5M A;  1USS A;  2IVM A;  2O03 A;  2Q2E A;  2HWV A;  4CHU A;  3CUQ B;  1G3Y A;  5FLX K;  1T38 A;  5HDN A;  5ILS A;  3J80 Z;  1B1B A;  2HFH A;  3HOT A;  4KIG A;  1KGS A;  4WXC A;  2OQG A;  2IA1 A;  3TDU C;  2DTR A;  2HDC A;  1ULY A;  2DLL A;  2HYF A;  1R23 A;  1B9M A;  2V1U A;  5KVR A;  4QLC U;  3RDI A;  4YIF A;  3F23 A;  2ZNY A;  2BE5 F;  4AD9 A;  2K4B A;  4RAY A;  1TTY A;  1ZAO A;  4ENM A;  2UWM A;  5E17 F;  1R1T A;  1K7A A;  1JXS A;  3D5L A;  4M9S A;  3M1E A;  4M73 A;  1XSX A;  4L9T A;  3RJP A;  2LF7 A;  1ZGA A;  5D5U B;  5A2Q K;  1SD6 A;  4GXO A;  1TW2 A;  5LBQ A;  3LA3 A;  3SZP A;  5HOO A;  4I01 A;  1P2F A;  1HKT A;  1XDS A;  2P4W A;  3GFI A;  4UXN A;  2QBY A;  1FLI A;  3CUO A;  1TQP A;  5IT9 K;  5CYV A;  4B09 A;  4Q5S F;  3O3K A;  3O2P E;  4LJZ F;  2W84 A;  3IKT A;  1ZGJ A;  3T1B A;  3LST A;  1WWX A;  3TOA A;  5J8C A;  4OU0 A;  2UXX A;  3ZP5 A;  4AIK A;  2CYY A;  5HS7 A;  3ROU A;  4A6E A;  2DU9 A;  2GZW A;  3GZ5 A;  4LLG F;  3FXR A;  2VBW A;  1MD0 A;  3IWZ A;  4CZZ A;  4Q47 A;  3P9K A;  4A12 A;  3RPQ A;  1I1S A;  3HHG A;  4IHT A;  2FNP A;  4EM1 A;  5LHH A;  3GVA A;  4A2U A;  1P4A A;  2JPB A;  2KIU A;  1O57 A;  4EM2 A;  1MJ9 A;  1IW7 F;  1E2X A;  5FO5 A;  5D8L B;  5FLX Z;  2BV6 A;  2PFB A;  5L3G A;  1YG2 A;  1OYY A;  3PFI A;  4I0B A;  4I09 A;  1P92 A;  1B6A A;  4IXA A;  5BOX A;  4KT5 C;  2FE3 A;  4OMZ A;  2R3S A;  2FF4 A;  1MZB A;  4HX8 A;  2LDU A;  4A5N A;  4RGR A;  2PBI A;  4MNU A;  2ELH A;  2V1D A;  3MFK A;  3F8N A;  2D1V A;  1C0W A;  1W5S A;  3KZY A;  4RB0 A;  1EH6 A;  3GFM A;  4EJV A;  3KP3 A;  3I0T A;  2H6C A;  3BPV A;  1YLF A;  3F8F A;  4YII A;  2QWW A;  2VT3 A;  3HSE A;  1YW7 A;  1ZN2 A;  2YX7 A;  4CXF A;  5A2Q Z;  4NHJ A;  2FRH A;  1D8J A;  4ETS A;  3I54 A;  1R7J A;  3L00 A;  1U5T C;  2V9V A;  3JTG A;  1MJB A;  2E1C A;  3WTX C;  4KDP A;  5IT9 Z;  3K9T A;  2XAH A;  4P9U A;  2R7D A;  3KP4 A;  3PQK A;  2K7L A;  2A07 F;  1SD7 A;  3ECH A;  3KEO A;  3G73 A;  1IN8 A;  1MDM B;  2K02 A;  2KKO A;  3F3X A;  1KA8 A;  2DT5 A;  1YTY A;  2DK5 A;  1QNT A;  5L3C A;  1YW9 A;  3L9F A;  4LFU A;  3KP2 A;  1YFH A;  3DV8 A;  3NEU A;  2RKH A;  1X3U A;  3FHZ A;  5FB2 A;  1UFM A;  4KMU X;  1OR7 A;  3GXO A;  2DQL A;  3JTH A;  1OMI A;  1Z9C A;  2FQ3 A;  1ZYR F;  1ZRD A;  3C3W A;  2F2E A;  5K5O A;  2ADU A;  4Q4Z F;  2ZME A;  2X0L A;  3WG9 A;  1FP1 D;  1OYW A;  4CIC A;  1QZZ A;  4PCQ A;  2QYO A;  2OD5 A;  2QEN A;  3WTU C;  1U5T B;  3GFL A;  2LF8 A;  4ENK A;  3R4K A;  1CF7 B;  4G7O F;  4HF1 A;  2V1X A;  2JT1 A;  2DW4 A;  3SQN A;  4O5V A;  1W4M A;  2HKO A;  4A6D A;  3KET A;  5BPD A;  1RZ4 A;  4WWC A;  5K5R A;  2H09 A;  3GFJ A;  3U1D A;  2XIG A;  3HUG A;  4I0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...