1BCPB

Binary complex of pertussis toxin and atp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
197
structure length
197
Chain Sequence
PGIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the pertussis toxin-ATP complex: a molecular sensor.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN
total genus 42
structure length 197
sequence length 197
chains with identical sequence H
ec nomenclature ec 2.4.2.-:
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
B PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bcpB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1bcpB01
1ET6A 4TSSA 2IPKD 2G9HD 1XTCD 1LTAD 1SBBB 3R2IA 1SE4A 3V05A 1S5CD 1LT6D 1PZKD 2O2LD 2SEBD 1TS3A 5ELDA 1CQVA 1KLGD 3CHBD 4RGOS 3MFGA 2RDGA 4RGTA 4DXFA 3SEBA 1JQYD 1ET9A 3BVMA 1EWCA 1DYQA 1FNVA 1PZID 1LLRD 4OHJA 2ICIA 3DWAA 5ELCA 3OWEB 1ENFA 1CT1D 1CHPD 1RD9D 1XXGA 4RFBA 1FD7D 4BWGB 1SE3A 1SEBD 3BVZA 5D3DA 1HXYD 1JCKB 1KTKA 1MD2D 1PTOB 1SE2A 1EEID 1PTOC 1TS2A 4O1NA 1JWSD 3R2TA 2QEJC 4Z9CB 4L6TB 1UNSA 3O13A 1PRTC 3R8BA 1D5XC 1LT3D 1BCPC 2AQ1B 3URYA 2AQ2B 1SXTA 1B1ZA 1TS4A 1UUPA 1V1PB 1FGBD 5FKAC 3MC0B 1G8ZD 5ELEA 3C0MA 3BYTB 4RGNA 1PYWD 1LTGD 3EA6A 4RGMA 1D5MC 1AW7A 5ELFA 4ZYSA 1Z52A 2WV6D 1B44D 1HA5A 1D6EC 3C0NA 1TY2A 4RCOA 3BZDB 1HQRD 1LT4D 1LTTD 4C56C 1I4HA 1RF2D 1L0XB 2J4XA 1GOZA 1PTOD 3DWQA 4L63B 1KLUD 2NTSA 2QILA 1JWMD 5FK9C 3TSSA 1EFID 1L0YB 1BCPD 1ESFA 1STEA 3W2DA 1EU4A 5D3IB 2R61A 1F77A 3C0OA 2CHBD 4RH6A 1PTOF 1V1OA 2XRSD 1LT5D 1PRTB 1JR0D 1LTRD 5ELBA 1BCPF 1RDPD 3KLSX 1FNUA 1S5DD 1S5ED 1TY0A 2RDHA 1LTSD 2TSSA 1LTBD 1RCVD 2AQ3B 1BXTA 1I4XA 1HTLD 4RHRA 1M4VA 1I4RA 3BYYB 1SJHD 1I4QA 5I4DA 1D5ZC 1V1PA 1DJRD 1S5FD 1JWUD 1I4PA 3GP7A 3G4OA 3G4NA 1PTOH 2XNAC 1AN8A 1PRTF 1TS5A 2Z8LA 1PZJD 3BVGA 1BCPB 4K6LA 4DXGA 3DWPA 1I4GA 1FNWA 1S5BD 1EU3A 1CK1A 1CHQD 1SJED 1EEFD 2XRQD 1PREA 1PRTD 2XN9C 1T5XD 4RHSA 5TSSA 1LO5D 2IJ0A 4UDUC 1QILA 3EFXD 2NTTA 1LTID
chains in the Genus database with same CATH superfamily
3OSOA 2B2WC 3Q22A 1FL0A 3P20A 4HJAA 2VNUD 4CBVA 2NBFA 3TRZA 2C9OA 1A63A 4YHHQ 5IT9c 4GLAC 2BA0A 3CAMA 1Y1WG 3LNNA 5C4XH 3N6RA 1Q1EA 3RR5A 1JQYD 4RG1A 4DV4Q 3CW2C 1F2ZA 2A69D 2HHHQ 1DYQA 1UAPA 4BY7G 3M3YB 2VUMH 3WOFA 4JI4L 3SR1A 3VA5A 1SE3A 4XT3B 2M00A 5D3DA 4PZ6A 1B8AA 5C44H 3G71A 1PTOC 1Q86C 1AE3A 2B8FA 4DV5L 4C1NI 4C3IG 1LT3D 4A3KB 4UPAA 1UUPA 1K83B 3EN2A 4POGA 5K36H 3D8GA 4DUYL 4JI1L 1QG7A 4B9XA 1XNRL 1D2BA 1YHQA 1CZWA 1NBWA 3U50C 4XQNA 4WFN3 2F0GA 5FLMH 1XYIA 5IY0A 2RSNA 1T9HA 5IGFA 3Q0AA 2ZJPA 1B53A 3A8JE 4JBMA 1B50A 4ZKCB 1CUKA 2ZM6Q 5M5WH 3K8AA 4YWKA 4RWSC 3K81C 1KLUD 5C3XA 4UY8C 1A8VA 2KEDA 1YIJA 4R4IA 1SDFA 2A6EC 3M4YA 1XMQQ 1VQLA 2EY1A 4XTCS 1MI2A 5IP9G 4B3RQ 2ZXRA 4A3MB 3T1HQ 3IRBA 4MTKA 2R93B 1I6HB 4Q0FA 3M4OB 2LKVA 2B29A 1S5DD 1TY0A 3DEOA 2Z6BA 2QDLA 1M4VA 4LUVA 5HURA 4NXML 1PZJD 2WP8J 3HOXH 3GTKB 2F52A 3S1RH 1GD7A 1AZQA 1EU3A 1E1OA 5M3MB 4JG2A 3T1HL 1TWCH 5IOCA 2XN9C 1EQRA 1QCBD 4HR7B 4ZRZA 1L1OB 2PQAB 2K14A 4P72A 3G7LA 4C3IB 3RLNA 2BA1A 2G9HD 2XWBB 2Z0SA 1UE7A 3V05A 1PA6A 1Y69U 2K50A 5COYA 1CZGA 4C2MH 2WAQG 1YNNC 4K0KL 3E0EA 1WYDA 4HJ7A 2V4DA 2K5NA 4X66L 2VQEQ 2OTJA 4H0LC 1LLRD 1F9PA 5LMNQ 3HOYG 3HP3A 2MHVA 2K01A 1U5KA 1SEBD 1JCKB 2L15A 2N3SA 4BS9A 1O7ZA 1EEID 2IY5B 3LX0A 4JC0A 4ULLA 3WWVA 4PMBA 2Y0SG 1BCPC 3URYA 2F3IA 3FVQA 4IALA 4NKLA 2BCOA 3HOWB 1A2UA 5M3FG 2BDOA 2KCMA 4DR3Q 5IP9H 4IFDH 1KDCA 4A3BG 4GKJL 4LF7Q 5FO8B 2Z4HA 2PI2A 2IX0A 2EYMA 2WB1G 1SFOH 4R4OA 3QR8A 2XVSA 4H44C 5IGGA 1OXVA 2NVXH 1CKOA 2R61A 3J7AV 1CI3M 4F8MA 3S17H 2FMCA 2QCPX 4QIWE 3TZUA 2Z6KA 1HNZQ 4MIUA 3BS1A 3UDFA 1IL8A 2JA7G 2KVMA 3IFDA 4ID6A 2NYZD 4DR2Q 1UE1A 4DNRB 4QUCA 3BYYB 3OIPA 5EPJA 2VW9A 1N36Q 4OX9Q 1Q1BA 3G4NA 1B9NA 5EBDA 2E2DC 2VY3A 4RAUC 1TS5A 2Z8LA 2EJGC 2G5DA 2D0OA 1BBXC 1Y14B 3H6MA 2HDMA 5DEHA 1TWHB 3TBIB 3HOWH 4IQZA 1PFBA 4G7HC 4FYDA 3NTHA 2Q8TA 4HEDA 1II3A 4KN7C 4UAIA 2IJ0A 3IKJA 1LACA 1I3QH 1VCIA 1JICA 1STYA 1IYJB 4HMIA 1PH8A 3J81E 3NWSA 4A3KH 3HFZB 5JJZA 2CWPA 4C3HH 2UU9Q 3S17B 2O2LD 5M5XB 2UXDL 1ONLA 3HOVG 2EJMA 3HOZG 5E1FA 3WOEA 1GO3E 1EQVA 5IWAL 1EIHA 1NR4A 3H3VI 2EVBA 1VQGA 1R9TH 1VF5C 4K14A 2EY6A 1WCMH 1KDBA 4DV2L 1QZHA 1WTPA 3EQLC 4O1NA 1PH6A 1EFWA 2R7DA 4PMCA 1HZAA 2ASBA 3QG1A 1TWHH 3I70A 1K8MA 1BDOA 2EDGA 1FYCA 4MZ9A 3HOUH 1HUNA 4KHZA 2IX3A 3D4DA 2A8VA 1F2MA 1V43A 2O4XA 4OIJA 5ELFA 4HIMA 5H1SE 3PF5A 2E2JH 1WD1A 4FXGC 4MN3A 1AEXA 1X3GA 3ER0A 4ZK9B 1RTNA 1BO0A 3GTOB 4C3JB 1HFGA 5CMDA 1MJCA 1IBLQ 2WKDA 5FOBB 2X69A 2F1MA 1WTOA 3LWEA 1B9MA 1KD1C 4LJZC 4J6HA 4GLXA 3VR2A 1QWYA 1S3OA 4O2DA 3PO3H 4H02A 3HOWG 1P8LA 2HHHL 4A3CH 4DV4L 4DR3L 4A3JH 4LFCL 3CCSA 4DR6Q 1JB3A 1LT5D 3K7AH 3TP8A 4HJ5A 2KHJA 3KLSX 1S5ED 5CV4A 3T4AC 2C5CA 3HS0C 4GKKL 3QOJA 3CMAA 3HZXA 5C3EH 4BY1H 3S14B 3OW7A 4EQPA 2OQKA 4JOIC 4CDEC 1C48A 2EY2A 1HFNA 1JWUD 1B7YB 1STGA 1E2ZA 3I4MB 4JV5L 3HOYB 3QB3A 1VQFA 2L0CA 2OCEA 1Y1VG 1HR0Q 1LUZA 2PCFB 4XDXA 1HQMC 3AB9A 1OXSC 4C3JH 3K57A 3E3XA 4DNIA 4LFCQ 1A3UA 2I46A 3FEWX 2OF1A 1JC7A 2RF4A 5J22A 2KCNA 3EIVA 3FHWA 3U58A 4RHSA 1XPRA 5C0XI 4L8JA 4TVAB 4B3TL 3V2TA 1K28A 1HNWL 1MKHA 2SNMA 3CC7A 3CMEA 1PVOA 1WTRA 4E6IA 5KGUA 3GTLB 1CKNA 5I2XA 4HJ9A 3H3VC 2F0JA 3W1GA 1L2FA 2D0PA 5ELDA 1SE8A 4IUUA 2FMMA 3CCUA 5KNCA 3TDQA 4QB4A 3HOZH 3MFGA 4RMFA 4DUYQ 2K52A 1ET9A 3BVMA 2N78A 4YCVA 1ILPA 3OWEB 3UI2A 4PMWA 1Z9FA 1SFOB 3GTQH 1KTKA 3I4MH 3CCMA 3A7AB 1HNWQ 4A3LG 5EKIA 2H5XA 2E75C 2Q2IA 2E2IH 4Y52H 2GVAA 1I94L 2AWOA 2F3WA 3QJYA 4R4CA 3TQYA 3V96A 1SRUA 1B4OA 2C35B 4P2CB 3C46A 3R3OA 4KJOA 2ID0A 2F0IA 4CJ2C 3K0XA 4DV7Q 1Q8IA 4PG3A 3FDTA 1LTTD 1E3PA 1A15A 3PF4A 1IKLA 4OWWB 4B3TQ 1NAPA 1EUJA 2QKIC 4BBRB 3KF8A 3K6OA 4IFDJ 5IODA 1VQ4A 4KLKA 1TWAH 3KLSA 5C4JH 1U4MA 3C1EA 4JI0L 2JA8G 1T5EA 3MHBA 3E5SA 1IBKL 1F77A 5IWAQ 1WTWA 1I5FA 1XMOL 2E2JB 4I7AA 1AFPA 4ZKBB 2HT1A 4GZYC 5A2QE 1U4PA 2PQAA 4DR4L 3J81L 1Y1VB 4A3GH 4KK7A 2JSOA 4DV5Q 4JI8L 1YITA 2B3GA 1S5FD 5BN3A 4GS3A 1Q12A 2CQOA 3HOXG 4CKEA 3CCLA 4YCUA 1WFQA 4HIOA 1FNWA 4DK3C 4X64Q 1DD2A 4JCVE 1SYDA 5IE8A 1EEFD 4CJ0B 1XMOQ 2YYZA 4K5VA 4A3IG 5EAYA 3GTMH 4ODGA 4AYBE 1TVXA 2PMZE 2AUKA 1EOVA 3CPFA 5FJ8H 2NN6I 1GXDC 5J1ZA 4JV5Q 2F0TA 4TSSA 4DU9A 2DY7A 4A93B 5JPMC 1CTMA 1AZPA 4WJ4A 5E4WC 3ZJYC 2MUYA 4X62Q 1TKWB 4A3FG 1XJVA 4C2MB 3Q24A 1SAPA 3VR5A 3CPWA 3K58A 1K8AC 1HJPA 4A3JG 2A6HC 1I6VC 4N9PA 1HUMA 1XPOA 1I50H 2M2LA 3A5UA 3FKIG 3VR3A 4PZ8A 1SMYD 2A6ED 4A3JB 1SYEA 4YCWA 4BY1G 1NR2A 3GO5A 4RGNA 1J5EQ 1PYSB 3D31A 1RHPA 3I4OA 5EPKA 5IYCG 3SK6A 1XNRQ 2OT2A 1PMRA 3ULJA 4K0KQ 1QNKA 3C3LA 2AUJD 2YU9H 2L11A 1HQRD 2NVXB 2XIWA 4QCLA 4NXMQ 3S1RB 5EPLA 4JI7Q 5M5YB 5JJIA 4C3JG 3I73A 3RLOA 5C6AA 4JI6L 1WD0A 1YJWA 3KJPA 5T1GA 1ZEQX 3RZOH 2KECA 2ZTEA 5C4HA 2F0OA 5JPNC 3EROA 4RH6A 3KLRA 3AMUA 3GV3A 2N8NA 3MEHA 1FNUA 4AYBG 1J9OA 2B2TA 4RHRA 5I9OA 4JYAL 2JA5B 1B3AA 5FLXE 1DZ1A 1KHIA 5IGDA 3CC4A 1W2BA 1EIFA 1X3PA 3S2DH 5IGBA 3TMEA 4K6LA 3HKSA 1QVGA 3GTPH 4O0AA 4AQYQ 2LMCB 5LMUQ 1V1QA 5AFWA 3VYUA 5LL6X 1V9PA 1F2LA 4LF5L 4CDFC 3RN2A 4J15A 3PQIA 5C3EG 3I2ZA 4RKLA 3ICEA 4ZUIA 2F03A 4DR7Q 3JAMi 3R2IA 3KLWA 4FF4A 3EBEA 3QOLA 1KQSA 2B2TC 1I3QB 3CHBD 5BN4A 2L5TA 2HDLA 3BZCA 4IO9A 4DR6L 4V190 5GAEC 2UUBL 4DXFA 3K80C 3OTOQ 2B2VC 2L55A 3ULPA 1N33L 1IBKQ 1C4QA 1TWGB 3M4QA 4NW2A 4IOAA 1JOKA 3MXNB 2AMCB 2BE5D 2IL8A 3HOUB 4UP7A 2Y0SB 3PUXA 2MQHA 5EBCA 2VQFQ 1UE5A 2DNEA 1JWSD 2CH4A 1IYVA 1UNSA 4DAVA 2JP1A 1D5XC 1TWFH 3Q6SA 4KKTA 1QVFA 5FKAC 2CCZA 2MP1A 2Z1CA 1FGUA 2JEBI 4JI4Q 3C0MA 3S15H 4IURA 3CRLC 3K7UC 4A93G 1K83H 1GHKA 2MNAA 2DGYA 4TKOB 1B44D 2PZWA 3BZDB 1CA5A 2E5LQ 5BR8Q 3A8IE 2WAQB 4KHVA 5C0XG 3PO3B 2EE1A 5LL6S 1K73C 2QEXA 5GADC 3TP5A 2Q2UA 1YNJC 4LF7L 4NXNQ 4OL7A 1EY7A 3M7GA 1K9MC 5JEAH 2PNHA 3I56A 3BDCA 3D6WA 1GM5A 5D3IB 2B2UC 3NBHB 2OTLA 4B3ML 5IP7G 4AH6A 2K4KA 3U9SA 4BBRG 1V1OA 5E3FA 2DY8A 4X62L 1F2YA 3ND8A 1PYBA 4G57A 2ICEC 3VDYA 1RCVD 2KCTA 3GQBA 1I4XA 2IWHA 4Q5VA 2UXBL 2WKCA 3DUZA 3AFQA 4IUPA 3NHHA 4KV6A 3JAME 1NCVA 5C44B 1N36L 4OX9L 1F9SA 1QZGA 2F0QA 3H0GB 2G9DA 3G4SA 4BY1B 3S14H 2BE5C 1S40A 3NQIA 3W3AA 2A73B 2LSSA 1EYDA 5EKKA 1ASZA 1EL0A 3NUCA 2JA5H 2JA8B 4ZAIA 2KEEA 3HRZC 1PFNA 5CR3A 1SMXA 4XIGS 5KRUA 1E24A 1PZKD 3GD7A 2WIIB 4AIMA 4LF4Q 2JYOA 1E7ZA 2L9HA 5M3FB 3GTLH 4DGZA 3X3MA 4GN3B 2LFNA 1SNPA 4FF2A 1EWCA 1FNVA 2YU9B 1H95A 1EWIA 5ELCA 3STBC 3MAQA 1W3SA 2HIVA 4BXXH 4ZUJA 3DLLA 5C3WA 3H0GH 2K03A 4DV2Q 1TS2A 1SNOA 1HNXL 3R2TA 4HMJA 2DN8A 3D4RA 1YJ9A 1K8GA 4JOIA 3S2HB 4DFAA 3K59A 1TS4A 1ZKOA 1OXUA 2N49A 3IFTA 1AW7A 1Q7YC 2CQAA 4QF4A 2UUAQ 3J7A5 3SXHA 5LMUL 5CV6A 3NSWA 1O7LA 1Z6HA 3NP8A 3MXGA 2JA7B 1TWAB 1XMQL 1X9NA 2VUMB 5D14A 4DR5Q 4GNXC 4DR1L 3PUZA 4M1UB 4A3FH 4C3IH 2EQSA 5FO9B 1ESFA 4CJ1B 2BDNA 4XT1B 4HTHA 4YIJA 3BDOA 3K5MA 3NQTA 1E1TA 1S4ZA 4QY7A 3VYSA 1PTOF 2K32A 3MTSA 1U0LA 1U4LA 3M85A 4B3RL 5ELBA 2O5JC 3CQZH 3CRKC 4K2LA 3U4VA 4HCEA 4NXNL 3GTGB 1I4RA 1YEZA 5I4DA 4YY3Q 1M8AA 4KI0A 4QMGA 3J81i 1N34L 1CSPA 1F9QA 2X6LA 3PCOB 3F2DA 1UEBA 4X6AH 1DOLA 4FVMA 1W6JA 3OPOA 1CHQD 1LM0A 3KBXA 1X65A 2B2VA 2CWAA 4ALPA 1T5XD 3CF5A 4DV6L 1I6HH 5CYUA 1YVCA 2E2IB 4ME3A 1SR3A 3QO2A 2A74C 1ET6A 2IW3A 5CV8A 4ME5A 2XTIA 1H9SB 4JI2L 1D1IA 1YHAA 3S1MH 2JEAI 4AYBB 4UP8A 3UDXA 1RODA 1KLGD 2IT1A 2Q2TA 4G7OC 1JOQA 1QUQB 3J7ZC 4LFBQ 4JI5Q 2WFWA 2ZXOA 4QIWB 4B3MQ 3D6CA 4DN4M 1CT1D 1KRSA 2IHEA 2PYKA 3QWNA 4NB3A 1B2TA 3E6ZX 4BBSG 5FJ8G 4DV0L 2CFMA 3P75A 2TMPA 3MWYW 1CQFA 1Q3LA 2F0WA 3H09A 2VUMG 2D5DA 3STBD 1YNND 1V1PB 1R4QB 5JEAJ 1GJXA 5C44G 2CW0C 3GTQB 3I72A 1VQPA 3I3CA 2B2YC 3OHXC 5M9OA 2A68D 2F4VL 4TQUS 5GROA 1HNXQ 4HN7A 3AFPA 2D9UA 1WI5A 2HCCA 1PTOD 3N52A 1QB5D 2UXCL 2QGQA 1DGSA 2H1EA 2VL6A 3H91A 2F0VA 1PH2A 1DM0B 4GKJQ 1K3BC 1EU4A 4DV1L 3ITPA 1VQ7A 3GTMB 3D4WA 4K6DA 4R9WA 4DV3L 5JJKA 1JR0D 3ONAB 1GUSA 2L12A 1DXMA 5NUCA 3M9BA 2JA8H 3OOCA 2R92B 1TXYA 1KAAA 2XSCA 2EYFA 3SE0A 1SJHD 1I4QA 1V1PA 4KY7A 1DJRD 1C9OA 1JOOA 3VYTA 2K05A 1XNQQ 2XNAC 1AN8A 4JYAQ 4K2KA 3K0YA 5C4XB 4DXGA 2KOLA 1KNEA 1EYAA 1LV9A 1BNZA 3TS2A 2J0TD 1Y1VH 1C0AA 1A3TA 1MJEA 1SSOA 1IXRA 5CC4A 4A3EB 1PH3A 4DPGA 1PREA 2VS1A 3A0JA 1LO5D 1EY0A 2KQ3A 2NN6H 2PI2E 4J1MA 3PV0A 2B2UA 1D1KA 5JOBA 3C2PA 1Q8KA 2RVLA 4DR1Q 1O78A 4LF6Q 1WTXA 1C7YA 1NJIC 2F4IA 4X3KA 2BH8A 1TWGH 4IJHA 4DAYB 3PIP3 1ICFB 4B08A 4LF9Q 2PZUA 4C1NK 3HEJA 4FXKC 4NMZA 3RZDH 1PH5A 4JI1Q 1GVPA 2F0PA 5KEEA 4DV1Q 1O80A 1VQ5A 3TP6A 1TT2A 3DWAA 2NZ1D 2JA6H 4EQOA 2F0NA 2EPBA 2Z4IA 3PIPA 3HKZG 4YY3L 1VQ9A 4QJFA 3J81c 2F0FA 4JI7L 3PSIA 2RCNA 5GQOA 2F0LA 4EVOA 2AQ2B 1SYCA 2Y0SE 2HUGA 1GHJA 1YZ6A 1VQJA 1B3QA 1LTGD 4A4IA 3CCEA 1Z52A 1TWFB 1J5EL 1TQOA 1D6EC 1TY2A 4A3EG 3E0JA 1Y1WB 1Z7TA 4PV1C 1VQ6A 1R9TB 4C56C 2A5HA 4K5WA 3DWQA 1PH7A 3LWUA 3TSSA 4A3DG 1L0WA 3W2DA 2WAQE 3HOVH 3J80i 1EZ8A 4A3BH 1JJGA 3T53B 4BBRH 2YV5A 2YTYA 4CHTB 2WB1B 1BCPF 4RA8A 4HJ8A 1Z47A 1LTSD 2AQ3B 3H94A 2CKZB 5DM63 4DAYA 3F2CA 4MHEA 3I90A 2ZM6L 3L3OC 1MSGA 1I4PA 1BBWA 1VQ8A 1PTOH 1PRTF 4GKKQ 2ZTCA 4OIKA 2EXDA 2NZHA 5BR8L 3I91A 5LMNL 5IYBG 4WJWA 4NDXA 1VQDA 3EJIA 5CV5A 4B9WA 3FPPA 1SJED 2N88A 1G2TA 2KUMA 5C5LA 3TN2A 4A3MG 4LF9L 2LXKA 5LHY1 5JJLA 3FPUB 3LGJA 3NBHA 3J7AF 5FO7B 4BA1I 2JA6G 5K5PA 1CQVA 5KYLA 4A3MH 2ZXPA 2R93H 1WTVA 2K7VA 4FF3A 3F1ZA 4EGVA 1CM9A 3MFYA 3KF6B 4MTNA 1SN8A 4JBJA 4C3HG 3JAML 1H9KA 1IYUA 4OO1H 3I4LA 1FD7D 1N34Q 2OEOA 1XTDA 1MD2D 1PTOB 3I8ZA 4A3IB 2NUCA 1WVLA 1MIUA 2OWOA 4L5SA 2PNRC 3KK7A 3TREA 4K5XA 1YBYA 1Y8PB 1GUNA 3UDIA 2AQ1B 3I4NB 3A74A 5EJWA 2ZTDA 4A3GG 2ENBA 1FGBD 4X65L 5FLXc 4DV7L 4IFDG 1SNDA 3BYTB 3FP9A 4XQJA 3S1NH 2E76C 1MSHA 5C0XJ 3W5OA 2F0SA 4POFA 2NN6G 1ENCA 2IHFA 4JI2Q 2EY5A 4BBSH 1Q81C 3G6EA 3PMFA 1JWMD 1PLFA 4KD4A 2JA9A 4BA2I 1BCPD 3H3VH 4JI3Q 3SK8A 1EY6A 4DR4Q 3SK5A 1IW7D 3A55A 2I5HA 1JB7A 3OW2A 1M1KC 1VF7A 1RDPD 2NZOA 2VB3X 4IZ8A 1OO9B 1O7YA 4A3IH 1Y8OB 1LTBD 4N8FA 1EY8A 4JI6Q 1OTCA 1EWHA 4QQBX 2HQEA 1Q82C 1NE3A 4H7BA 3NE5B 3HGBA 3SK4A 1VQAA 4I7ZC 5HGTA 2XGTA 3FMCA 3CU7A 3SDZA 3MXUA 5HGQA 5ELOA 4HSVA 3K7AB 4X3UA 4F87A 4BY7H 1WCMB 2F0UA 3FKIH 5DAUA 2UXCQ 2R6GA 4KHPL 2UU9L 2IPKD 4Y7NH 1XTCD 4A3GB 1D8LA 2K33A 1SE4A 5IYCH 3HOYH 2FFKB 3AU7A 1JE5A 1A0IA 4GLVB 5J39A 3VYRA 2K6AA 4LF5Q 3BG3A 5K36G 5JVH3 1HPCA 3DHQA 3BZKA 5CV9A 3JAMc 1HR0W 1K0SA 4CKBA 4FF1A 5FLXL 2ICIA 2F0EA 3PO2B 1QVCA 3AQQA 4NPSA 1VQKA 4IPHA 3K5NA 1EY5A 1SNCA 3GTJH 1XNQL 2PO4A 1SE2A 2H4OA 1A62A 4FO2A 4KJNA 2VB2X 3I7FA 3CCRA 4LUZA 4LF8Q 5G3LD 1DOKA 3MVVA 3M4OH 2K75A 3DMUA 4G7ZC 1F9RA 5J3BA 2A19A 3UDGA 1H9SA 4KD3A 4KTAA 3I4MG 4RGMA 5CBAE 3KF6A 1XPUA 3CD6A 4A3LH 4IPDA 2KHSA 1X32A 1G291 2DJGC 2M9VA 2V1CC 3PUYA 3AEVA 1MHWC 4LMQD 2BH2A 2PW7A 1EZ6A 3SVMA 1EIYB 1L0XB 1JORA 1WTQA 5F2DA 3RMHA 5DLQE 1EFID 1BUVT 1STEA 1E2WA 1EYCA 4CGYB 3CXCA 3HOZB 2EYPA 3ERSX 2B8GA 1X6OA 4HAEA 5IGEA 2K5QA 4BBSB 2RDHA 1ZXTA 2EXZA 1VQMA 1BXTA 2UXDQ 2VQFL 1ENAA 2RDFA 2CH4W 5FLMG 2JE6I 3GDEA 4L5RC 3RNUA 5ISRA 2JK8A 4C3HB 4A3EH 2FXQA 2F0MA 5IYDH 3R93A 1IZ6A 4APVA 2E2HH 3I4NH 5GAHC 4OO1G 2B2YA 3X3NA 4L5TA 4JI5L 3HKZE 1HA6A 3D0FA 2YTXA 3T56B 4F88A 2B63G 4FNFA 4UDUC 2VXWA 1Y1WH 1SYGA 1LTID 3M4PA 3P1HA 3H0GG 1SROA 4GN5A 4GNXA 1VQBA 2B63B 3M7NA 1HRJA 3TS0A 4OO1I 1BQQT 5C4JB 4KMUC 1EQTA 4I65A 3S2DB 3MXNA 3Q23A 1U9RA 3S24A 2ZJQA 2EYLA 4R4TA 2Q8IB 3T1YL 5KNDA 4X64L 1RD9D 1XXGA 5IYBH 3E9HA 4BWGB 4LWCA 1E0BA 5IP7H 5M3MG 5C5MA 4X3SA 2IX1A 4A93H 1IW7C 3ND9A 2JN4A 4JW0A 2K5WA 2K5VA 5C4ZA 1X3EA 2GN5A 2B2WA 1SNQA 4MNOA 2E2HB 4LUOA 2HD3A 1M90C 2EIFA 1STBA 5JVG3 3VR4A 2NWGA 1JT8A 1W6KA 5I2YA 3PO2G 3EA6A 2Z6KC 5KIXA 3K5OA 1ZYRD 2ES2A 1G91A 3GTJB 3F2UA 5CGKA 2R93G 1I4HA 4KY5A 1PXUA 4L63B 2NTSA 1H9RA 2BOSA 2EYOA 2F0KA 4N8X1 3A7LA 4IOCA 1STHA 1E22A 4DK0A 3OTOL 2EJFC 1CKNB 2JA5G 4A3CG 1EQQA 1ILQA 5M3FH 4OWXB 1H9JA 4GNXB 4R1JA 2NB0A 1RKNA 4QUFA 2R92G 4WJ3M 1Y8NB 3J80L 3CP0A 1SLJA 2Q8RE 4IUQA 4JPBW 3S15B 3RUZA 4Y7NB 1S72A 4JI3L 2X6GA 3NK9A 4GN4B 4B3SL 5CV7A 3F2BA 1X54A 1J6QA 3CCVA 1WOCA 2SOBA 5E4XA 3JC66 4ZCKA 2F3VA 1HZCA 1HZ9A 2ZJRA 3U9OA 1BCPB 4BXXG 1UWVA 2LXJA 3J80c 1I4GA 2QDBA 1KDAA 1CK1A 2JA6B 1SYBA 4IUTA 1N9WA 4ILWA 5T1IA 1QJOA 3DEPA 1BF4A 3S1QB 2B63H 2CVRA 3D3RA 4HSPA 2RKSA 5AJ3L 5A35A 4JI8Q 3M3YH 5JAVA 1IHZA 4B3SQ 3BJUA 4NP5A 1SBBB 2MO0A 3U4ZA 3SGIA 4U68A 1RJTA 1TS3A 2A68C 1RL2A 4K8JA 4X3TA 3HOUG 2FINB 2UUCL 3ZYYX 4LAAA 3BU2A 2RDGA 1YI2A 3GTOH 3SEBA 1EYGA 3ERQA 1PH1A 1ICWA 4ZQ3A 1EIGA 4OHJA 1GUTA 4JK1C 1X55A 3DXJC 2EOTA 3HG9A 2R7ZG 1K8OA 3BVZA 1HXYD 1KC8C 1YNJD 1IL2A 3T13A 2K5DA 3NENA 4RCNA 4P73A 3O13A 1PRTC 2GA4B 1PFSA 1ML0D 4IPCA 1G8ZD 2FJ2A 4O42A 2K28A 2N55A 1PYWD 4L5QA 4J8QA 1BVSA 1HR0L 2DJFC 2UUCQ 3KBGA 4X65Q 2ALYB 2WV6D 4A3KG 3J7YW 1LTLA 1HNZL 5G3LF 1HA5A 1WJJA 4KKUA 1NMFA 1RF2D 3IAYA 2JQOA 2E5LL 4DR2L 2QILA 5AJ3Q 5FK9C 1GUGA 3QIAA 2MGSA 3AYHB 3S1MB 1JE4A 5CORA 4GOPB 2KBNA 5EQ0A 1G6ZA 5DNFA 3S9WA 2DUDA 2P5ZX 4H13C 1PH4A 3IL8A 2TSSA 1GUOA 2L4NA 3P7JA 1QE6A 1HTLD 1BR9A 1N32Q 1TWCB 4EQ5A 3CCQA 4LF8L 1BKBA 4XYOA 1UE6A 1YHBA 1DCZA 2JA7H 1A3VA 1NY4A 3CKIB 3PGZA 5M5YH 3L9AX 1IBMQ 5M5WB 2PMZB 2O5IC 4XQQA 2UUBQ 3TP7A 4A75A 2HCIA 3OWFA 1PFMA 3KDFA 4DF7A 4K8IA 3PIOA 3OIQA 2HIXA 3RN5A 2I0QA 4R8IA 1XX8A 5KNBA 1HHVA 4BY7B 3DM3A 4OXPA 1DOMA 4CDCC 1G2SA 2MPMA 1AH9A 1KAWA 3T51B 3I55A 1LT6D 1NNXA 2J7ZA 2E8GA 1ASYA 2OQ0A 1X3FA 1PH9A 4GOPC 4RGOS 1JMCA 2EZVA 4RGTA 3MZ5A 1X3QA 3PUWA 2B39A 4P71A 4AQYL 2ATWA 5ELNA 4LNQA 1EY4A 5IGCA 5IYDG 1ENFA 3FRPB 4LK1C 3WDNA 1B70B 1NTGA 2KCCA 4A76A 4ZLTF 4RKBA 1GUWA 5I6WA 1VQCA 2RHQB 2JXMB 3GTPB 3R8BA 2NVQH 1SXTA 4CKCA 4FDBA 2RA4A 4DK1A 4QGUA 5ELEA 3KOJA 4A3DB 3KJOA 3TEHB 2D2CC 2ZT9C 3PUVA 1N33Q 4LF4L 1HTPA 2RQXA 3RD4A 2GVBA 3NEMA 1SNMA 3C0NA 3B6YA 3VR6A 2R3ZA 4JI0Q 1FR3A 2JJQA 5CBEE 4F7XA 1TU2B 4HCSA 2F4VQ 1XWEA 2F0DA 4EQNA 4DR5L 3BDLA 3A5ZB 3T16A 4OONA 1HH2P 4EX5A 4UP9A 2F0HA 4KN4C 4HIKA 3C0OA 3CCJA 3FKIB 1G6PA 4KKSA 1OXXK 2XRSD 3RZDB 3S16H 2SDFA 4IPGA 3RLFA 1LTRD 1Q46A 1UEAB 3J80E 3HOVB 3HKZB 4OGQC 2L1BA 4LFAQ 1AE2A 5C4XG 1MGSA 2KHIA 3GP7A 4DKAC 4YWLA 2RHSB 2NVYB 2YTVA 1X56A 3NTKA 1YJNA 3Q8DA 2PPBC 1VS0A 1PHJA 1JJCB 3NPPA 4PZ7A 5IT9L 2PW5A 4DAPA 4V0BA 1BOSA 1PRTD 3C1FA 3EVQA 3EFXD 5KYIA 3K5LA 2AWNA 1LABA 1CFMA 2SNSA 4IN3A 4JVZA 2XWJB 3KF8B 2A1AA 4DK6C 4KHPQ 5I6YA 1STAA 1S5CD 5IT9E 4IFDI 1CA6A 1U4RA 3F8TA 4DV3Q 1NMGA 2CW0D 1YNXA 4ABNA 1DONA 1PZID 1QUQA 1VMPA 2WINB 4OWTB 4LFBL 3CC2A 1VDZA 2WACA 4RFBA 4TRDA 3L2PA 1V8QA 4A3FB 4R8NA 1VQIA 2KJXA 3G6JB 3KYHC 1VMCA 2NVYH 1FVIA 2AHOB 4LW1A 4Z9CB 2QEJC 3A8KE 4L6TB 2E74C 1HCZA 1GKHA 5EGTA 3J81j 2UUAL 2K04A 4ZYSA 2RSOA 4X66Q 4P74A 2AKWB 3UE0A 1PV4A 3MEFA 3S1NB 4DUZQ 1R4PB 4WRDA 1RTOA 2J4XA 5GAGC 1GOZA 2LY7A 2I07B 4XYQA 1VQEA 3L0OA 1FJGQ 1A2TA 2R7ZH 1WTHA 3W1BA 4DV6Q 3T1YQ 1BBUA 1TIID 2CHBD 5IIFA 1RIPA 2A6HD 4FXDA 1J8IA 1O7IA 2KA7A 4IJLA 2FHTA 2KENA 2RCFA 4DAMA 2NVTH 5I9PA 1I94Q 1P16A 1VQHA 1NUCA 2PZTA 1KABA 1H9MA 3BVGA 3KDFB 3S2HH 1STNA 1HZBA 1L1OC 3DWPA 4S3SA 2NVQB 2K1BA 2VZAA 1TR5A 2EYJA 3GV6A 3S16B 2Z9HA 2XRQD 1IKMA 5A2QL 5L37A 3A54A 2R92H 5TSSA 4JBWA 2R7FA 4GOPA 2MJ8A 5C0XH 1IBML 2NTTA 2Q2HA 1EOTA 3CQZB 3KUPA 2I5LX 3TZDA 4JBKA 2MO1A 4DV0Q 1E2VA 1LTAD 3GTGH 4G4KA 4M8AA 5JEAG 5C3EB 1EY9A 4HIDA 1IBLL 3H15A 3RZOB 2PQEA 4UHVA 2SEBD 4LF6L 1QOHA 4OEMB 4DUZL 1K3RA 4A3DH 4IUVA 3HOXB 3GTKH 2MFIA 3SHLA 2DNCA 3NTIA 4KY6A 4WORA 5M5XH 1SYFA 1FJGL 2QF7A 4DA2A 2D62A 2A69C 1JJ2A 5E7NA 1SMYC 1CHPD 3ULLA 4DNTB 1LYLA 2K5HA 3L7ZC 1K0RA 1I50B 4XXEA 1PDQA 1WCMG 3PO2H 1CSQA 2UXBQ 1NSNS 5HY6A 3NWTA 2RBMA 2QA4A 1B1ZA 3NELA 3NXWA 5EKLA 3MC0B 5M3MH 3VA7A 4YWMA 5DM73 2WB1E 5D65A 1D5MC 3MXPA 4CDDC 3PO3G 2LS01 4RCOA 3G48A 3NBIA 2EYHA 1LT4D 4YHHL 5BN5A 3UE1A 1VQOA 4FP5D 2R7ZB 1D7QA 1L0YB 3KFUA 1QNUA 4LFAL 1ESRA 2QW7A 2VQEL 2NVTB 4N9TA 3S1QH 4R4QA 1CKMA 1KIXA 1ZYRC 1PRTB 5LMNW 1L1OA 4P75A 2I5MX 1C8CA 3DM1A 3PIO3 3OMGA 3OMCA 1D5ZC 1A6XA 4QL5A 3G4OA 3OYYA 1VQNA 4PQXA 1N32L 4DR7L 1G51A 3MA2B 3E9IA 4A3BB 1AP0A 2HQLA 1S5BD 3I4NG 1KL9A 1KRTA 2OXPA 1KNAA 4OELB 4PNYA 1Q90A 1OXTA 1N8RC 1KXLA 3A56A 1QILA 1MBYA 4IUNA 4U673
chains in the Genus database with same CATH topology
3OSOA 2B2WC 3Q22A 3P20A 2VNUD 4CBVA 2NBFA 2C9OA 2BA0A 3LNNA 3N6RA 1Q1EA 1JQYD 1F2ZA 2A69D 1DYQA 1UAPA 3M3YB 3WOFA 3SR1A 3VA5A 1SE3A 4XT3B 2M00A 5D3DA 1PTOC 2B8FA 4C1NI 4C3IG 1LT3D 4A3KB 1UUPA 1K83B 5K36H 3D8GA 1QG7A 4B9XA 1D2BA 1CZWA 4XQNA 4WFN3 2F0GA 1XYIA 2RSNA 5IGFA 3Q0AA 1B50A 1B53A 3A8JE 4ZKCB 4RWSC 5C3XA 1KLUD 2KEDA 1SDFA 2A6EC 3M4YA 2EY1A 4XTCS 1MI2A 2ZXRA 4A3MB 2R93B 1I6HB 4Q0FA 3M4OB 2LKVA 1S5DD 1TY0A 3DEOA 1M4VA 5HURA 1PZJD 2WP8J 3GTKB 1AZQA 1EU3A 5M3MB 5IOCA 2XN9C 1QCBD 4HR7B 4ZRZA 3G7LA 4C3IB 2BA1A 2G9HD 2XWBB 3V05A 1Y69U 5COYA 1CZGA 1YNNC 2V4DA 4H0LC 1LLRD 1F9PA 3HP3A 2MHVA 2K01A 1SEBD 1JCKB 4BS9A 1O7ZA 1EEID 3LX0A 4ULLA 4PMBA 3URYA 1BCPC 3FVQA 4IALA 4NKLA 2BCOA 3HOWB 1A2UA 2BDOA 4IFDH 1KDCA 5FO8B 2Z4HA 2IX0A 2EYMA 2XVSA 4H44C 5IGGA 1OXVA 2R61A 3J7AV 1CI3M 4F8MA 2FMCA 2QCPX 3TZUA 4MIUA 3BS1A 1IL8A 2KVMA 3IFDA 4ID6A 2NYZD 4DNRB 4QUCA 3BYYB 3OIPA 5EPJA 1Q1BA 3G4NA 1B9NA 5EBDA 2E2DC 4RAUC 1TS5A 2Z8LA 2EJGC 1BBXC 3H6MA 2HDMA 5DEHA 1TWHB 3TBIB 4IQZA 1PFBA 4G7HC 4FYDA 3NTHA 2Q8TA 4HEDA 1II3A 4KN7C 4UAIA 2IJ0A 3IKJA 1LACA 1VCIA 1JICA 1STYA 4HMIA 3J81E 3NWSA 5JJZA 3S17B 2O2LD 5M5XB 1ONLA 2EJMA 5E1FA 3WOEA 1EQVA 1EIHA 1NR4A 2EVBA 1VF5C 4K14A 2EY6A 1KDBA 1WTPA 3EQLC 4O1NA 4PMCA 3QG1A 3I70A 1K8MA 1BDOA 2EDGA 1FYCA 1HUNA 4KHZA 2IX3A 3D4DA 1F2MA 1V43A 2O4XA 4OIJA 5ELFA 1WD1A 4FXGC 4MN3A 1AEXA 4ZK9B 1RTNA 1BO0A 3GTOB 4C3JB 1HFGA 5CMDA 2WKDA 5FOBB 2X69A 2F1MA 1WTOA 3LWEA 1B9MA 4LJZC 4J6HA 3VR2A 1QWYA 1JB3A 1LT5D 3TP8A 3KLSX 1S5ED 5CV4A 3T4AC 2C5CA 3HS0C 3QOJA 3HZXA 3S14B 3OW7A 4EQPA 1C48A 2EY2A 1HFNA 1JWUD 1STGA 1E2ZA 3I4MB 3HOYB 3QB3A 2L0CA 2PCFB 4XDXA 1HQMC 3AB9A 1OXSC 3K57A 1A3UA 2I46A 3FEWX 2OF1A 1JC7A 5J22A 2KCNA 4RHSA 5C0XI 4L8JA 3V2TA 2SNMA 1WTRA 4E6IA 5KGUA 3GTLB 5I2XA 3H3VC 2F0JA 5ELDA 4IUUA 2FMMA 5KNCA 3TDQA 4QB4A 3MFGA 1ET9A 3BVMA 1ILPA 3OWEB 3UI2A 4PMWA 1SFOB 1KTKA 3A7AB 5EKIA 2E75C 2AWOA 2F3WA 3QJYA 3V96A 1B4OA 4P2CB 3C46A 3R3OA 4KJOA 2ID0A 2F0IA 4CJ2C 1Q8IA 3FDTA 1LTTD 1A15A 1IKLA 1NAPA 2QKIC 4BBRB 3KF8A 3K6OA 4IFDJ 5IODA 3KLSA 1U4MA 3C1EA 1T5EA 3MHBA 3E5SA 1F77A 1WTWA 2E2JB 1AFPA 4ZKBB 4GZYC 5A2QE 1U4PA 3J81L 1Y1VB 4KK7A 2JSOA 1S5FD 5BN3A 1Q12A 4CKEA 1FNWA 1DD2A 1SYDA 1EEFD 4CJ0B 2YYZA 4K5VA 4ODGA 1TVXA 2AUKA 2NN6I 1GXDC 5J1ZA 2F0TA 4TSSA 4DU9A 2DY7A 4A93B 5JPMC 1CTMA 1AZPA 5E4WC 2MUYA 1TKWB 4C2MB 3Q24A 1SAPA 3VR5A 3K58A 2A6HC 1I6VC 4N9PA 1HUMA 2M2LA 3VR3A 1SMYD 2A6ED 4A3JB 1SYEA 1NR2A 3GO5A 4RGNA 3D31A 1RHPA 5EPKA 3SK6A 2OT2A 1PMRA 1QNKA 3C3LA 2AUJD 2L11A 1HQRD 2NVXB 2XIWA 4QCLA 3S1RB 5EPLA 5M5YB 4C3JG 3I73A 5C6AA 1WD0A 5T1GA 1ZEQX 2KECA 5C4HA 2F0OA 5JPNC 3EROA 4RH6A 3KLRA 3AMUA 3GV3A 3MEHA 1FNUA 1J9OA 2B2TA 4RHRA 5I9OA 2JA5B 1B3AA 5FLXE 1DZ1A 5IGDA 1X3PA 5IGBA 3TMEA 4K6LA 2LMCB 5AFWA 3VYUA 5LL6X 1F2LA 4RKLA 4ZUIA 2F03A 3R2IA 4FF4A 3QOLA 2B2TC 1I3QB 3CHBD 5BN4A 2L5TA 2HDLA 4V190 4DXFA 2B2VC 2L55A 1C4QA 1TWGB 4NW2A 1JOKA 2IL8A 2BE5D 3HOUB 2Y0SB 3PUXA 5EBCA 2DNEA 1JWSD 1IYVA 1UNSA 4DAVA 2JP1A 1D5XC 3Q6SA 4KKTA 5FKAC 2MP1A 2Z1CA 2JEBI 3C0MA 4IURA 3CRLC 1GHKA 4TKOB 1B44D 2PZWA 3BZDB 1CA5A 3A8IE 2WAQB 4KHVA 5C0XG 3PO3B 2EE1A 5LL6S 3TP5A 1YNJC 4OL7A 1EY7A 3M7GA 5JEAH 3BDCA 3D6WA 5D3IB 2B2UC 3U9SA 1V1OA 5E3FA 2DY8A 1F2YA 3ND8A 4G57A 2ICEC 1RCVD 3GQBA 1I4XA 2IWHA 4Q5VA 2WKCA 3DUZA 4IUPA 3NHHA 4KV6A 3JAME 1NCVA 5C44B 1F9SA 2F0QA 2G9DA 3H0GB 4BY1B 2BE5C 3NQIA 3W3AA 2A73B 1EYDA 5EKKA 1EL0A 3NUCA 2JA8B 4ZAIA 2KEEA 3HRZC 1PFNA 5CR3A 4XIGS 5KRUA 1PZKD 3GD7A 2WIIB 2JYOA 2L9HA 5M3FB 4DGZA 3X3MA 2LFNA 1SNPA 4FF2A 1EWCA 1FNVA 2YU9B 5ELCA 3MAQA 4ZUJA 5C3WA 2K03A 1TS2A 1SNOA 3R2TA 4HMJA 2DN8A 3D4RA 3S2HB 4DFAA 3K59A 1TS4A 1ZKOA 1OXUA 3IFTA 1AW7A 2CQAA 4QF4A 3SXHA 5CV6A 1O7LA 1Z6HA 3NSWA 3NP8A 3MXGA 2JA7B 1TWAB 2VUMB 5D14A 3PUZA 4M1UB 5FO9B 1ESFA 4CJ1B 2BDNA 4XT1B 4HTHA 4YIJA 3BDOA 3K5MA 3NQTA 1S4ZA 3VYSA 1PTOF 2K32A 3MTSA 1U4LA 3M85A 5ELBA 2O5JC 3CRKC 4K2LA 4HCEA 3GTGB 1I4RA 5I4DA 1M8AA 4KI0A 4QMGA 1F9QA 2X6LA 1DOLA 4FVMA 1W6JA 3OPOA 1CHQD 3KBXA 2B2VA 1T5XD 5CYUA 2E2IB 3QO2A 2A74C 1ET6A 2IW3A 5CV8A 4ME5A 1H9SB 1D1IA 2JEAI 4AYBB 1RODA 1KLGD 2IT1A 4G7OC 1JOQA 2ZXOA 4QIWB 3D6CA 4DN4M 1CT1D 2PYKA 3QWNA 1B2TA 3E6ZX 3P75A 2TMPA 3MWYW 1CQFA 1Q3LA 2F0WA 3H09A 2D5DA 1YNND 1V1PB 1R4QB 5JEAJ 1GJXA 2CW0C 3GTQB 3I72A 3I3CA 2B2YC 3OHXC 5M9OA 2A68D 4TQUS 4HN7A 2D9UA 2HCCA 1PTOD 3N52A 1QB5D 2H1EA 3H91A 2F0VA 1DM0B 1EU4A 3ITPA 3GTMB 3D4WA 4K6DA 4R9WA 1JR0D 3ONAB 1GUSA 2L12A 1DXMA 5NUCA 3OOCA 2R92B 1KAAA 2XSCA 2EYFA 3SE0A 1SJHD 1I4QA 1V1PA 4KY7A 1DJRD 1JOOA 3VYTA 2K05A 2XNAC 1AN8A 4K2KA 3K0YA 5C4XB 4DXGA 2KOLA 1KNEA 1EYAA 1LV9A 1BNZA 2J0TD 1A3TA 1SSOA 5CC4A 4A3EB 1PREA 1LO5D 1EY0A 2KQ3A 2NN6H 4J1MA 3PV0A 2B2UA 1D1KA 5JOBA 3C2PA 2RVLA 1O78A 1WTXA 2F4IA 4X3KA 3PIP3 4B08A 2PZUA 4C1NK 3HEJA 4FXKC 4NMZA 2F0PA 5KEEA 1O80A 3TP6A 1TT2A 3DWAA 2NZ1D 4EQOA 2F0NA 2EPBA 2Z4IA 2F0FA 2F0LA 4EVOA 2AQ2B 1SYCA 2HUGA 1GHJA 1LTGD 1Z52A 1TWFB 1TQOA 1D6EC 1TY2A 3E0JA 1Y1WB 1Z7TA 4PV1C 1R9TB 4C56C 2A5HA 4K5WA 3DWQA 3LWUA 3TSSA 3W2DA 1EZ8A 3T53B 4CHTB 2WB1B 1BCPF 4RA8A 1Z47A 1LTSD 2AQ3B 3H94A 5DM63 4DAYA 4MHEA 3I90A 3L3OC 1MSGA 1I4PA 1PTOH 1PRTF 4OIKA 3I91A 4WJWA 4NDXA 3EJIA 5CV5A 4B9WA 3FPPA 1SJED 2N88A 1G2TA 2KUMA 5C5LA 3TN2A 5LHY1 3FPUB 3NBHA 3J7AF 5FO7B 4BA1I 5K5PA 1CQVA 5KYLA 2ZXPA 1WTVA 2K7VA 4FF3A 4EGVA 1CM9A 3MFYA 4C3HG 3JAML 1H9KA 1IYUA 4OO1H 3I4LA 1FD7D 2OEOA 1MD2D 1PTOB 3I8ZA 4A3IB 2NUCA 1WVLA 2PNRC 3KK7A 4K5XA 1Y8PB 1GUNA 2AQ1B 3I4NB 5EJWA 2ENBA 1FGBD 4IFDG 1SNDA 3BYTB 4XQJA 2E76C 1MSHA 5C0XJ 2F0SA 2NN6G 1ENCA 2EY5A 3PMFA 1JWMD 1PLFA 4KD4A 4BA2I 1BCPD 3SK8A 1EY6A 3SK5A 1IW7D 3A55A 1VF7A 1RDPD 2VB3X 4IZ8A 1OO9B 1O7YA 1Y8OB 1LTBD 1EY8A 1EWHA 2HQEA 4H7BA 3NE5B 3HGBA 3SK4A 4I7ZC 5HGTA 3FMCA 3CU7A 3SDZA 3MXUA 4HSVA 3K7AB 4X3UA 4F87A 1WCMB 2F0UA 5DAUA 2R6GA 2IPKD 1XTCD 4A3GB 2K33A 1SE4A 2FFKB 3AU7A 5J39A 3VYRA 2K6AA 3BG3A 5K36G 5JVH3 1HPCA 3DHQA 5CV9A 4CKBA 4FF1A 5FLXL 2ICIA 2F0EA 3PO2B 3K5NA 1EY5A 1SNCA 2PO4A 1SE2A 2H4OA 4FO2A 4KJNA 2VB2X 5G3LD 1DOKA 3MVVA 3DMUA 4G7ZC 1F9RA 1H9SA 4KD3A 4KTAA 4RGMA 5CBAE 2KHSA 1X32A 1G291 2M9VA 3PUYA 4LMQD 2PW7A 1EZ6A 3SVMA 1L0XB 1JORA 1WTQA 5F2DA 3RMHA 1EFID 1BUVT 1STEA 1E2WA 1EYCA 4CGYB 3HOZB 2EYPA 4HAEA 2B8GA 5IGEA 2K5QA 4BBSB 2RDHA 1ZXTA 2EXZA 1BXTA 1ENAA 2RDFA 2JE6I 5ISRA 4C3HB 2F0MA 3R93A 4OO1G 2B2YA 3X3NA 1HA6A 3T56B 4F88A 4FNFA 4UDUC 2VXWA 1SYGA 1LTID 3P1HA 2B63B 3M7NA 1HRJA 4OO1I 1BQQT 5C4JB 4KMUC 1EQTA 4I65A 3S2DB 3MXNA 3Q23A 1U9RA 2EYLA 2Q8IB 5KNDA 1RD9D 1XXGA 4BWGB 1E0BA 5C5MA 4X3SA 2IX1A 1IW7C 3ND9A 2K5WA 5C4ZA 2B2WA 1SNQA 2E2HB 1STBA 5JVG3 3VR4A 2NWGA 1W6KA 5I2YA 3EA6A 5KIXA 3K5OA 1ZYRD 1G91A 3GTJB 3F2UA 5CGKA 1I4HA 4KY5A 1PXUA 4L63B 2NTSA 1H9RA 2BOSA 2EYOA 2F0KA 3A7LA 1STHA 4DK0A 2EJFC 1ILQA 1H9JA 2NB0A 1RKNA 4QUFA 1Y8NB 3J80L 2Q8RE 4IUQA 3S15B 3RUZA 4Y7NB 2X6GA 3NK9A 5CV7A 2SOBA 5E4XA 2F3VA 3U9OA 1BCPB 1I4GA 2QDBA 1KDAA 1CK1A 2JA6B 1SYBA 4IUTA 4ILWA 5T1IA 1QJOA 3DEPA 1BF4A 3S1QB 2CVRA 3D3RA 4HSPA 2RKSA 5A35A 5JAVA 1IHZA 4NP5A 1SBBB 4U68A 1RJTA 1TS3A 2A68C 4K8JA 4X3TA 2FINB 3ZYYX 4LAAA 2RDGA 3SEBA 3ERQA 1ICWA 4ZQ3A 1EIGA 4OHJA 1GUTA 4JK1C 3DXJC 2EOTA 3HG9A 1K8OA 3BVZA 1HXYD 1YNJD 3T13A 2K5DA 4RCNA 3O13A 1PRTC 2GA4B 1ML0D 1G8ZD 2FJ2A 4O42A 2K28A 2N55A 1PYWD 4J8QA 3KBGA 2WV6D 3J7YW 5G3LF 1HA5A 4KKUA 1RF2D 3IAYA 2QILA 5FK9C 1GUGA 3QIAA 2MGSA 3S1MB 1JE4A 5CORA 5EQ0A 1G6ZA 5DNFA 3S9WA 4H13C 3IL8A 2TSSA 1GUOA 2L4NA 3P7JA 1QE6A 1HTLD 1BR9A 1TWCB 4XYOA 1DCZA 1A3VA 3CKIB 3L9AX 5M5WB 2PMZB 2O5IC 4XQQA 3TP7A 2HCIA 3OWFA 1PFMA 4DF7A 4K8IA 3OIQA 4R8IA 1XX8A 5KNBA 1HHVA 4BY7B 1DOMA 1G2SA 2MPMA 3T51B 1LT6D 2J7ZA 4RGOS 2EZVA 4RGTA 3MZ5A 1X3QA 2B39A 3PUWA 1EY4A 5IGCA 1ENFA 3FRPB 4LK1C 3WDNA 2KCCA 4ZLTF 4RKBA 1GUWA 5I6WA 2JXMB 3GTPB 3R8BA 1SXTA 4CKCA 4DK1A 2RA4A 5ELEA 4A3DB 2D2CC 2ZT9C 3PUVA 1HTPA 2RQXA 3RD4A 1SNMA 3C0NA 3VR6A 2R3ZA 1FR3A 5CBEE 4F7XA 1TU2B 4HCSA 1XWEA 2F0DA 4EQNA 3BDLA 3T16A 2F0HA 4KN4C 3C0OA 3FKIB 4KKSA 1OXXK 2XRSD 3RZDB 2SDFA 3RLFA 3HOVB 1LTRD 1UEAB 3J80E 3HKZB 4OGQC 2L1BA 1MGSA 3GP7A 2NVYB 3NTKA 2PPBC 3NPPA 5IT9L 2PW5A 4DAPA 4V0BA 1BOSA 1PRTD 3C1FA 3EVQA 3EFXD 5KYIA 3K5LA 2AWNA 1LABA 1CFMA 2SNSA 4IN3A 2XWJB 5I6YA 1STAA 1S5CD 5IT9E 4IFDI 1CA6A 1U4RA 2CW0D 4ABNA 1DONA 1PZID 1VMPA 2WINB 1VDZA 2WACA 4RFBA 4TRDA 1V8QA 4A3FB 4R8NA 2KJXA 3G6JB 1VMCA 4Z9CB 2QEJC 3A8KE 4L6TB 2E74C 1HCZA 5EGTA 2K04A 4ZYSA 2RSOA 3S1NB 1R4PB 4WRDA 1RTOA 2J4XA 1GOZA 2LY7A 2I07B 4XYQA 1A2TA 1TIID 2CHBD 5IIFA 2A6HD 4FXDA 1J8IA 2KA7A 2FHTA 5I9PA 1NUCA 2PZTA 1KABA 1H9MA 3BVGA 1STNA 3DWPA 4S3SA 2NVQB 2K1BA 1TR5A 2EYJA 3GV6A 3S16B 2XRQD 1IKMA 5A2QL 3A54A 5TSSA 4JBWA 2MJ8A 5C0XH 2NTTA 1EOTA 3CQZB 3KUPA 3TZDA 1E2VA 1LTAD 4G4KA 4M8AA 5JEAG 5C3EB 1EY9A 3RZOB 2PQEA 2SEBD 1QOHA 4IUVA 3HOXB 3SHLA 2DNCA 3NTIA 4KY6A 4WORA 1SYFA 2QF7A 4DA2A 2D62A 2A69C 1SMYC 1CHPD 4DNTB 3L7ZC 1I50B 4XXEA 1PDQA 1NSNS 3NWTA 2RBMA 1B1ZA 3NXWA 5EKLA 3MC0B 3VA7A 5DM73 5D65A 1D5MC 3MXPA 2LS01 4RCOA 3NBIA 2EYHA 1LT4D 5BN5A 4FP5D 2R7ZB 1L0YB 1QNUA 1ESRA 2NVTB 4N9TA 1ZYRC 1PRTB 1C8CA 3DM1A 3PIO3 3OMGA 3OMCA 1D5ZC 1A6XA 3G4OA 4PQXA 3MA2B 4A3BB 1AP0A 1S5BD 2OXPA 1KNAA 4PNYA 1Q90A 1OXTA 3A56A 1QILA 1MBYA 4IUNA 4U673
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ET6 A;  4TSS A;  2IPK D;  2G9H D;  1XTC D;  1LTA D;  1SBB B;  3R2I A;  1SE4 A;  3V05 A;  1S5C D;  1LT6 D;  1PZK D;  2O2L D;  2SEB D;  1TS3 A;  5ELD A;  1CQV A;  1KLG D;  3CHB D;  4RGO S;  3MFG A;  2RDG A;  4RGT A;  4DXF A;  3SEB A;  1JQY D;  1ET9 A;  3BVM A;  1EWC A;  1DYQ A;  1FNV A;  1PZI D;  1LLR D;  4OHJ A;  2ICI A;  3DWA A;  5ELC A;  3OWE B;  1ENF A;  1CT1 D;  1CHP D;  1RD9 D;  1XXG A;  4RFB A;  1FD7 D;  4BWG B;  1SE3 A;  1SEB D;  3BVZ A;  5D3D A;  1HXY D;  1JCK B;  1KTK A;  1MD2 D;  1PTO B;  1SE2 A;  1EEI D;  1PTO C;  1TS2 A;  4O1N A;  1JWS D;  3R2T A;  2QEJ C;  4Z9C B;  4L6T B;  1UNS A;  3O13 A;  1PRT C;  3R8B A;  1D5X C;  1LT3 D;  1BCP C;  2AQ1 B;  3URY A;  2AQ2 B;  1SXT A;  1B1Z A;  1TS4 A;  1UUP A;  1V1P B;  1FGB D;  5FKA C;  3MC0 B;  1G8Z D;  5ELE A;  3C0M A;  3BYT B;  4RGN A;  1PYW D;  1LTG D;  3EA6 A;  4RGM A;  1D5M C;  1AW7 A;  5ELF A;  4ZYS A;  1Z52 A;  2WV6 D;  1B44 D;  1HA5 A;  1D6E C;  3C0N A;  1TY2 A;  4RCO A;  3BZD B;  1HQR D;  1LT4 D;  1LTT D;  4C56 C;  1I4H A;  1RF2 D;  1L0X B;  2J4X A;  1GOZ A;  1PTO D;  3DWQ A;  4L63 B;  1KLU D;  2NTS A;  2QIL A;  1JWM D;  5FK9 C;  3TSS A;  1EFI D;  1L0Y B;  1BCP D;  1ESF A;  1STE A;  3W2D A;  1EU4 A;  5D3I B;  2R61 A;  1F77 A;  3C0O A;  2CHB D;  4RH6 A;  1PTO F;  1V1O A;  2XRS D;  1LT5 D;  1PRT B;  1JR0 D;  1LTR D;  5ELB A;  1BCP F;  1RDP D;  3KLS X;  1FNU A;  1S5D D;  1S5E D;  1TY0 A;  2RDH A;  1LTS D;  2TSS A;  1LTB D;  1RCV D;  2AQ3 B;  1BXT A;  1I4X A;  1HTL D;  4RHR A;  1M4V A;  1I4R A;  3BYY B;  1SJH D;  1I4Q A;  5I4D A;  1D5Z C;  1V1P A;  1DJR D;  1S5F D;  1JWU D;  1I4P A;  3GP7 A;  3G4O A;  3G4N A;  1PTO H;  2XNA C;  1AN8 A;  1PRT F;  1TS5 A;  2Z8L A;  1PZJ D;  3BVG A;  1BCP B;  4K6L A;  4DXG A;  3DWP A;  1I4G A;  1FNW A;  1S5B D;  1EU3 A;  1CK1 A;  1CHQ D;  1SJE D;  1EEF D;  2XRQ D;  1PRE A;  1PRT D;  2XN9 C;  1T5X D;  4RHS A;  5TSS A;  1LO5 D;  2IJ0 A;  4UDU C;  1QIL A;  3EFX D;  2NTT A;  1LTI D; 
#chains in the Genus database with same CATH topology
 3OSO A;  2B2W C;  3Q22 A;  1FL0 A;  3P20 A;  4HJA A;  2VNU D;  4CBV A;  2NBF A;  3TRZ A;  2C9O A;  1A63 A;  4YHH Q;  5IT9 c;  4GLA C;  2BA0 A;  3CAM A;  1Y1W G;  3LNN A;  5C4X H;  3N6R A;  1Q1E A;  3RR5 A;  1JQY D;  4RG1 A;  4DV4 Q;  3CW2 C;  1F2Z A;  2A69 D;  2HHH Q;  1DYQ A;  1UAP A;  4BY7 G;  3M3Y B;  2VUM H;  3WOF A;  4JI4 L;  3SR1 A;  3VA5 A;  1SE3 A;  4XT3 B;  2M00 A;  5D3D A;  4PZ6 A;  1B8A A;  5C44 H;  3G71 A;  1PTO C;  1Q86 C;  1AE3 A;  2B8F A;  4DV5 L;  4C1N I;  4C3I G;  1LT3 D;  4A3K B;  4UPA A;  1UUP A;  1K83 B;  3EN2 A;  4POG A;  5K36 H;  3D8G A;  4DUY L;  4JI1 L;  1QG7 A;  4B9X A;  1XNR L;  1D2B A;  1YHQ A;  1CZW A;  1NBW A;  3U50 C;  4XQN A;  4WFN 3;  2F0G A;  5FLM H;  1XYI A;  5IY0 A;  2RSN A;  1T9H A;  5IGF A;  3Q0A A;  2ZJP A;  1B53 A;  3A8J E;  4JBM A;  1B50 A;  4ZKC B;  1CUK A;  2ZM6 Q;  5M5W H;  3K8A A;  4YWK A;  4RWS C;  3K81 C;  1KLU D;  5C3X A;  4UY8 C;  1A8V A;  2KED A;  1YIJ A;  4R4I A;  1SDF A;  2A6E C;  3M4Y A;  1XMQ Q;  1VQL A;  2EY1 A;  4XTC S;  1MI2 A;  5IP9 G;  4B3R Q;  2ZXR A;  4A3M B;  3T1H Q;  3IRB A;  4MTK A;  2R93 B;  1I6H B;  4Q0F A;  3M4O B;  2LKV A;  2B29 A;  1S5D D;  1TY0 A;  3DEO A;  2Z6B A;  2QDL A;  1M4V A;  4LUV A;  5HUR A;  4NXM L;  1PZJ D;  2WP8 J;  3HOX H;  3GTK B;  2F52 A;  3S1R H;  1GD7 A;  1AZQ A;  1EU3 A;  1E1O A;  5M3M B;  4JG2 A;  3T1H L;  1TWC H;  5IOC A;  2XN9 C;  1EQR A;  1QCB D;  4HR7 B;  4ZRZ A;  1L1O B;  2PQA B;  2K14 A;  4P72 A;  3G7L A;  4C3I B;  3RLN A;  2BA1 A;  2G9H D;  2XWB B;  2Z0S A;  1UE7 A;  3V05 A;  1PA6 A;  1Y69 U;  2K50 A;  5COY A;  1CZG A;  4C2M H;  2WAQ G;  1YNN C;  4K0K L;  3E0E A;  1WYD A;  4HJ7 A;  2V4D A;  2K5N A;  4X66 L;  2VQE Q;  2OTJ A;  4H0L C;  1LLR D;  1F9P A;  5LMN Q;  3HOY G;  3HP3 A;  2MHV A;  2K01 A;  1U5K A;  1SEB D;  1JCK B;  2L15 A;  2N3S A;  4BS9 A;  1O7Z A;  1EEI D;  2IY5 B;  3LX0 A;  4JC0 A;  4ULL A;  3WWV A;  4PMB A;  2Y0S G;  1BCP C;  3URY A;  2F3I A;  3FVQ A;  4IAL A;  4NKL A;  2BCO A;  3HOW B;  1A2U A;  5M3F G;  2BDO A;  2KCM A;  4DR3 Q;  5IP9 H;  4IFD H;  1KDC A;  4A3B G;  4GKJ L;  4LF7 Q;  5FO8 B;  2Z4H A;  2PI2 A;  2IX0 A;  2EYM A;  2WB1 G;  1SFO H;  4R4O A;  3QR8 A;  2XVS A;  4H44 C;  5IGG A;  1OXV A;  2NVX H;  1CKO A;  2R61 A;  3J7A V;  1CI3 M;  4F8M A;  3S17 H;  2FMC A;  2QCP X;  4QIW E;  3TZU A;  2Z6K A;  1HNZ Q;  4MIU A;  3BS1 A;  3UDF A;  1IL8 A;  2JA7 G;  2KVM A;  3IFD A;  4ID6 A;  2NYZ D;  4DR2 Q;  1UE1 A;  4DNR B;  4QUC A;  3BYY B;  3OIP A;  5EPJ A;  2VW9 A;  1N36 Q;  4OX9 Q;  1Q1B A;  3G4N A;  1B9N A;  5EBD A;  2E2D C;  2VY3 A;  4RAU C;  1TS5 A;  2Z8L A;  2EJG C;  2G5D A;  2D0O A;  1BBX C;  1Y14 B;  3H6M A;  2HDM A;  5DEH A;  1TWH B;  3TBI B;  3HOW H;  4IQZ A;  1PFB A;  4G7H C;  4FYD A;  3NTH A;  2Q8T A;  4HED A;  1II3 A;  4KN7 C;  4UAI A;  2IJ0 A;  3IKJ A;  1LAC A;  1I3Q H;  1VCI A;  1JIC A;  1STY A;  1IYJ B;  4HMI A;  1PH8 A;  3J81 E;  3NWS A;  4A3K H;  3HFZ B;  5JJZ A;  2CWP A;  4C3H H;  2UU9 Q;  3S17 B;  2O2L D;  5M5X B;  2UXD L;  1ONL A;  3HOV G;  2EJM A;  3HOZ G;  5E1F A;  3WOE A;  1GO3 E;  1EQV A;  5IWA L;  1EIH A;  1NR4 A;  3H3V I;  2EVB A;  1VQG A;  1R9T H;  1VF5 C;  4K14 A;  2EY6 A;  1WCM H;  1KDB A;  4DV2 L;  1QZH A;  1WTP A;  3EQL C;  4O1N A;  1PH6 A;  1EFW A;  2R7D A;  4PMC A;  1HZA A;  2ASB A;  3QG1 A;  1TWH H;  3I70 A;  1K8M A;  1BDO A;  2EDG A;  1FYC A;  4MZ9 A;  3HOU H;  1HUN A;  4KHZ A;  2IX3 A;  3D4D A;  2A8V A;  1F2M A;  1V43 A;  2O4X A;  4OIJ A;  5ELF A;  4HIM A;  5H1S E;  3PF5 A;  2E2J H;  1WD1 A;  4FXG C;  4MN3 A;  1AEX A;  1X3G A;  3ER0 A;  4ZK9 B;  1RTN A;  1BO0 A;  3GTO B;  4C3J B;  1HFG A;  5CMD A;  1MJC A;  1IBL Q;  2WKD A;  5FOB B;  2X69 A;  2F1M A;  1WTO A;  3LWE A;  1B9M A;  1KD1 C;  4LJZ C;  4J6H A;  4GLX A;  3VR2 A;  1QWY A;  1S3O A;  4O2D A;  3PO3 H;  4H02 A;  3HOW G;  1P8L A;  2HHH L;  4A3C H;  4DV4 L;  4DR3 L;  4A3J H;  4LFC L;  3CCS A;  4DR6 Q;  1JB3 A;  1LT5 D;  3K7A H;  3TP8 A;  4HJ5 A;  2KHJ A;  3KLS X;  1S5E D;  5CV4 A;  3T4A C;  2C5C A;  3HS0 C;  4GKK L;  3QOJ A;  3CMA A;  3HZX A;  5C3E H;  4BY1 H;  3S14 B;  3OW7 A;  4EQP A;  2OQK A;  4JOI C;  4CDE C;  1C48 A;  2EY2 A;  1HFN A;  1JWU D;  1B7Y B;  1STG A;  1E2Z A;  3I4M B;  4JV5 L;  3HOY B;  3QB3 A;  1VQF A;  2L0C A;  2OCE A;  1Y1V G;  1HR0 Q;  1LUZ A;  2PCF B;  4XDX A;  1HQM C;  3AB9 A;  1OXS C;  4C3J H;  3K57 A;  3E3X A;  4DNI A;  4LFC Q;  1A3U A;  2I46 A;  3FEW X;  2OF1 A;  1JC7 A;  2RF4 A;  5J22 A;  2KCN A;  3EIV A;  3FHW A;  3U58 A;  4RHS A;  1XPR A;  5C0X I;  4L8J A;  4TVA B;  4B3T L;  3V2T A;  1K28 A;  1HNW L;  1MKH A;  2SNM A;  3CC7 A;  3CME A;  1PVO A;  1WTR A;  4E6I A;  5KGU A;  3GTL B;  1CKN A;  5I2X A;  4HJ9 A;  3H3V C;  2F0J A;  3W1G A;  1L2F A;  2D0P A;  5ELD A;  1SE8 A;  4IUU A;  2FMM A;  3CCU A;  5KNC A;  3TDQ A;  4QB4 A;  3HOZ H;  3MFG A;  4RMF A;  4DUY Q;  2K52 A;  1ET9 A;  3BVM A;  2N78 A;  4YCV A;  1ILP A;  3OWE B;  3UI2 A;  4PMW A;  1Z9F A;  1SFO B;  3GTQ H;  1KTK A;  3I4M H;  3CCM A;  3A7A B;  1HNW Q;  4A3L G;  5EKI A;  2H5X A;  2E75 C;  2Q2I A;  2E2I H;  4Y52 H;  2GVA A;  1I94 L;  2AWO A;  2F3W A;  3QJY A;  4R4C A;  3TQY A;  3V96 A;  1SRU A;  1B4O A;  2C35 B;  4P2C B;  3C46 A;  3R3O A;  4KJO A;  2ID0 A;  2F0I A;  4CJ2 C;  3K0X A;  4DV7 Q;  1Q8I A;  4PG3 A;  3FDT A;  1LTT D;  1E3P A;  1A15 A;  3PF4 A;  1IKL A;  4OWW B;  4B3T Q;  1NAP A;  1EUJ A;  2QKI C;  4BBR B;  3KF8 A;  3K6O A;  4IFD J;  5IOD A;  1VQ4 A;  4KLK A;  1TWA H;  3KLS A;  5C4J H;  1U4M A;  3C1E A;  4JI0 L;  2JA8 G;  1T5E A;  3MHB A;  3E5S A;  1IBK L;  1F77 A;  5IWA Q;  1WTW A;  1I5F A;  1XMO L;  2E2J B;  4I7A A;  1AFP A;  4ZKB B;  2HT1 A;  4GZY C;  5A2Q E;  1U4P A;  2PQA A;  4DR4 L;  3J81 L;  1Y1V B;  4A3G H;  4KK7 A;  2JSO A;  4DV5 Q;  4JI8 L;  1YIT A;  2B3G A;  1S5F D;  5BN3 A;  4GS3 A;  1Q12 A;  2CQO A;  3HOX G;  4CKE A;  3CCL A;  4YCU A;  1WFQ A;  4HIO A;  1FNW A;  4DK3 C;  4X64 Q;  1DD2 A;  4JCV E;  1SYD A;  5IE8 A;  1EEF D;  4CJ0 B;  1XMO Q;  2YYZ A;  4K5V A;  4A3I G;  5EAY A;  3GTM H;  4ODG A;  4AYB E;  1TVX A;  2PMZ E;  2AUK A;  1EOV A;  3CPF A;  5FJ8 H;  2NN6 I;  1GXD C;  5J1Z A;  4JV5 Q;  2F0T A;  4TSS A;  4DU9 A;  2DY7 A;  4A93 B;  5JPM C;  1CTM A;  1AZP A;  4WJ4 A;  5E4W C;  3ZJY C;  2MUY A;  4X62 Q;  1TKW B;  4A3F G;  1XJV A;  4C2M B;  3Q24 A;  1SAP A;  3VR5 A;  3CPW A;  3K58 A;  1K8A C;  1HJP A;  4A3J G;  2A6H C;  1I6V C;  4N9P A;  1HUM A;  1XPO A;  1I50 H;  2M2L A;  3A5U A;  3FKI G;  3VR3 A;  4PZ8 A;  1SMY D;  2A6E D;  4A3J B;  1SYE A;  4YCW A;  4BY1 G;  1NR2 A;  3GO5 A;  4RGN A;  1J5E Q;  1PYS B;  3D31 A;  1RHP A;  3I4O A;  5EPK A;  5IYC G;  3SK6 A;  1XNR Q;  2OT2 A;  1PMR A;  3ULJ A;  4K0K Q;  1QNK A;  3C3L A;  2AUJ D;  2YU9 H;  2L11 A;  1HQR D;  2NVX B;  2XIW A;  4QCL A;  4NXM Q;  3S1R B;  5EPL A;  4JI7 Q;  5M5Y B;  5JJI A;  4C3J G;  3I73 A;  3RLO A;  5C6A A;  4JI6 L;  1WD0 A;  1YJW A;  3KJP A;  5T1G A;  1ZEQ X;  3RZO H;  2KEC A;  2ZTE A;  5C4H A;  2F0O A;  5JPN C;  3ERO A;  4RH6 A;  3KLR A;  3AMU A;  3GV3 A;  2N8N A;  3MEH A;  1FNU A;  4AYB G;  1J9O A;  2B2T A;  4RHR A;  5I9O A;  4JYA L;  2JA5 B;  1B3A A;  5FLX E;  1DZ1 A;  1KHI A;  5IGD A;  3CC4 A;  1W2B A;  1EIF A;  1X3P A;  3S2D H;  5IGB A;  3TME A;  4K6L A;  3HKS A;  1QVG A;  3GTP H;  4O0A A;  4AQY Q;  2LMC B;  5LMU Q;  1V1Q A;  5AFW A;  3VYU A;  5LL6 X;  1V9P A;  1F2L A;  4LF5 L;  4CDF C;  3RN2 A;  4J15 A;  3PQI A;  5C3E G;  3I2Z A;  4RKL A;  3ICE A;  4ZUI A;  2F03 A;  4DR7 Q;  3JAM i;  3R2I A;  3KLW A;  4FF4 A;  3EBE A;  3QOL A;  1KQS A;  2B2T C;  1I3Q B;  3CHB D;  5BN4 A;  2L5T A;  2HDL A;  3BZC A;  4IO9 A;  4DR6 L;  4V19 0;  5GAE C;  2UUB L;  4DXF A;  3K80 C;  3OTO Q;  2B2V C;  2L55 A;  3ULP A;  1N33 L;  1IBK Q;  1C4Q A;  1TWG B;  3M4Q A;  4NW2 A;  4IOA A;  1JOK A;  3MXN B;  2AMC B;  2BE5 D;  2IL8 A;  3HOU B;  4UP7 A;  2Y0S B;  3PUX A;  2MQH A;  5EBC A;  2VQF Q;  1UE5 A;  2DNE A;  1JWS D;  2CH4 A;  1IYV A;  1UNS A;  4DAV A;  2JP1 A;  1D5X C;  1TWF H;  3Q6S A;  4KKT A;  1QVF A;  5FKA C;  2CCZ A;  2MP1 A;  2Z1C A;  1FGU A;  2JEB I;  4JI4 Q;  3C0M A;  3S15 H;  4IUR A;  3CRL C;  3K7U C;  4A93 G;  1K83 H;  1GHK A;  2MNA A;  2DGY A;  4TKO B;  1B44 D;  2PZW A;  3BZD B;  1CA5 A;  2E5L Q;  5BR8 Q;  3A8I E;  2WAQ B;  4KHV A;  5C0X G;  3PO3 B;  2EE1 A;  5LL6 S;  1K73 C;  2QEX A;  5GAD C;  3TP5 A;  2Q2U A;  1YNJ C;  4LF7 L;  4NXN Q;  4OL7 A;  1EY7 A;  3M7G A;  1K9M C;  5JEA H;  2PNH A;  3I56 A;  3BDC A;  3D6W A;  1GM5 A;  5D3I B;  2B2U C;  3NBH B;  2OTL A;  4B3M L;  5IP7 G;  4AH6 A;  2K4K A;  3U9S A;  4BBR G;  1V1O A;  5E3F A;  2DY8 A;  4X62 L;  1F2Y A;  3ND8 A;  1PYB A;  4G57 A;  2ICE C;  3VDY A;  1RCV D;  2KCT A;  3GQB A;  1I4X A;  2IWH A;  4Q5V A;  2UXB L;  2WKC A;  3DUZ A;  3AFQ A;  4IUP A;  3NHH A;  4KV6 A;  3JAM E;  1NCV A;  5C44 B;  1N36 L;  4OX9 L;  1F9S A;  1QZG A;  2F0Q A;  3H0G B;  2G9D A;  3G4S A;  4BY1 B;  3S14 H;  2BE5 C;  1S40 A;  3NQI A;  3W3A A;  2A73 B;  2LSS A;  1EYD A;  5EKK A;  1ASZ A;  1EL0 A;  3NUC A;  2JA5 H;  2JA8 B;  4ZAI A;  2KEE A;  3HRZ C;  1PFN A;  5CR3 A;  1SMX A;  4XIG S;  5KRU A;  1E24 A;  1PZK D;  3GD7 A;  2WII B;  4AIM A;  4LF4 Q;  2JYO A;  1E7Z A;  2L9H A;  5M3F B;  3GTL H;  4DGZ A;  3X3M A;  4GN3 B;  2LFN A;  1SNP A;  4FF2 A;  1EWC A;  1FNV A;  2YU9 B;  1H95 A;  1EWI A;  5ELC A;  3STB C;  3MAQ A;  1W3S A;  2HIV A;  4BXX H;  4ZUJ A;  3DLL A;  5C3W A;  3H0G H;  2K03 A;  4DV2 Q;  1TS2 A;  1SNO A;  1HNX L;  3R2T A;  4HMJ A;  2DN8 A;  3D4R A;  1YJ9 A;  1K8G A;  4JOI A;  3S2H B;  4DFA A;  3K59 A;  1TS4 A;  1ZKO A;  1OXU A;  2N49 A;  3IFT A;  1AW7 A;  1Q7Y C;  2CQA A;  4QF4 A;  2UUA Q;  3J7A 5;  3SXH A;  5LMU L;  5CV6 A;  3NSW A;  1O7L A;  1Z6H A;  3NP8 A;  3MXG A;  2JA7 B;  1TWA B;  1XMQ L;  1X9N A;  2VUM B;  5D14 A;  4DR5 Q;  4GNX C;  4DR1 L;  3PUZ A;  4M1U B;  4A3F H;  4C3I H;  2EQS A;  5FO9 B;  1ESF A;  4CJ1 B;  2BDN A;  4XT1 B;  4HTH A;  4YIJ A;  3BDO A;  3K5M A;  3NQT A;  1E1T A;  1S4Z A;  4QY7 A;  3VYS A;  1PTO F;  2K32 A;  3MTS A;  1U0L A;  1U4L A;  3M85 A;  4B3R L;  5ELB A;  2O5J C;  3CQZ H;  3CRK C;  4K2L A;  3U4V A;  4HCE A;  4NXN L;  3GTG B;  1I4R A;  1YEZ A;  5I4D A;  4YY3 Q;  1M8A A;  4KI0 A;  4QMG A;  3J81 i;  1N34 L;  1CSP A;  1F9Q A;  2X6L A;  3PCO B;  3F2D A;  1UEB A;  4X6A H;  1DOL A;  4FVM A;  1W6J A;  3OPO A;  1CHQ D;  1LM0 A;  3KBX A;  1X65 A;  2B2V A;  2CWA A;  4ALP A;  1T5X D;  3CF5 A;  4DV6 L;  1I6H H;  5CYU A;  1YVC A;  2E2I B;  4ME3 A;  1SR3 A;  3QO2 A;  2A74 C;  1ET6 A;  2IW3 A;  5CV8 A;  4ME5 A;  2XTI A;  1H9S B;  4JI2 L;  1D1I A;  1YHA A;  3S1M H;  2JEA I;  4AYB B;  4UP8 A;  3UDX A;  1ROD A;  1KLG D;  2IT1 A;  2Q2T A;  4G7O C;  1JOQ A;  1QUQ B;  3J7Z C;  4LFB Q;  4JI5 Q;  2WFW A;  2ZXO A;  4QIW B;  4B3M Q;  3D6C A;  4DN4 M;  1CT1 D;  1KRS A;  2IHE A;  2PYK A;  3QWN A;  4NB3 A;  1B2T A;  3E6Z X;  4BBS G;  5FJ8 G;  4DV0 L;  2CFM A;  3P75 A;  2TMP A;  3MWY W;  1CQF A;  1Q3L A;  2F0W A;  3H09 A;  2VUM G;  2D5D A;  3STB D;  1YNN D;  1V1P B;  1R4Q B;  5JEA J;  1GJX A;  5C44 G;  2CW0 C;  3GTQ B;  3I72 A;  1VQP A;  3I3C A;  2B2Y C;  3OHX C;  5M9O A;  2A68 D;  2F4V L;  4TQU S;  5GRO A;  1HNX Q;  4HN7 A;  3AFP A;  2D9U A;  1WI5 A;  2HCC A;  1PTO D;  3N52 A;  1QB5 D;  2UXC L;  2QGQ A;  1DGS A;  2H1E A;  2VL6 A;  3H91 A;  2F0V A;  1PH2 A;  1DM0 B;  4GKJ Q;  1K3B C;  1EU4 A;  4DV1 L;  3ITP A;  1VQ7 A;  3GTM B;  3D4W A;  4K6D A;  4R9W A;  4DV3 L;  5JJK A;  1JR0 D;  3ONA B;  1GUS A;  2L12 A;  1DXM A;  5NUC A;  3M9B A;  2JA8 H;  3OOC A;  2R92 B;  1TXY A;  1KAA A;  2XSC A;  2EYF A;  3SE0 A;  1SJH D;  1I4Q A;  1V1P A;  4KY7 A;  1DJR D;  1C9O A;  1JOO A;  3VYT A;  2K05 A;  1XNQ Q;  2XNA C;  1AN8 A;  4JYA Q;  4K2K A;  3K0Y A;  5C4X B;  4DXG A;  2KOL A;  1KNE A;  1EYA A;  1LV9 A;  1BNZ A;  3TS2 A;  2J0T D;  1Y1V H;  1C0A A;  1A3T A;  1MJE A;  1SSO A;  1IXR A;  5CC4 A;  4A3E B;  1PH3 A;  4DPG A;  1PRE A;  2VS1 A;  3A0J A;  1LO5 D;  1EY0 A;  2KQ3 A;  2NN6 H;  2PI2 E;  4J1M A;  3PV0 A;  2B2U A;  1D1K A;  5JOB A;  3C2P A;  1Q8K A;  2RVL A;  4DR1 Q;  1O78 A;  4LF6 Q;  1WTX A;  1C7Y A;  1NJI C;  2F4I A;  4X3K A;  2BH8 A;  1TWG H;  4IJH A;  4DAY B;  3PIP 3;  1ICF B;  4B08 A;  4LF9 Q;  2PZU A;  4C1N K;  3HEJ A;  4FXK C;  4NMZ A;  3RZD H;  1PH5 A;  4JI1 Q;  1GVP A;  2F0P A;  5KEE A;  4DV1 Q;  1O80 A;  1VQ5 A;  3TP6 A;  1TT2 A;  3DWA A;  2NZ1 D;  2JA6 H;  4EQO A;  2F0N A;  2EPB A;  2Z4I A;  3PIP A;  3HKZ G;  4YY3 L;  1VQ9 A;  4QJF A;  3J81 c;  2F0F A;  4JI7 L;  3PSI A;  2RCN A;  5GQO A;  2F0L A;  4EVO A;  2AQ2 B;  1SYC A;  2Y0S E;  2HUG A;  1GHJ A;  1YZ6 A;  1VQJ A;  1B3Q A;  1LTG D;  4A4I A;  3CCE A;  1Z52 A;  1TWF B;  1J5E L;  1TQO A;  1D6E C;  1TY2 A;  4A3E G;  3E0J A;  1Y1W B;  1Z7T A;  4PV1 C;  1VQ6 A;  1R9T B;  4C56 C;  2A5H A;  4K5W A;  3DWQ A;  1PH7 A;  3LWU A;  3TSS A;  4A3D G;  1L0W A;  3W2D A;  2WAQ E;  3HOV H;  3J80 i;  1EZ8 A;  4A3B H;  1JJG A;  3T53 B;  4BBR H;  2YV5 A;  2YTY A;  4CHT B;  2WB1 B;  1BCP F;  4RA8 A;  4HJ8 A;  1Z47 A;  1LTS D;  2AQ3 B;  3H94 A;  2CKZ B;  5DM6 3;  4DAY A;  3F2C A;  4MHE A;  3I90 A;  2ZM6 L;  3L3O C;  1MSG A;  1I4P A;  1BBW A;  1VQ8 A;  1PTO H;  1PRT F;  4GKK Q;  2ZTC A;  4OIK A;  2EXD A;  2NZH A;  5BR8 L;  3I91 A;  5LMN L;  5IYB G;  4WJW A;  4NDX A;  1VQD A;  3EJI A;  5CV5 A;  4B9W A;  3FPP A;  1SJE D;  2N88 A;  1G2T A;  2KUM A;  5C5L A;  3TN2 A;  4A3M G;  4LF9 L;  2LXK A;  5LHY 1;  5JJL A;  3FPU B;  3LGJ A;  3NBH A;  3J7A F;  5FO7 B;  4BA1 I;  2JA6 G;  5K5P A;  1CQV A;  5KYL A;  4A3M H;  2ZXP A;  2R93 H;  1WTV A;  2K7V A;  4FF3 A;  3F1Z A;  4EGV A;  1CM9 A;  3MFY A;  3KF6 B;  4MTN A;  1SN8 A;  4JBJ A;  4C3H G;  3JAM L;  1H9K A;  1IYU A;  4OO1 H;  3I4L A;  1FD7 D;  1N34 Q;  2OEO A;  1XTD A;  1MD2 D;  1PTO B;  3I8Z A;  4A3I B;  2NUC A;  1WVL A;  1MIU A;  2OWO A;  4L5S A;  2PNR C;  3KK7 A;  3TRE A;  4K5X A;  1YBY A;  1Y8P B;  1GUN A;  3UDI A;  2AQ1 B;  3I4N B;  3A74 A;  5EJW A;  2ZTD A;  4A3G G;  2ENB A;  1FGB D;  4X65 L;  5FLX c;  4DV7 L;  4IFD G;  1SND A;  3BYT B;  3FP9 A;  4XQJ A;  3S1N H;  2E76 C;  1MSH A;  5C0X J;  3W5O A;  2F0S A;  4POF A;  2NN6 G;  1ENC A;  2IHF A;  4JI2 Q;  2EY5 A;  4BBS H;  1Q81 C;  3G6E A;  3PMF A;  1JWM D;  1PLF A;  4KD4 A;  2JA9 A;  4BA2 I;  1BCP D;  3H3V H;  4JI3 Q;  3SK8 A;  1EY6 A;  4DR4 Q;  3SK5 A;  1IW7 D;  3A55 A;  2I5H A;  1JB7 A;  3OW2 A;  1M1K C;  1VF7 A;  1RDP D;  2NZO A;  2VB3 X;  4IZ8 A;  1OO9 B;  1O7Y A;  4A3I H;  1Y8O B;  1LTB D;  4N8F A;  1EY8 A;  4JI6 Q;  1OTC A;  1EWH A;  4QQB X;  2HQE A;  1Q82 C;  1NE3 A;  4H7B A;  3NE5 B;  3HGB A;  3SK4 A;  1VQA A;  4I7Z C;  5HGT A;  2XGT A;  3FMC A;  3CU7 A;  3SDZ A;  3MXU A;  5HGQ A;  5ELO A;  4HSV A;  3K7A B;  4X3U A;  4F87 A;  4BY7 H;  1WCM B;  2F0U A;  3FKI H;  5DAU A;  2UXC Q;  2R6G A;  4KHP L;  2UU9 L;  2IPK D;  4Y7N H;  1XTC D;  4A3G B;  1D8L A;  2K33 A;  1SE4 A;  5IYC H;  3HOY H;  2FFK B;  3AU7 A;  1JE5 A;  1A0I A;  4GLV B;  5J39 A;  3VYR A;  2K6A A;  4LF5 Q;  3BG3 A;  5K36 G;  5JVH 3;  1HPC A;  3DHQ A;  3BZK A;  5CV9 A;  3JAM c;  1HR0 W;  1K0S A;  4CKB A;  4FF1 A;  5FLX L;  2ICI A;  2F0E A;  3PO2 B;  1QVC A;  3AQQ A;  4NPS A;  1VQK A;  4IPH A;  3K5N A;  1EY5 A;  1SNC A;  3GTJ H;  1XNQ L;  2PO4 A;  1SE2 A;  2H4O A;  1A62 A;  4FO2 A;  4KJN A;  2VB2 X;  3I7F A;  3CCR A;  4LUZ A;  4LF8 Q;  5G3L D;  1DOK A;  3MVV A;  3M4O H;  2K75 A;  3DMU A;  4G7Z C;  1F9R A;  5J3B A;  2A19 A;  3UDG A;  1H9S A;  4KD3 A;  4KTA A;  3I4M G;  4RGM A;  5CBA E;  3KF6 A;  1XPU A;  3CD6 A;  4A3L H;  4IPD A;  2KHS A;  1X32 A;  1G29 1;  2DJG C;  2M9V A;  2V1C C;  3PUY A;  3AEV A;  1MHW C;  4LMQ D;  2BH2 A;  2PW7 A;  1EZ6 A;  3SVM A;  1EIY B;  1L0X B;  1JOR A;  1WTQ A;  5F2D A;  3RMH A;  5DLQ E;  1EFI D;  1BUV T;  1STE A;  1E2W A;  1EYC A;  4CGY B;  3CXC A;  3HOZ B;  2EYP A;  3ERS X;  2B8G A;  1X6O A;  4HAE A;  5IGE A;  2K5Q A;  4BBS B;  2RDH A;  1ZXT A;  2EXZ A;  1VQM A;  1BXT A;  2UXD Q;  2VQF L;  1ENA A;  2RDF A;  2CH4 W;  5FLM G;  2JE6 I;  3GDE A;  4L5R C;  3RNU A;  5ISR A;  2JK8 A;  4C3H B;  4A3E H;  2FXQ A;  2F0M A;  5IYD H;  3R93 A;  1IZ6 A;  4APV A;  2E2H H;  3I4N H;  5GAH C;  4OO1 G;  2B2Y A;  3X3N A;  4L5T A;  4JI5 L;  3HKZ E;  1HA6 A;  3D0F A;  2YTX A;  3T56 B;  4F88 A;  2B63 G;  4FNF A;  4UDU C;  2VXW A;  1Y1W H;  1SYG A;  1LTI D;  3M4P A;  3P1H A;  3H0G G;  1SRO A;  4GN5 A;  4GNX A;  1VQB A;  2B63 B;  3M7N A;  1HRJ A;  3TS0 A;  4OO1 I;  1BQQ T;  5C4J B;  4KMU C;  1EQT A;  4I65 A;  3S2D B;  3MXN A;  3Q23 A;  1U9R A;  3S24 A;  2ZJQ A;  2EYL A;  4R4T A;  2Q8I B;  3T1Y L;  5KND A;  4X64 L;  1RD9 D;  1XXG A;  5IYB H;  3E9H A;  4BWG B;  4LWC A;  1E0B A;  5IP7 H;  5M3M G;  5C5M A;  4X3S A;  2IX1 A;  4A93 H;  1IW7 C;  3ND9 A;  2JN4 A;  4JW0 A;  2K5W A;  2K5V A;  5C4Z A;  1X3E A;  2GN5 A;  2B2W A;  1SNQ A;  4MNO A;  2E2H B;  4LUO A;  2HD3 A;  1M90 C;  2EIF A;  1STB A;  5JVG 3;  3VR4 A;  2NWG A;  1JT8 A;  1W6K A;  5I2Y A;  3PO2 G;  3EA6 A;  2Z6K C;  5KIX A;  3K5O A;  1ZYR D;  2ES2 A;  1G91 A;  3GTJ B;  3F2U A;  5CGK A;  2R93 G;  1I4H A;  4KY5 A;  1PXU A;  4L63 B;  2NTS A;  1H9R A;  2BOS A;  2EYO A;  2F0K A;  4N8X 1;  3A7L A;  4IOC A;  1STH A;  1E22 A;  4DK0 A;  3OTO L;  2EJF C;  1CKN B;  2JA5 G;  4A3C G;  1EQQ A;  1ILQ A;  5M3F H;  4OWX B;  1H9J A;  4GNX B;  4R1J A;  2NB0 A;  1RKN A;  4QUF A;  2R92 G;  4WJ3 M;  1Y8N B;  3J80 L;  3CP0 A;  1SLJ A;  2Q8R E;  4IUQ A;  4JPB W;  3S15 B;  3RUZ A;  4Y7N B;  1S72 A;  4JI3 L;  2X6G A;  3NK9 A;  4GN4 B;  4B3S L;  5CV7 A;  3F2B A;  1X54 A;  1J6Q A;  3CCV A;  1WOC A;  2SOB A;  5E4X A;  3JC6 6;  4ZCK A;  2F3V A;  1HZC A;  1HZ9 A;  2ZJR A;  3U9O A;  1BCP B;  4BXX G;  1UWV A;  2LXJ A;  3J80 c;  1I4G A;  2QDB A;  1KDA A;  1CK1 A;  2JA6 B;  1SYB A;  4IUT A;  1N9W A;  4ILW A;  5T1I A;  1QJO A;  3DEP A;  1BF4 A;  3S1Q B;  2B63 H;  2CVR A;  3D3R A;  4HSP A;  2RKS A;  5AJ3 L;  5A35 A;  4JI8 Q;  3M3Y H;  5JAV A;  1IHZ A;  4B3S Q;  3BJU A;  4NP5 A;  1SBB B;  2MO0 A;  3U4Z A;  3SGI A;  4U68 A;  1RJT A;  1TS3 A;  2A68 C;  1RL2 A;  4K8J A;  4X3T A;  3HOU G;  2FIN B;  2UUC L;  3ZYY X;  4LAA A;  3BU2 A;  2RDG A;  1YI2 A;  3GTO H;  3SEB A;  1EYG A;  3ERQ A;  1PH1 A;  1ICW A;  4ZQ3 A;  1EIG A;  4OHJ A;  1GUT A;  4JK1 C;  1X55 A;  3DXJ C;  2EOT A;  3HG9 A;  2R7Z G;  1K8O A;  3BVZ A;  1HXY D;  1KC8 C;  1YNJ D;  1IL2 A;  3T13 A;  2K5D A;  3NEN A;  4RCN A;  4P73 A;  3O13 A;  1PRT C;  2GA4 B;  1PFS A;  1ML0 D;  4IPC A;  1G8Z D;  2FJ2 A;  4O42 A;  2K28 A;  2N55 A;  1PYW D;  4L5Q A;  4J8Q A;  1BVS A;  1HR0 L;  2DJF C;  2UUC Q;  3KBG A;  4X65 Q;  2ALY B;  2WV6 D;  4A3K G;  3J7Y W;  1LTL A;  1HNZ L;  5G3L F;  1HA5 A;  1WJJ A;  4KKU A;  1NMF A;  1RF2 D;  3IAY A;  2JQO A;  2E5L L;  4DR2 L;  2QIL A;  5AJ3 Q;  5FK9 C;  1GUG A;  3QIA A;  2MGS A;  3AYH B;  3S1M B;  1JE4 A;  5COR A;  4GOP B;  2KBN A;  5EQ0 A;  1G6Z A;  5DNF A;  3S9W A;  2DUD A;  2P5Z X;  4H13 C;  1PH4 A;  3IL8 A;  2TSS A;  1GUO A;  2L4N A;  3P7J A;  1QE6 A;  1HTL D;  1BR9 A;  1N32 Q;  1TWC B;  4EQ5 A;  3CCQ A;  4LF8 L;  1BKB A;  4XYO A;  1UE6 A;  1YHB A;  1DCZ A;  2JA7 H;  1A3V A;  1NY4 A;  3CKI B;  3PGZ A;  5M5Y H;  3L9A X;  1IBM Q;  5M5W B;  2PMZ B;  2O5I C;  4XQQ A;  2UUB Q;  3TP7 A;  4A75 A;  2HCI A;  3OWF A;  1PFM A;  3KDF A;  4DF7 A;  4K8I A;  3PIO A;  3OIQ A;  2HIX A;  3RN5 A;  2I0Q A;  4R8I A;  1XX8 A;  5KNB A;  1HHV A;  4BY7 B;  3DM3 A;  4OXP A;  1DOM A;  4CDC C;  1G2S A;  2MPM A;  1AH9 A;  1KAW A;  3T51 B;  3I55 A;  1LT6 D;  1NNX A;  2J7Z A;  2E8G A;  1ASY A;  2OQ0 A;  1X3F A;  1PH9 A;  4GOP C;  4RGO S;  1JMC A;  2EZV A;  4RGT A;  3MZ5 A;  1X3Q A;  3PUW A;  2B39 A;  4P71 A;  4AQY L;  2ATW A;  5ELN A;  4LNQ A;  1EY4 A;  5IGC A;  5IYD G;  1ENF A;  3FRP B;  4LK1 C;  3WDN A;  1B70 B;  1NTG A;  2KCC A;  4A76 A;  4ZLT F;  4RKB A;  1GUW A;  5I6W A;  1VQC A;  2RHQ B;  2JXM B;  3GTP B;  3R8B A;  2NVQ H;  1SXT A;  4CKC A;  4FDB A;  2RA4 A;  4DK1 A;  4QGU A;  5ELE A;  3KOJ A;  4A3D B;  3KJO A;  3TEH B;  2D2C C;  2ZT9 C;  3PUV A;  1N33 Q;  4LF4 L;  1HTP A;  2RQX A;  3RD4 A;  2GVB A;  3NEM A;  1SNM A;  3C0N A;  3B6Y A;  3VR6 A;  2R3Z A;  4JI0 Q;  1FR3 A;  2JJQ A;  5CBE E;  4F7X A;  1TU2 B;  4HCS A;  2F4V Q;  1XWE A;  2F0D A;  4EQN A;  4DR5 L;  3BDL A;  3A5Z B;  3T16 A;  4OON A;  1HH2 P;  4EX5 A;  4UP9 A;  2F0H A;  4KN4 C;  4HIK A;  3C0O A;  3CCJ A;  3FKI B;  1G6P A;  4KKS A;  1OXX K;  2XRS D;  3RZD B;  3S16 H;  2SDF A;  4IPG A;  3RLF A;  1LTR D;  1Q46 A;  1UEA B;  3J80 E;  3HOV B;  3HKZ B;  4OGQ C;  2L1B A;  4LFA Q;  1AE2 A;  5C4X G;  1MGS A;  2KHI A;  3GP7 A;  4DKA C;  4YWL A;  2RHS B;  2NVY B;  2YTV A;  1X56 A;  3NTK A;  1YJN A;  3Q8D A;  2PPB C;  1VS0 A;  1PHJ A;  1JJC B;  3NPP A;  4PZ7 A;  5IT9 L;  2PW5 A;  4DAP A;  4V0B A;  1BOS A;  1PRT D;  3C1F A;  3EVQ A;  3EFX D;  5KYI A;  3K5L A;  2AWN A;  1LAB A;  1CFM A;  2SNS A;  4IN3 A;  4JVZ A;  2XWJ B;  3KF8 B;  2A1A A;  4DK6 C;  4KHP Q;  5I6Y A;  1STA A;  1S5C D;  5IT9 E;  4IFD I;  1CA6 A;  1U4R A;  3F8T A;  4DV3 Q;  1NMG A;  2CW0 D;  1YNX A;  4ABN A;  1DON A;  1PZI D;  1QUQ A;  1VMP A;  2WIN B;  4OWT B;  4LFB L;  3CC2 A;  1VDZ A;  2WAC A;  4RFB A;  4TRD A;  3L2P A;  1V8Q A;  4A3F B;  4R8N A;  1VQI A;  2KJX A;  3G6J B;  3KYH C;  1VMC A;  2NVY H;  1FVI A;  2AHO B;  4LW1 A;  4Z9C B;  2QEJ C;  3A8K E;  4L6T B;  2E74 C;  1HCZ A;  1GKH A;  5EGT A;  3J81 j;  2UUA L;  2K04 A;  4ZYS A;  2RSO A;  4X66 Q;  4P74 A;  2AKW B;  3UE0 A;  1PV4 A;  3MEF A;  3S1N B;  4DUZ Q;  1R4P B;  4WRD A;  1RTO A;  2J4X A;  5GAG C;  1GOZ A;  2LY7 A;  2I07 B;  4XYQ A;  1VQE A;  3L0O A;  1FJG Q;  1A2T A;  2R7Z H;  1WTH A;  3W1B A;  4DV6 Q;  3T1Y Q;  1BBU A;  1TII D;  2CHB D;  5IIF A;  1RIP A;  2A6H D;  4FXD A;  1J8I A;  1O7I A;  2KA7 A;  4IJL A;  2FHT A;  2KEN A;  2RCF A;  4DAM A;  2NVT H;  5I9P A;  1I94 Q;  1P16 A;  1VQH A;  1NUC A;  2PZT A;  1KAB A;  1H9M A;  3BVG A;  3KDF B;  3S2H H;  1STN A;  1HZB A;  1L1O C;  3DWP A;  4S3S A;  2NVQ B;  2K1B A;  2VZA A;  1TR5 A;  2EYJ A;  3GV6 A;  3S16 B;  2Z9H A;  2XRQ D;  1IKM A;  5A2Q L;  5L37 A;  3A54 A;  2R92 H;  5TSS A;  4JBW A;  2R7F A;  4GOP A;  2MJ8 A;  5C0X H;  1IBM L;  2NTT A;  2Q2H A;  1EOT A;  3CQZ B;  3KUP A;  2I5L X;  3TZD A;  4JBK A;  2MO1 A;  4DV0 Q;  1E2V A;  1LTA D;  3GTG H;  4G4K A;  4M8A A;  5JEA G;  5C3E B;  1EY9 A;  4HID A;  1IBL L;  3H15 A;  3RZO B;  2PQE A;  4UHV A;  2SEB D;  4LF6 L;  1QOH A;  4OEM B;  4DUZ L;  1K3R A;  4A3D H;  4IUV A;  3HOX B;  3GTK H;  2MFI A;  3SHL A;  2DNC A;  3NTI A;  4KY6 A;  4WOR A;  5M5X H;  1SYF A;  1FJG L;  2QF7 A;  4DA2 A;  2D62 A;  2A69 C;  1JJ2 A;  5E7N A;  1SMY C;  1CHP D;  3ULL A;  4DNT B;  1LYL A;  2K5H A;  3L7Z C;  1K0R A;  1I50 B;  4XXE A;  1PDQ A;  1WCM G;  3PO2 H;  1CSQ A;  2UXB Q;  1NSN S;  5HY6 A;  3NWT A;  2RBM A;  2QA4 A;  1B1Z A;  3NEL A;  3NXW A;  5EKL A;  3MC0 B;  5M3M H;  3VA7 A;  4YWM A;  5DM7 3;  2WB1 E;  5D65 A;  1D5M C;  3MXP A;  4CDD C;  3PO3 G;  2LS0 1;  4RCO A;  3G48 A;  3NBI A;  2EYH A;  1LT4 D;  4YHH L;  5BN5 A;  3UE1 A;  1VQO A;  4FP5 D;  2R7Z B;  1D7Q A;  1L0Y B;  3KFU A;  1QNU A;  4LFA L;  1ESR A;  2QW7 A;  2VQE L;  2NVT B;  4N9T A;  3S1Q H;  4R4Q A;  1CKM A;  1KIX A;  1ZYR C;  1PRT B;  5LMN W;  1L1O A;  4P75 A;  2I5M X;  1C8C A;  3DM1 A;  3PIO 3;  3OMG A;  3OMC A;  1D5Z C;  1A6X A;  4QL5 A;  3G4O A;  3OYY A;  1VQN A;  4PQX A;  1N32 L;  4DR7 L;  1G51 A;  3MA2 B;  3E9I A;  4A3B B;  1AP0 A;  2HQL A;  1S5B D;  3I4N G;  1KL9 A;  1KRT A;  2OXP A;  1KNA A;  4OEL B;  4PNY A;  1Q90 A;  1OXT A;  1N8R C;  1KXL A;  3A56 A;  1QIL A;  1MBY A;  4IUN A;  4U67 3; 
#chains in the Genus database with same CATH homology
 3OSO A;  2B2W C;  3Q22 A;  3P20 A;  2VNU D;  4CBV A;  2NBF A;  2C9O A;  2BA0 A;  3LNN A;  3N6R A;  1Q1E A;  1JQY D;  1F2Z A;  2A69 D;  1DYQ A;  1UAP A;  3M3Y B;  3WOF A;  3SR1 A;  3VA5 A;  1SE3 A;  4XT3 B;  2M00 A;  5D3D A;  1PTO C;  2B8F A;  4C1N I;  4C3I G;  1LT3 D;  4A3K B;  1UUP A;  1K83 B;  5K36 H;  3D8G A;  1QG7 A;  4B9X A;  1D2B A;  1CZW A;  4XQN A;  4WFN 3;  2F0G A;  1XYI A;  2RSN A;  5IGF A;  3Q0A A;  1B50 A;  1B53 A;  3A8J E;  4ZKC B;  4RWS C;  5C3X A;  1KLU D;  2KED A;  1SDF A;  2A6E C;  3M4Y A;  2EY1 A;  4XTC S;  1MI2 A;  2ZXR A;  4A3M B;  2R93 B;  1I6H B;  4Q0F A;  3M4O B;  2LKV A;  1S5D D;  1TY0 A;  3DEO A;  1M4V A;  5HUR A;  1PZJ D;  2WP8 J;  3GTK B;  1AZQ A;  1EU3 A;  5M3M B;  5IOC A;  2XN9 C;  1QCB D;  4HR7 B;  4ZRZ A;  3G7L A;  4C3I B;  2BA1 A;  2G9H D;  2XWB B;  3V05 A;  1Y69 U;  5COY A;  1CZG A;  1YNN C;  2V4D A;  4H0L C;  1LLR D;  1F9P A;  3HP3 A;  2MHV A;  2K01 A;  1SEB D;  1JCK B;  4BS9 A;  1O7Z A;  1EEI D;  3LX0 A;  4ULL A;  4PMB A;  3URY A;  1BCP C;  3FVQ A;  4IAL A;  4NKL A;  2BCO A;  3HOW B;  1A2U A;  2BDO A;  4IFD H;  1KDC A;  5FO8 B;  2Z4H A;  2IX0 A;  2EYM A;  2XVS A;  4H44 C;  5IGG A;  1OXV A;  2R61 A;  3J7A V;  1CI3 M;  4F8M A;  2FMC A;  2QCP X;  3TZU A;  4MIU A;  3BS1 A;  1IL8 A;  2KVM A;  3IFD A;  4ID6 A;  2NYZ D;  4DNR B;  4QUC A;  3BYY B;  3OIP A;  5EPJ A;  1Q1B A;  3G4N A;  1B9N A;  5EBD A;  2E2D C;  4RAU C;  1TS5 A;  2Z8L A;  2EJG C;  1BBX C;  3H6M A;  2HDM A;  5DEH A;  1TWH B;  3TBI B;  4IQZ A;  1PFB A;  4G7H C;  4FYD A;  3NTH A;  2Q8T A;  4HED A;  1II3 A;  4KN7 C;  4UAI A;  2IJ0 A;  3IKJ A;  1LAC A;  1VCI A;  1JIC A;  1STY A;  4HMI A;  3J81 E;  3NWS A;  5JJZ A;  3S17 B;  2O2L D;  5M5X B;  1ONL A;  2EJM A;  5E1F A;  3WOE A;  1EQV A;  1EIH A;  1NR4 A;  2EVB A;  1VF5 C;  4K14 A;  2EY6 A;  1KDB A;  1WTP A;  3EQL C;  4O1N A;  4PMC A;  3QG1 A;  3I70 A;  1K8M A;  1BDO A;  2EDG A;  1FYC A;  1HUN A;  4KHZ A;  2IX3 A;  3D4D A;  1F2M A;  1V43 A;  2O4X A;  4OIJ A;  5ELF A;  1WD1 A;  4FXG C;  4MN3 A;  1AEX A;  4ZK9 B;  1RTN A;  1BO0 A;  3GTO B;  4C3J B;  1HFG A;  5CMD A;  2WKD A;  5FOB B;  2X69 A;  2F1M A;  1WTO A;  3LWE A;  1B9M A;  4LJZ C;  4J6H A;  3VR2 A;  1QWY A;  1JB3 A;  1LT5 D;  3TP8 A;  3KLS X;  1S5E D;  5CV4 A;  3T4A C;  2C5C A;  3HS0 C;  3QOJ A;  3HZX A;  3S14 B;  3OW7 A;  4EQP A;  1C48 A;  2EY2 A;  1HFN A;  1JWU D;  1STG A;  1E2Z A;  3I4M B;  3HOY B;  3QB3 A;  2L0C A;  2PCF B;  4XDX A;  1HQM C;  3AB9 A;  1OXS C;  3K57 A;  1A3U A;  2I46 A;  3FEW X;  2OF1 A;  1JC7 A;  5J22 A;  2KCN A;  4RHS A;  5C0X I;  4L8J A;  3V2T A;  2SNM A;  1WTR A;  4E6I A;  5KGU A;  3GTL B;  5I2X A;  3H3V C;  2F0J A;  5ELD A;  4IUU A;  2FMM A;  5KNC A;  3TDQ A;  4QB4 A;  3MFG A;  1ET9 A;  3BVM A;  1ILP A;  3OWE B;  3UI2 A;  4PMW A;  1SFO B;  1KTK A;  3A7A B;  5EKI A;  2E75 C;  2AWO A;  2F3W A;  3QJY A;  3V96 A;  1B4O A;  4P2C B;  3C46 A;  3R3O A;  4KJO A;  2ID0 A;  2F0I A;  4CJ2 C;  1Q8I A;  3FDT A;  1LTT D;  1A15 A;  1IKL A;  1NAP A;  2QKI C;  4BBR B;  3KF8 A;  3K6O A;  4IFD J;  5IOD A;  3KLS A;  1U4M A;  3C1E A;  1T5E A;  3MHB A;  3E5S A;  1F77 A;  1WTW A;  2E2J B;  1AFP A;  4ZKB B;  4GZY C;  5A2Q E;  1U4P A;  3J81 L;  1Y1V B;  4KK7 A;  2JSO A;  1S5F D;  5BN3 A;  1Q12 A;  4CKE A;  1FNW A;  1DD2 A;  1SYD A;  1EEF D;  4CJ0 B;  2YYZ A;  4K5V A;  4ODG A;  1TVX A;  2AUK A;  2NN6 I;  1GXD C;  5J1Z A;  2F0T A;  4TSS A;  4DU9 A;  2DY7 A;  4A93 B;  5JPM C;  1CTM A;  1AZP A;  5E4W C;  2MUY A;  1TKW B;  4C2M B;  3Q24 A;  1SAP A;  3VR5 A;  3K58 A;  2A6H C;  1I6V C;  4N9P A;  1HUM A;  2M2L A;  3VR3 A;  1SMY D;  2A6E D;  4A3J B;  1SYE A;  1NR2 A;  3GO5 A;  4RGN A;  3D31 A;  1RHP A;  5EPK A;  3SK6 A;  2OT2 A;  1PMR A;  1QNK A;  3C3L A;  2AUJ D;  2L11 A;  1HQR D;  2NVX B;  2XIW A;  4QCL A;  3S1R B;  5EPL A;  5M5Y B;  4C3J G;  3I73 A;  5C6A A;  1WD0 A;  5T1G A;  1ZEQ X;  2KEC A;  5C4H A;  2F0O A;  5JPN C;  3ERO A;  4RH6 A;  3KLR A;  3AMU A;  3GV3 A;  3MEH A;  1FNU A;  1J9O A;  2B2T A;  4RHR A;  5I9O A;  2JA5 B;  1B3A A;  5FLX E;  1DZ1 A;  5IGD A;  1X3P A;  5IGB A;  3TME A;  4K6L A;  2LMC B;  5AFW A;  3VYU A;  5LL6 X;  1F2L A;  4RKL A;  4ZUI A;  2F03 A;  3R2I A;  4FF4 A;  3QOL A;  2B2T C;  1I3Q B;  3CHB D;  5BN4 A;  2L5T A;  2HDL A;  4V19 0;  4DXF A;  2B2V C;  2L55 A;  1C4Q A;  1TWG B;  4NW2 A;  1JOK A;  2IL8 A;  2BE5 D;  3HOU B;  2Y0S B;  3PUX A;  5EBC A;  2DNE A;  1JWS D;  1IYV A;  1UNS A;  4DAV A;  2JP1 A;  1D5X C;  3Q6S A;  4KKT A;  5FKA C;  2MP1 A;  2Z1C A;  2JEB I;  3C0M A;  4IUR A;  3CRL C;  1GHK A;  4TKO B;  1B44 D;  2PZW A;  3BZD B;  1CA5 A;  3A8I E;  2WAQ B;  4KHV A;  5C0X G;  3PO3 B;  2EE1 A;  5LL6 S;  3TP5 A;  1YNJ C;  4OL7 A;  1EY7 A;  3M7G A;  5JEA H;  3BDC A;  3D6W A;  5D3I B;  2B2U C;  3U9S A;  1V1O A;  5E3F A;  2DY8 A;  1F2Y A;  3ND8 A;  4G57 A;  2ICE C;  1RCV D;  3GQB A;  1I4X A;  2IWH A;  4Q5V A;  2WKC A;  3DUZ A;  4IUP A;  3NHH A;  4KV6 A;  3JAM E;  1NCV A;  5C44 B;  1F9S A;  2F0Q A;  2G9D A;  3H0G B;  4BY1 B;  2BE5 C;  3NQI A;  3W3A A;  2A73 B;  1EYD A;  5EKK A;  1EL0 A;  3NUC A;  2JA8 B;  4ZAI A;  2KEE A;  3HRZ C;  1PFN A;  5CR3 A;  4XIG S;  5KRU A;  1PZK D;  3GD7 A;  2WII B;  2JYO A;  2L9H A;  5M3F B;  4DGZ A;  3X3M A;  2LFN A;  1SNP A;  4FF2 A;  1EWC A;  1FNV A;  2YU9 B;  5ELC A;  3MAQ A;  4ZUJ A;  5C3W A;  2K03 A;  1TS2 A;  1SNO A;  3R2T A;  4HMJ A;  2DN8 A;  3D4R A;  3S2H B;  4DFA A;  3K59 A;  1TS4 A;  1ZKO A;  1OXU A;  3IFT A;  1AW7 A;  2CQA A;  4QF4 A;  3SXH A;  5CV6 A;  1O7L A;  1Z6H A;  3NSW A;  3NP8 A;  3MXG A;  2JA7 B;  1TWA B;  2VUM B;  5D14 A;  3PUZ A;  4M1U B;  5FO9 B;  1ESF A;  4CJ1 B;  2BDN A;  4XT1 B;  4HTH A;  4YIJ A;  3BDO A;  3K5M A;  3NQT A;  1S4Z A;  3VYS A;  1PTO F;  2K32 A;  3MTS A;  1U4L A;  3M85 A;  5ELB A;  2O5J C;  3CRK C;  4K2L A;  4HCE A;  3GTG B;  1I4R A;  5I4D A;  1M8A A;  4KI0 A;  4QMG A;  1F9Q A;  2X6L A;  1DOL A;  4FVM A;  1W6J A;  3OPO A;  1CHQ D;  3KBX A;  2B2V A;  1T5X D;  5CYU A;  2E2I B;  3QO2 A;  2A74 C;  1ET6 A;  2IW3 A;  5CV8 A;  4ME5 A;  1H9S B;  1D1I A;  2JEA I;  4AYB B;  1ROD A;  1KLG D;  2IT1 A;  4G7O C;  1JOQ A;  2ZXO A;  4QIW B;  3D6C A;  4DN4 M;  1CT1 D;  2PYK A;  3QWN A;  1B2T A;  3E6Z X;  3P75 A;  2TMP A;  3MWY W;  1CQF A;  1Q3L A;  2F0W A;  3H09 A;  2D5D A;  1YNN D;  1V1P B;  1R4Q B;  5JEA J;  1GJX A;  2CW0 C;  3GTQ B;  3I72 A;  3I3C A;  2B2Y C;  3OHX C;  5M9O A;  2A68 D;  4TQU S;  4HN7 A;  2D9U A;  2HCC A;  1PTO D;  3N52 A;  1QB5 D;  2H1E A;  3H91 A;  2F0V A;  1DM0 B;  1EU4 A;  3ITP A;  3GTM B;  3D4W A;  4K6D A;  4R9W A;  1JR0 D;  3ONA B;  1GUS A;  2L12 A;  1DXM A;  5NUC A;  3OOC A;  2R92 B;  1KAA A;  2XSC A;  2EYF A;  3SE0 A;  1SJH D;  1I4Q A;  1V1P A;  4KY7 A;  1DJR D;  1JOO A;  3VYT A;  2K05 A;  2XNA C;  1AN8 A;  4K2K A;  3K0Y A;  5C4X B;  4DXG A;  2KOL A;  1KNE A;  1EYA A;  1LV9 A;  1BNZ A;  2J0T D;  1A3T A;  1SSO A;  5CC4 A;  4A3E B;  1PRE A;  1LO5 D;  1EY0 A;  2KQ3 A;  2NN6 H;  4J1M A;  3PV0 A;  2B2U A;  1D1K A;  5JOB A;  3C2P A;  2RVL A;  1O78 A;  1WTX A;  2F4I A;  4X3K A;  3PIP 3;  4B08 A;  2PZU A;  4C1N K;  3HEJ A;  4FXK C;  4NMZ A;  2F0P A;  5KEE A;  1O80 A;  3TP6 A;  1TT2 A;  3DWA A;  2NZ1 D;  4EQO A;  2F0N A;  2EPB A;  2Z4I A;  2F0F A;  2F0L A;  4EVO A;  2AQ2 B;  1SYC A;  2HUG A;  1GHJ A;  1LTG D;  1Z52 A;  1TWF B;  1TQO A;  1D6E C;  1TY2 A;  3E0J A;  1Y1W B;  1Z7T A;  4PV1 C;  1R9T B;  4C56 C;  2A5H A;  4K5W A;  3DWQ A;  3LWU A;  3TSS A;  3W2D A;  1EZ8 A;  3T53 B;  4CHT B;  2WB1 B;  1BCP F;  4RA8 A;  1Z47 A;  1LTS D;  2AQ3 B;  3H94 A;  5DM6 3;  4DAY A;  4MHE A;  3I90 A;  3L3O C;  1MSG A;  1I4P A;  1PTO H;  1PRT F;  4OIK A;  3I91 A;  4WJW A;  4NDX A;  3EJI A;  5CV5 A;  4B9W A;  3FPP A;  1SJE D;  2N88 A;  1G2T A;  2KUM A;  5C5L A;  3TN2 A;  5LHY 1;  3FPU B;  3NBH A;  3J7A F;  5FO7 B;  4BA1 I;  5K5P A;  1CQV A;  5KYL A;  2ZXP A;  1WTV A;  2K7V A;  4FF3 A;  4EGV A;  1CM9 A;  3MFY A;  4C3H G;  3JAM L;  1H9K A;  1IYU A;  4OO1 H;  3I4L A;  1FD7 D;  2OEO A;  1MD2 D;  1PTO B;  3I8Z A;  4A3I B;  2NUC A;  1WVL A;  2PNR C;  3KK7 A;  4K5X A;  1Y8P B;  1GUN A;  2AQ1 B;  3I4N B;  5EJW A;  2ENB A;  1FGB D;  4IFD G;  1SND A;  3BYT B;  4XQJ A;  2E76 C;  1MSH A;  5C0X J;  2F0S A;  2NN6 G;  1ENC A;  2EY5 A;  3PMF A;  1JWM D;  1PLF A;  4KD4 A;  4BA2 I;  1BCP D;  3SK8 A;  1EY6 A;  3SK5 A;  1IW7 D;  3A55 A;  1VF7 A;  1RDP D;  2VB3 X;  4IZ8 A;  1OO9 B;  1O7Y A;  1Y8O B;  1LTB D;  1EY8 A;  1EWH A;  2HQE A;  4H7B A;  3NE5 B;  3HGB A;  3SK4 A;  4I7Z C;  5HGT A;  3FMC A;  3CU7 A;  3SDZ A;  3MXU A;  4HSV A;  3K7A B;  4X3U A;  4F87 A;  1WCM B;  2F0U A;  5DAU A;  2R6G A;  2IPK D;  1XTC D;  4A3G B;  2K33 A;  1SE4 A;  2FFK B;  3AU7 A;  5J39 A;  3VYR A;  2K6A A;  3BG3 A;  5K36 G;  5JVH 3;  1HPC A;  3DHQ A;  5CV9 A;  4CKB A;  4FF1 A;  5FLX L;  2ICI A;  2F0E A;  3PO2 B;  3K5N A;  1EY5 A;  1SNC A;  2PO4 A;  1SE2 A;  2H4O A;  4FO2 A;  4KJN A;  2VB2 X;  5G3L D;  1DOK A;  3MVV A;  3DMU A;  4G7Z C;  1F9R A;  1H9S A;  4KD3 A;  4KTA A;  4RGM A;  5CBA E;  2KHS A;  1X32 A;  1G29 1;  2M9V A;  3PUY A;  4LMQ D;  2PW7 A;  1EZ6 A;  3SVM A;  1L0X B;  1JOR A;  1WTQ A;  5F2D A;  3RMH A;  1EFI D;  1BUV T;  1STE A;  1E2W A;  1EYC A;  4CGY B;  3HOZ B;  2EYP A;  4HAE A;  2B8G A;  5IGE A;  2K5Q A;  4BBS B;  2RDH A;  1ZXT A;  2EXZ A;  1BXT A;  1ENA A;  2RDF A;  2JE6 I;  5ISR A;  4C3H B;  2F0M A;  3R93 A;  4OO1 G;  2B2Y A;  3X3N A;  1HA6 A;  3T56 B;  4F88 A;  4FNF A;  4UDU C;  2VXW A;  1SYG A;  1LTI D;  3P1H A;  2B63 B;  3M7N A;  1HRJ A;  4OO1 I;  1BQQ T;  5C4J B;  4KMU C;  1EQT A;  4I65 A;  3S2D B;  3MXN A;  3Q23 A;  1U9R A;  2EYL A;  2Q8I B;  5KND A;  1RD9 D;  1XXG A;  4BWG B;  1E0B A;  5C5M A;  4X3S A;  2IX1 A;  1IW7 C;  3ND9 A;  2K5W A;  5C4Z A;  2B2W A;  1SNQ A;  2E2H B;  1STB A;  5JVG 3;  3VR4 A;  2NWG A;  1W6K A;  5I2Y A;  3EA6 A;  5KIX A;  3K5O A;  1ZYR D;  1G91 A;  3GTJ B;  3F2U A;  5CGK A;  1I4H A;  4KY5 A;  1PXU A;  4L63 B;  2NTS A;  1H9R A;  2BOS A;  2EYO A;  2F0K A;  3A7L A;  1STH A;  4DK0 A;  2EJF C;  1ILQ A;  1H9J A;  2NB0 A;  1RKN A;  4QUF A;  1Y8N B;  3J80 L;  2Q8R E;  4IUQ A;  3S15 B;  3RUZ A;  4Y7N B;  2X6G A;  3NK9 A;  5CV7 A;  2SOB A;  5E4X A;  2F3V A;  3U9O A;  1BCP B;  1I4G A;  2QDB A;  1KDA A;  1CK1 A;  2JA6 B;  1SYB A;  4IUT A;  4ILW A;  5T1I A;  1QJO A;  3DEP A;  1BF4 A;  3S1Q B;  2CVR A;  3D3R A;  4HSP A;  2RKS A;  5A35 A;  5JAV A;  1IHZ A;  4NP5 A;  1SBB B;  4U68 A;  1RJT A;  1TS3 A;  2A68 C;  4K8J A;  4X3T A;  2FIN B;  3ZYY X;  4LAA A;  2RDG A;  3SEB A;  3ERQ A;  1ICW A;  4ZQ3 A;  1EIG A;  4OHJ A;  1GUT A;  4JK1 C;  3DXJ C;  2EOT A;  3HG9 A;  1K8O A;  3BVZ A;  1HXY D;  1YNJ D;  3T13 A;  2K5D A;  4RCN A;  3O13 A;  1PRT C;  2GA4 B;  1ML0 D;  1G8Z D;  2FJ2 A;  4O42 A;  2K28 A;  2N55 A;  1PYW D;  4J8Q A;  3KBG A;  2WV6 D;  3J7Y W;  5G3L F;  1HA5 A;  4KKU A;  1RF2 D;  3IAY A;  2QIL A;  5FK9 C;  1GUG A;  3QIA A;  2MGS A;  3S1M B;  1JE4 A;  5COR A;  5EQ0 A;  1G6Z A;  5DNF A;  3S9W A;  4H13 C;  3IL8 A;  2TSS A;  1GUO A;  2L4N A;  3P7J A;  1QE6 A;  1HTL D;  1BR9 A;  1TWC B;  4XYO A;  1DCZ A;  1A3V A;  3CKI B;  3L9A X;  5M5W B;  2PMZ B;  2O5I C;  4XQQ A;  3TP7 A;  2HCI A;  3OWF A;  1PFM A;  4DF7 A;  4K8I A;  3OIQ A;  4R8I A;  1XX8 A;  5KNB A;  1HHV A;  4BY7 B;  1DOM A;  1G2S A;  2MPM A;  3T51 B;  1LT6 D;  2J7Z A;  4RGO S;  2EZV A;  4RGT A;  3MZ5 A;  1X3Q A;  2B39 A;  3PUW A;  1EY4 A;  5IGC A;  1ENF A;  3FRP B;  4LK1 C;  3WDN A;  2KCC A;  4ZLT F;  4RKB A;  1GUW A;  5I6W A;  2JXM B;  3GTP B;  3R8B A;  1SXT A;  4CKC A;  4DK1 A;  2RA4 A;  5ELE A;  4A3D B;  2D2C C;  2ZT9 C;  3PUV A;  1HTP A;  2RQX A;  3RD4 A;  1SNM A;  3C0N A;  3VR6 A;  2R3Z A;  1FR3 A;  5CBE E;  4F7X A;  1TU2 B;  4HCS A;  1XWE A;  2F0D A;  4EQN A;  3BDL A;  3T16 A;  2F0H A;  4KN4 C;  3C0O A;  3FKI B;  4KKS A;  1OXX K;  2XRS D;  3RZD B;  2SDF A;  3RLF A;  3HOV B;  1LTR D;  1UEA B;  3J80 E;  3HKZ B;  4OGQ C;  2L1B A;  1MGS A;  3GP7 A;  2NVY B;  3NTK A;  2PPB C;  3NPP A;  5IT9 L;  2PW5 A;  4DAP A;  4V0B A;  1BOS A;  1PRT D;  3C1F A;  3EVQ A;  3EFX D;  5KYI A;  3K5L A;  2AWN A;  1LAB A;  1CFM A;  2SNS A;  4IN3 A;  2XWJ B;  5I6Y A;  1STA A;  1S5C D;  5IT9 E;  4IFD I;  1CA6 A;  1U4R A;  2CW0 D;  4ABN A;  1DON A;  1PZI D;  1VMP A;  2WIN B;  1VDZ A;  2WAC A;  4RFB A;  4TRD A;  1V8Q A;  4A3F B;  4R8N A;  2KJX A;  3G6J B;  1VMC A;  4Z9C B;  2QEJ C;  3A8K E;  4L6T B;  2E74 C;  1HCZ A;  5EGT A;  2K04 A;  4ZYS A;  2RSO A;  3S1N B;  1R4P B;  4WRD A;  1RTO A;  2J4X A;  1GOZ A;  2LY7 A;  2I07 B;  4XYQ A;  1A2T A;  1TII D;  2CHB D;  5IIF A;  2A6H D;  4FXD A;  1J8I A;  2KA7 A;  2FHT A;  5I9P A;  1NUC A;  2PZT A;  1KAB A;  1H9M A;  3BVG A;  1STN A;  3DWP A;  4S3S A;  2NVQ B;  2K1B A;  1TR5 A;  2EYJ A;  3GV6 A;  3S16 B;  2XRQ D;  1IKM A;  5A2Q L;  3A54 A;  5TSS A;  4JBW A;  2MJ8 A;  5C0X H;  2NTT A;  1EOT A;  3CQZ B;  3KUP A;  3TZD A;  1E2V A;  1LTA D;  4G4K A;  4M8A A;  5JEA G;  5C3E B;  1EY9 A;  3RZO B;  2PQE A;  2SEB D;  1QOH A;  4IUV A;  3HOX B;  3SHL A;  2DNC A;  3NTI A;  4KY6 A;  4WOR A;  1SYF A;  2QF7 A;  4DA2 A;  2D62 A;  2A69 C;  1SMY C;  1CHP D;  4DNT B;  3L7Z C;  1I50 B;  4XXE A;  1PDQ A;  1NSN S;  3NWT A;  2RBM A;  1B1Z A;  3NXW A;  5EKL A;  3MC0 B;  3VA7 A;  5DM7 3;  5D65 A;  1D5M C;  3MXP A;  2LS0 1;  4RCO A;  3NBI A;  2EYH A;  1LT4 D;  5BN5 A;  4FP5 D;  2R7Z B;  1L0Y B;  1QNU A;  1ESR A;  2NVT B;  4N9T A;  1ZYR C;  1PRT B;  1C8C A;  3DM1 A;  3PIO 3;  3OMG A;  3OMC A;  1D5Z C;  1A6X A;  3G4O A;  4PQX A;  3MA2 B;  4A3B B;  1AP0 A;  1S5B D;  2OXP A;  1KNA A;  4PNY A;  1Q90 A;  1OXT A;  3A56 A;  1QIL A;  1MBY A;  4IUN A;  4U67 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...