1BCPB

Binary complex of pertussis toxin and atp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
197
structure length
197
Chain Sequence
b'PGIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN
publication title Crystal structure of the pertussis toxin-ATP complex: a molecular sensor.
pubmed doi rcsb
molecule tags Toxin
total genus 42
structure length 197
sequence length 197
chains with identical sequence H
ec nomenclature ec 2.4.2.-:
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
B PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bcpB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1bcpB01
4BWGB 1UNSA 1EEID 1QILA 1BCPB 2WV6D 1GOZA 2NTSA 1JWMD 1PRTF 1BCPC 3R2TA 1ET9A 1LT5D 4RFBA 1I4RA 2SEBD 1LLRD 1V1PB 5D3IB 1ET6A 1JQYD 1ESFA 1S5FD 1SBBB 1BCPF 4L6TB 1SJHD 3MFGA 4OHJA 1JR0D 4Z9CB 3MC0B 3C0MA 2CHBD 1LTID 2RDGA 2XN9C 2G9HD 1KTKA 2AQ2B 1EU4A 3W2DA 1FNWA 1G8ZD 2AQ1B 1SE2A 1KLGD 1PRTB 1CK1A 3BVGA 5ELDA 1I4XA 5FK9C 1PRTC 5FKAC 1LO5D 1PTOB 1L0YB 1ENFA 3G4NA 1DYQA 3BZDB 4RGTA 1PYWD 1RF2D 1PTOC 1I4GA 1CHPD 2TSSA 3URYA 1BCPD 1AW7A 1I4HA 2RDHA 2XRQD 4L63B 1B44D 3V05A 1PTOF 1HTLD 1LTAD 1S5CD 1DJRD 3O13A 4RGOS 1LTBD 2QILA 1TS2A 1HQRD 1S5BD 1SEBD 5ELBA 1PREA 3R8BA 3DWPA 1TS4A 1TY2A 1HA5A 2XRSD 1Z52A 3EFXD 1CHQD 1AN8A 1EEFD 2Z8LA 1TS3A 4RGMA 2XNAC 5TSSA 1SE4A 4DXFA 5I4DA 1B1ZA 1I4QA 5ELCA 4RHRA 5ELEA 1PRTD 2NTTA 1D6EC 1KLUD 1PTOD 1PZID 2IJ0A 1PZJD 1JWUD 4ZYSA 2AQ3B 1EFID 1JCKB 1LTGD 1SE3A 1BXTA 3BYYB 4RH6A 1XTCD 3C0NA 2IPKD 1PZKD 1LTRD 1F77A 1V1PA 3DWQA 1LT3D 2J4XA 4UDUC 1T5XD 1FGBD 1LT6D 1UUPA 3OWEB 1I4PA 2QEJC 1FNUA 3GP7A 2O2LD 1EU3A 4TSSA 4K6LA 1M4VA 4RGNA 3SEBA 3DWAA 1STEA 4DXGA 1JWSD 1TS5A 3TSSA 1D5XC 2ICIA 1MD2D 1FD7D 1L0XB 1D5MC 1S5DD 3CHBD 1SJED 3C0OA 1XXGA 1TY0A 1PTOH 3R2IA 1LT4D 4RCOA 3KLSX 1D5ZC 4RHSA 3EA6A 1V1OA 1RD9D 1CT1D 3G4OA 1HXYD 3BVMA 1LTTD 2R61A 5D3DA 1SXTA 5ELFA 3BYTB 1LTSD 1RCVD 3BVZA 1FNVA 1RDPD 1CQVA 4C56C 1S5ED 4O1NA 1EWCA
chains in the Genus database with same CATH superfamily
3I8ZA 5C0XG 3K0XA 1PH2A 2PW7A 2FFKB 4C3IH 4CJ1B 2HHHL 2CFMA 5GAEC 1PA6A 5JEAG 1A15A 5C3EH 4A3IB 1E24A 4DA2A 4GNXA 2R92G 1CI3M 4CJ2C 3K57A 4NP5A 4CHTB 1YHAA 3A7AB 1LTID 1O7LA 5E7NA 1ICFB 2AQ2B 2EY5A 2ZJRA 1AH9A 4ZLTF 3H6MA 4R4TA 1L0WA 3QOJA 1HZAA 5EBCA 1CZWA 1UAPA 5FKAC 4JI7Q 1BVSA 2FJ2A 1ENFA 3G4NA 1IBKL 1Y14B 4GKKL 3AMUA 4HSPA 2Z6KA 3UI2A 1PTOC 2VQFQ 1KXLA 1L1OA 2CH4A 2DJGC 1JICA 1I6HH 2F0UA 2UXBL 4POGA 2CWAA 3IFTA 4X3TA 2F4VL 1QVFA 4YCVA 1PREA 3RZDH 3R8BA 3S1RB 1G2TA 4YWLA 3WDNA 1S40A 2C9OA 1AN8A 1EEFD 3S2HH 4FNFA 5TSSA 2NVTH 3W1GA 1GHKA 3K7AB 1B1ZA 2QEXA 1I4QA 3P20A 3TZUA 2VW9A 1F9PA 2E5LQ 2MFIA 1STAA 1KLUD 2FXQA 2G5DA 2BOSA 2IY5B 1JCKB 4ABNA 1B9NA 3Q22A 1KAAA 4HIDA 5KYLA 3QOLA 2I5MX 3JAML 4OEMB 2EDGA 1HNXQ 1GUNA 3AU7A 5C0XH 4DPGA 2F03A 3PO3B 2PQAB 3K5NA 2J4XA 3M4OH 3CU7A 2OF1A 3U58A 1G6ZA 3S1MH 3QJYA 2R92H 3DXJC 4LW1A 4BBSB 1RTOA 4P2CB 3RD4A 1NSNS 4R4CA 4DAYA 4QUCA 5CORA 2B3GA 1JB7A 2IX0A 2H4OA 4HEDA 4RHSA 4OIJA 2O5JC 4DR6L 4AYBB 1BQQT 5ELFA 4LFAQ 5DM63 3WOFA 1BO0A 1WJJA 1Y8NB 2I5HA 1PLFA 1C9OA 4MNOA 5CC4A 4JI6Q 1K83H 5CV7A 2EY2A 1ONLA 4HCEA 2IW3A 1I3QB 2QDLA 4TQUS 3K6OA 2F3IA 4KHPQ 4DV0Q 3PQIA 3SDZA 3J81j 4OGQC 3V2TA 1ILQA 3T1YL 1OXSC 1N33L 1VQEA 2EJGC 1DD2A 1SE8A 3KDFA 4BA2I 3PV0A 4HIOA 3GTOB 1AE3A 5D65A 1JOKA 5I6YA 2DUDA 3BZDB 3DHQA 1RF2D 4A3IG 1VQBA 3HG9A 1JJCB 1W3SA 1PV4A 2R93B 3HOWB 5JJKA 3IAYA 1H9KA 1SMYC 2MO1A 5HGQA 1TY2A 4QJFA 4RKLA 4RGMA 5GAHC 2B39A 1IBLQ 2J7ZA 3I2ZA 1N8RC 4K14A 2UUBQ 3I70A 1FJGL 1U4LA 3D4RA 3QR8A 2PMZE 4UPAA 1PZID 1PZJD 1IYUA 1YIJA 5F2DA 3L2PA 1XMQQ 2B63B 3A55A 1EWIA 4LF7Q 1A6XA 1HNWL 4NPSA 4AH6A 1KQSA 4LUVA 2LXKA 1YNNC 1EY7A 3MWYW 4DR5L 2E2HB 3TBIB 3M3YH 4PV1C 4H02A 4JPBW 4R8NA 5GQOA 1OXVA 4KI0A 2DNCA 1FD7D 4XQNA 1XPOA 4NXMQ 4DKAC 4X64L 2F0HA 4IO9A 1YEZA 4YHHL 3S15B 1KNEA 3PO3G 3NELA 1QCBD 4A3IH 2EVBA 2KHJA 4BBSG 4DR1Q 4B3SQ 1Q86C 2ZTCA 2VQEQ 3OTOL 1I6VC 1NCVA 4QUFA 1GHJA 2K5HA 4JOIC 1KRSA 1GUSA 3W1BA 1I4RA 1QOHA 1ET6A 3HOUH 2QCPX 1XPUA 1NBWA 1F2MA 3L9AX 4DV4L 1DONA 1JOOA 4AYBG 2HHHQ 3TQYA 3T1HL 1J6QA 3MC0B 4HMIA 1BDOA 4EX5A 3I7FA 1XNRL 3PO2B 1K0SA 2DJFC 1D1KA 2Z0SA 4KN4C 1YNXA 1SE2A 2VY3A 3CAMA 4BY1B 5C0XI 3S1RH 1HPCA 2MPMA 2WAQB 3K81C 5FK9C 4A3DB 3LWEA 3PIPA 4GKJL 4J1MA 1H9MA 2LS01 5IOCA 3GQBA 2UXDL 4DV6Q 4E6IA 3A0JA 2XIWA 1HFNA 2N8NA 3EQLC 1K8GA 1QB5D 4IOAA 2F4VQ 3FRPB 3A74A 1L1OB 2N3SA 5K36H 3T16A 4UHVA 1HZCA 5I4DA 3PO3H 5IT9L 1NR2A 1WD1A 1A0IA 2JA8B 2PI2A 4NB3A 1HUMA 2R93G 3HOWG 2WB1B 3B6YA 4ZAIA 3VYRA 2WKDA 2M2LA 4L5TA 5FLMG 4QL5A 1SNMA 1XTCD 1B50A 3UDFA 1JJ2A 2BH2A 1I50B 4LF8L 4Y7NB 1VF5C 1YJWA 4YY3Q 2JYOA 1LT6D 2BDOA 3GP7A 1VQDA 1X6OA 4A3KB 3GTKB 3M4QA 4DV2Q 4IUPA 3A5ZB 2K52A 1L0XB 2KCNA 2O5IC 4A75A 2B63G 1RHPA 3A7LA 1LT4D 3NBHA 1Z47A 5FJ8H 2D62A 4C1NK 4JI4Q 1JE4A 1I3QH 2CCZA 5DLQE 1SXTA 3KJOA 1SNPA 4A76A 1O7YA 4DNIA 5DEHA 3MA2B 4BY7B 1PFSA 5K5PA 3OMCA 3W3AA 1N34Q 5CV5A 4B9XA 1BCPC 2A68D 4AQYL 2CKZB 3GTOH 5C4JB 1VQ8A 3H15A 5ELNA 1HTPA 3OHXC 4Q5VA 3BJUA 1JR0D 1TQOA 2CHBD 2XWBB 4NDXA 4ZUJA 2RDGA 1LV9A 2R93H 3HOWH 1V8QA 3Q23A 5LMUL 1VQLA 4KKSA 1KLGD 1VCIA 1TWCB 5FLMH 3T1YQ 1XX8A 1YJ9A 1N33Q 5GAGC 4DR4L 4FDBA 4ME3A 1IW7D 3I4OA 4LF6Q 1EY5A 2L55A 1Q90A 3JC66 3KDFB 4TKOB 3PO2G 4IN3A 2RSNA 1Z52A 3U4ZA 3P7JA 3BDCA 4BY1G 5EKKA 2ID0A 4A93H 3STBD 2Z4HA 2WAQG 5BN5A 2R7DA 2B2TA 1I94L 4A3DG 5EQ0A 4GOPC 1PHJA 1WCMB 5IYCG 2KHIA 3E6ZX 3H0GB 5BR8Q 4KLKA 3NSWA 5COYA 5CV4A 3IKJA 3PUZA 1CTMA 1SE3A 4GN4B 1HCZA 1FJGQ 1ML0D 1PXUA 3SK5A 1F77A 4DK0A 1VQ5A 1VMCA 5IGCA 4HMJA 4I7ZC 2Z1CA 3R3OA 5EBDA 1AP0A 4C1NI 5H1SE 2JA8G 2WINB 2L1BA 4QCLA 3KUPA 2WB1G 4DR5Q 1LACA 2CQAA 2ZJPA 3CHBD 1VS0A 2JE6I 5IGGA 4RCOA 5JOBA 3FKIB 1G2SA 2MQHA 3G71A 2NVTB 2JN4A 4X64Q 4DV3Q 2IX3A 4OWXB 3AYHB 1NUCA 2H1EA 4K8JA 5E4XA 3VYTA 5C4ZA 4A3KG 1SRUA 4AYBE 1M1KC 1WTPA 1TKWB 1A2UA 3AB9A 1NTGA 2E2IH 1PH6A 1NNXA 3PO2H 2J0TD 1N9WA 1YI2A 4BY1H 3FP9A 5D3IB 2R3ZA 2LXJA 1EYDA 2HIXA 3OTOQ 4A3DH 3NPPA 2CW0C 4BXXH 4KY7A 1QNUA 3SK8A 3C0MA 1IYJB 1A8VA 4K5VA 1G51A 2GVBA 4DAPA 4AIMA 4A4IA 2D0OA 4BY7G 2JEAI 1YHQA 2AQ1B 3GTQB 5D14A 1Y8PB 2FMMA 1B8AA 3E0JA 3X3MA 1PRTC 2ZTEA 1XNRQ 2CVRA 3ITPA 1IYVA 3NEMA 2F0GA 2AWOA 4DNTB 3KJPA 1JE5A 4O0AA 1EY4A 1R9TB 1D8LA 1LTBD 1HQRD 1PH4A 3GV3A 2NVXB 4LF9L 2K28A 1K83B 1TS3A 3GD7A 2AUKA 4RMFA 3VR2A 3HOYH 2YTVA 1GXDC 3V96A 1I50H 4PG3A 3PGZA 3K0YA 3J81E 1YHBA 3PUYA 2RQXA 5J1ZA 1PTOD 2EYHA 2KBNA 1EL0A 1JWUD 1EYAA 4JCVE 1VQIA 1IL8A 1RL2A 2Q2IA 4QF4A 1F2ZA 2A69C 3DEPA 1Y1WB 4S3SA 3GTKH 1PZKD 1X65A 4C3HB 4XYOA 1BBXC 1E2WA 1Z6HA 2A19A 2BDNA 4FXGC 1IBML 3S17B 1WOCA 4ILWA 4A3GH 2MJ8A 4OWWB 1WCMG 5C0XJ 4LFBQ 3H0GG 1F9QA 1AE2A 3SEBA 1STEA 5G3LD 5C5LA 4M1UB 1Q8KA 1JWSD 1MD2D 1DOMA 2L15A 3PF4A 2D9UA 3MAQA 3FPUB 1PTOH 1AEXA 3HS0C 5GROA 4DUYL 3MVVA 1X32A 2L9HA 2ES2A 1W2BA 4KV6A 3AEVA 3L3OC 4UP7A 5C4JH 4N9TA 3I56A 1G6PA 2LSSA 3QWNA 3KOJA 2Z4IA 3I4NB 5EAYA 1PRTF 3BDLA 1ET9A 4IPGA 3HOXH 1TWCH 3A54A 3FKIG 3CCUA 2L5TA 4X6AH 4KHVA 2RBMA 1STBA 4ZKCB 1DOLA 2F0TA 2B2VC 5E4WC 1KD1C 2KQ3A 4HTHA 3MHBA 1EU4A 4GN3B 1WVLA 5JVG3 2OCEA 2R7ZH 4DF7A 5ELDA 1SDFA 1LO5D 2RSOA 3Q24A 1NMGA 1PYWD 1OTCA 1EY0A 2HT1A 2WAQE 1FR3A 1UE6A 1WCMH 2F0KA 3UE0A 1S5CD 2K5DA 3H0GH 4N9PA 4DR4Q 1J8IA 2K1BA 3J80L 5M5WB 2KCCA 3E5SA 4DR2Q 1HNZL 5KRUA 1UEAB 1S3OA 3EIVA 3WOEA 4WJWA 3LWUA 5IWAQ 5M5XH 2UU9L 3S9WA 2YV5A 2B8GA 1WTRA 3D4DA 3HOUB 2VL6A 2QF7A 4X66L 2F0PA 1MJCA 1RKNA 2LFNA 5BN4A 4JI5Q 1KIXA 4G7ZC 4R9WA 2RHQB 5JJLA 1STNA 3AFQA 3NP8A 2WB1E 1V9PA 4IUNA 1SMYD 4NXNL 1H9SB 2F3WA 4L8JA 1MHWC 1X3QA 3C3LA 2B2VA 4TSSA 3FKIH 3CF5A 2JXMB 5C3WA 2FHTA 3M4YA 4YCUA 3CP0A 2ALYB 4H13C 2KOLA 2X6LA 1D5XC 1ZYRC 3Q8DA 3GTLH 4IUVA 2E2DC 1NJIC 3S1QH 3EN2A 4CDEC 4JI3L 1Y1WG 5JPNC 4C3HG 1C4QA 4P72A 4GN5A 2EY1A 4EQ5A 2PPBC 2PNHA 1H9RA 2JK8A 3KYHC 4KN7C 5D3DA 5HY6A 1YNND 3NWSA 1VQGA 4IPCA 3FMCA 4BWGB 5IGFA 1SNDA 1E2VA 1ILPA 1U5KA 1XNQQ 4R4OA 3R2TA 3WWVA 1BR9A 3GTQH 4LAAA 1LLRD 2DY8A 3I4MH 2RKSA 3N52A 4HN7A 2I46A 4X65L 3RMHA 1TWHH 3J81L 2B29A 1CQFA 4G4KA 4KTAA 4K5XA 2JA7B 1B53A 4MHEA 2XN9C 4OL7A 1R9TH 5J22A 5J3BA 3TREA 4DR7L 3I4NG 2NVXH 3CC7A 5DAUA 1CKNA 4JYAL 3SK4A 1H95A 2UUAQ 4HCSA 3ULLA 3F1ZA 4RKBA 4X3KA 2RDHA 4L63B 1A3TA 1O7IA 1PTOF 1MI2A 1KABA 1TS2A 2K6AA 4GLVB 1J5EL 4DUZL 1B70B 4M8AA 2UXCQ 3KLWA 1X3FA 1U4MA 1E1TA 4FF3A 1M90C 2EY6A 3GV6A 2IL8A 2Z8LA 4DK3C 1Y1WH 4IJHA 4C3HH 3L0OA 4EQNA 5M3FB 3S17H 2DN8A 4LF9Q 4XDXA 1Q1EA 1S4ZA 1WFQA 1E3PA 1YZ6A 1A63A 2KCTA 2RDFA 5G3LF 1EFID 1STHA 4J15A 4X3SA 4YIJA 3C46A 3TZDA 2ENBA 2K5VA 4JI0L 4X62L 3CXCA 3F2BA 1VQ7A 1V1PA 2Q2HA 4QB4A 4DV1Q 5LHY1 3GTGH 4LJZC 4ALPA 1QWYA 4IQZA 2K75A 2OTLA 5EKLA 1FNUA 3HOUG 3CCRA 2UUCQ 5IGBA 4DXGA 2K33A 2MHVA 2BH8A 2L0CA 4CDDC 3NQTA 2IT1A 1K8OA 3IFDA 4UY8C 4F87A 1AZPA 4U673 1CA5A 3I4NH 1W6JA 4A93B 3KF6A 3SGIA 2SNSA 3NENA 4KY5A 2Q8TA 2NZHA 4OWTB 2E74C 4XT1B 4DUYQ 3P75A 1TR5A 2E76C 1S5ED 3VA7A 2EYJA 3GDEA 2K05A 1EEID 4A3JB 3NXWA 3M7GA 2PZUA 2XSCA 3BS1A 1GO3E 1TWFB 1NR4A 2KA7A 4IURA 5IT9c 3PUXA 3N6RA 5K36G 1HR0L 3RNUA 3TP6A 1DZ1A 1KDAA 2AHOB 3RN5A 3ULJA 1J9OA 3HFZB 5M5WH 4MTNA 1K28A 2OXPA 2BCOA 3KF8A 3ER0A 5LL6S 2NVYH 4RWSC 3S14H 2K14A 3C1EA 4LFCL 1SYFA 1ICWA 1BCPD 4G7OC 5E1FA 1B44D 1GUTA 2SDFA 4HJ5A 4IUQA 4K2LA 2R7FA 1PFMA 2JA7G 4KJOA 4H0LC 3D6WA 3RZOH 4KK7A 1VQAA 1HA5A 2XRSD 3G4SA 3TS0A 4IPHA 2E2IB 3H94A 4DV5L 1N36L 2HIVA 2DGYA 2Z9HA 5KNBA 2ZXPA 4DXFA 1VQ9A 1NMFA 5FJ8G 3SR1A 4GNXB 1MSHA 2UU9Q 2FINB 2AQ3B 1B3QA 4PZ6A 3FHWA 3BYYB 4G7HC 4FF4A 1IBKQ 3U9SA 3TS2A 4K8IA 4GKKQ 2ZM6L 2A5HA 2UXBQ 1QVCA 1GVPA 1EIHA 5M3FG 3Q0AA 4LF5L 1M4VA 4YCWA 1SFOB 4NXNQ 5LMNL 1QJOA 1TS5A 2H5XA 4DNRB 4QQBX 3DMUA 3H3VH 4Q0FA 1SJED 3IL8A 2PYKA 4C2MH 3I55A 2BE5C 4JOIA 3RLOA 4ZCKA 2ATWA 3EA6A 1VQHA 3HOYB 3HKZB 1PH9A 1CA6A 1HR0W 1STYA 1Q46A 3ZJYC 3BYTB 4CKEA 4DR3L 3F2UA 3J7A5 1BNZA 1EIYB 3QG1A 2JA7H 3T53B 4PMCA 2D5DA 1VQOA 4NMZA 2VNUD 1WTVA 1A2TA 2EXDA 1LT5D 3EJIA 4XXEA 4DV7L 4KKTA 3C1FA 1HQMC 4NW2A 4A93G 4LWCA 3CMEA 4A3GB 4PZ7A 1MGSA 3PIP3 1XYIA 2JQOA 1STGA 2F0WA 3M85A 3DM3A 2D0PA 3PIOA 4IALA 3MFYA 3CCEA 2F0IA 1JOQA 3W2DA 5M3MB 4A3FH 2EZVA 4DAYB 3SVMA 4A3JG 4JV5L 1B7YB 3I73A 5T1IA 1XMOL 4DR6Q 2OWOA 1PTOB 1SYBA 3U9OA 1CHPD 3URYA 4J6HA 4BBRB 4B3TL 5M3FH 2Q2UA 4DFAA 4ME5A 1C7YA 1HTLD 3E9IA 5ISRA 1ZEQX 2QILA 1VQ4A 2K01A 1K3BC 2MUYA 5CBAE 1CKNB 3HOZB 3E9HA 1SNQA 3KFUA 3ND8A 3BZCA 3DLLA 3TP5A 5C3XA 3K80C 1SYCA 5ELCA 3HOXB 1PH8A 2MGSA 4B08A 2F4IA 1PRTD 1A62A 4WRDA 4YWMA 3CCSA 1SROA 1D6EC 1LTLA 4FXKC 3GTPB 1EYCA 2OT2A 4ZYSA 1LTGD 5C4HA 5LMNW 2N49A 3QIAA 3TMEA 2K5WA 5JJZA 2IPKD 4JI1L 3TEHB 1PH7A 3CQZB 1KC8C 3FPPA 4LF4L 2R7ZB 5EPJA 2KUMA 2OQ0A 5KIXA 2JJQA 4UDUC 2EYMA 2DNEA 2IHFA 3LX0A 4YWKA 3S24A 1UE5A 2O2LD 2MNAA 1PH3A 4LUOA 4BXXG 2VZAA 2EYLA 3D0FA 3TSSA 2ICIA 1N32L 3FEWX 1S5DD 3AQQA 5FO9B 4CDFC 4APVA 1PDQA 3A8IE 1MSGA 1Y8OB 4JBWA 2A69D 5M5XB 4A3JH 1VMPA 1G91A 1OXUA 2E8GA 1TWFH 4JI7L 1QNKA 2XTIA 1HXYD 4WORA 5I6WA 4O42A 2VQFL 4CDCC 3CCMA 1SAPA 4A3LG 1HNWQ 5FLXc 3K5LA 2ZTDA 1UNSA 2RF4A 2IWHA 3KF6B 4A3EB 5KEEA 3PUWA 1X56A 3F8TA 2SEBD 1IHZA 5IIFA 1ESFA 1S5FD 1BCPF 2F0OA 4L6TB 3T51B 3PCOB 3HKZG 3HOYG 1FYCA 3S1NH 1E2ZA 2PW5A 2WKCA 2IHEA 2VB2X 2TMPA 2E5LL 1JC7A 2L4NA 3UE1A 4WJ3M 4YHHQ 1GD7A 3GTLB 2HD3A 1CM9A 1E22A 1MIUA 3S1QB 2PQAA 3MZ5A 4B3ML 4GLXA 2F0SA 1HNXL 4GOPA 2YU9H 1I4GA 3Q6SA 4A3GG 2OEOA 2IX1A 3K58A 2K5QA 3O13A 4ZRZA 3D3RA 4XQQA 4KMUC 5ELBA 1G291 5AFWA 3H3VI 4QGUA 3CKIB 5M3MG 1K0RA 1K8AC 1SR3A 1K3RA 3KF8B 5A2QE 3NE5B 4DV4Q 1TWGB 3T1HQ 3ERSX 4HJ7A 1GUOA 4QIWB 4BBRG 3I4MB 3GO5A 3OMGA 4DV5Q 4IOCA 1TWHB 2I07B 3VA5A 3M7NA 2NZOA 1KL9A 2EYPA 4C3JH 1SFOH 4LFAL 4JBKA 4A3LH 3C0NA 3J80i 4GKJQ 5IP7H 3HP3A 1U4PA 3HOZG 2K50A 2UXDQ 1T5XD 1BUVT 1FGBD 2K4KA 3HOXG 1NAPA 2BA0A 4K6LA 4RGNA 2GA4B 1T9HA 4KHPL 4DV0L 1MBYA 1M8AA 1Q8IA 1PH1A 3CCJA 4LF5Q 2HQLA 1VQ6A 1F2YA 1WYDA 5LMNQ 3RLFA 2JEBI 4UAIA 2R7ZG 3KLSX 2C35B 4JW0A 4IPDA 1E0BA 2WIIB 3BVMA 1LTTD 4H44C 4I7AA 1CKMA 1TU2B 2XVSA 3PF5A 2OQKA 4B3RL 1CSQA 1RCVD 4XTCS 1CQVA 4P75A 1WTHA 4GLAC 1RJTA 5L37A 3IRBA 4LF8Q 3CRLC 1SNOA 1HZBA 2NTSA 5M3MH 4OELB 1ZYRD 4V0BA 5KYIA 1EUJA 4PNYA 1YITA 4JI2L 4RFBA 4JBJA 2X6GA 3GTGB 5EPLA 1VQPA 3D6CA 1DCZA 3NTIA 1HH2P 3OW7A 1DGSA 1IBLL 5AJ3L 3VR6A 3RR5A 3JAMi 4POFA 4BBRH 2UUBL 3TP7A 3CPWA 2JSOA 3DM1A 5C5MA 1EOVA 1Z7TA 1BBUA 1YNJC 3HZXA 1CK1A 2RCFA 4A3EG 1XMQL 1L0YB 4HJ9A 3HOZH 1HJPA 4OONA 5IYBG 4LF7L 3NBHB 4ODGA 4CBVA 4DU9A 3K5OA 1C0AA 1SEBD 2WP8J 3GTPH 1Q7YC 1TS4A 4O2DA 4KY6A 4AQYQ 4OX9L 1CHQD 4WJ4A 1QVGA 3VYUA 3SXHA 2Z6KC 2KEEA 3CQZH 3JAMc 1L1OC 2K7VA 3F2CA 2G9DA 2WACA 2HCCA 3G48A 2NTTA 2JA9A 4A3MH 4LK1C 5LMUQ 5IYDG 1PVOA 4DR1L 4B3SL 5EGTA 3HEJA 2GVAA 1LUZA 4ZQ3A 2M9VA 5GADC 4IUTA 2VQEL 5IGDA 4TRDA 2AWNA 2JA5B 1MJEA 3S14B 2NVYB 4JI1Q 2A1AA 4BA1I 2QEJC 4KJNA 3I4MG 3BU2A 3C2PA 4FP5D 4FXDA 3BDOA 2KJXA 1F2LA 4OXPA 1WD0A 1A3VA 1ENCA 3QB3A 1EZ6A 2B2UC 3RZOB 1I94Q 4IFDJ 1PYBA 3T56B 2CQOA 4A3EH 1N32Q 3M4PA 5IYBH 3G4OA 5CYUA 3PSIA 1LTSD 3BVZA 3NQIA 1RDPD 3HKZE 3UDGA 4DV6L 1GM5A 3VR5A 1BCPB 4P73A 5M5YH 1EZ8A 3MXNA 3PUVA 3ICEA 4N8FA 4KHZA 5A2QL 2EOTA 1SJHD 4Z9CB 2ZXRA 1EY6A 4Y52H 1II3A 2G9HD 2YTYA 3H91A 3VR3A 1FNWA 2HDMA 1HFGA 5IYDH 4HJAA 1EQRA 4MN3A 4CGYB 2NWGA 4B9WA 4V190 2O4XA 4C2MB 4F7XA 4RGTA 3CCLA 2TSSA 3RN2A 5EJWA 1TWGH 1I4HA 3H09A 4YY3L 2B2UA 1DJRD 1IZ6A 4B3MQ 1SLJA 1EFWA 2E2JB 1IKLA 4XIGS 3BG3A 4IFDG 2Q2TA 3EFXD 3F2DA 1F9SA 2NN6G 4DV2L 3OOCA 5JEAH 4LMQD 4GOPB 2V1CC 3A8KE 3E0EA 1SE4A 1H9JA 1PFBA 1UE1A 2A6HC 4EQPA 4JI4L 2F52A 3J7AF 2SOBA 4MTKA 1X3EA 4K6DA 1IKMA 1R4QB 4JI8L 2Y0SB 1DOKA 2A6EC 5IT9E 4A3FB 2PCFB 5FOBB 1LTRD 1EIGA 3CC2A 3G7LA 2Q8IB 1EY9A 3VR4A 1QZHA 1N34L 5M9OA 3DUZA 1LT3D 3KK7A 5IGEA 3U4VA 1C8CA 1UUPA 2C5CA 1I4PA 3OPOA 1U0LA 4EGVA 2VUMB 4K2KA 1BOSA 3ZYYX 3TRZA 2F3VA 1D5MC 3FVQA 3HOVB 3OSOA 1IXRA 1TY0A 3J7YW 2B8FA 2GN5A 5A35A 4R1JA 3D4WA 1D5ZC 2JA5G 1JJGA 1Q82C 1V1OA 1Q12A 4J8QA 3CCQA 3BZKA 5KGUA 3LNNA 1FNVA 1PH5A 3NUCA 4LF6L 2YYZA 3OIPA 4U68A 2ICEC 1EWCA 5HGTA 1IBMQ 1Q3LA 1XTDA 1TXYA 1VF7A 1GOZA 4B3RQ 4IFDH 3I91A 2NN6H 1ESRA 1Y1VB 1EOTA 3LGJA 1WTWA 2BE5D 2N78A 5IODA 4FF1A 2ZT9C 1B3AA 3SHLA 3RUZA 4JI2Q 4BS9A 1EQTA 3S2DB 1KDCA 1EWHA 5BR8L 1G8ZD 2HDLA 2L11A 3M9BA 3SK6A 5AJ3Q 2QDBA 1PRTB 5E3FA 4WFN3 1OXXK 2K32A 4OIKA 4UP9A 4CKBA 1EYGA 4JG2A 2F0EA 1B4OA 1QUQA 4DN4M 1FGUA 1GUGA 3J7ZC 5CMDA 5I2YA 2KHSA 1F9RA 2JP1A 2NBFA 1LTAD 1PMRA 3S16H 1X54A 4PMWA 1KRTA 3GTJB 3OYYA 1K8MA 2B2WC 4JC0A 4K0KL 4R4IA 4L5RC 2YTXA 4RG1A 2MO0A 4R4QA 3KLRA 1VQCA 2XGTA 5ELEA 4RCNA 4OX9Q 2JA5H 4FVMA 1X3GA 4F8MA 1SN8A 3S1NB 1SYEA 1T5EA 4DV3L 3E3XA 4QIWE 3T13A 1BXTA 3MEFA 2ZXOA 4PQXA 2EIFA 5I9OA 1OXTA 2JA6B 3I3CA 4A3BB 2L12A 1P16A 2YU9B 1B9MA 2VXWA 1R4PB 1UWVA 2PQEA 1SNCA 1VQFA 3PMFA 1Y69U 3KLSA 4LNQA 1HNZQ 2KECA 2A8VA 2PZTA 2Z6BA 4TVAB 1YVCA 1KDBA 2Y0SG 1HUNA 3ULPA 4A3FG 3C0OA 3R2IA 1VDZA 4HIKA 2EQSA 3NK9A 4FO2A 3G6JB 3NHHA 2P5ZX 3MEHA 4X66Q 1GUWA 4IUUA 2EPBA 3L7ZC 1VQJA 3W5OA 2VUMG 1FVIA 2B2WA 1TWAB 3DWPA 2FMCA 2QW7A 1WI5A 1QILA 2AKWB 4L5QA 4C3JB 3HOVG 2EJFC 2PI2E 1W6KA 1JWMD 1Q1BA 2K04A 1WTQA 2VS1A 1QZGA 3K7AH 2M00A 4HR7B 2RCNA 3EROA 1JQYD 1SBBB 1O78A 3CRKC 3MXGA 5DM73 1BBWA 2V4DA 4L5SA 1QG7A 2KVMA 2F0NA 2HUGA 3K5MA 2AMCB 2K5NA 4JI3Q 5KNCA 1K9MC 3MXNB 2E2JH 1A3UA 2LKVA 5C6AA 4CKCA 4PZ8A 4FF2A 2CH4W 1UE7A 1CKOA 1DYQA 1Y1VG 2VB3X 4G57A 1AW7A 4BBSH 2XWJB 1K73C 5C4XB 3EBEA 1U4RA 4RGOS 4LFBL 1C48A 5J39A 2QA4A 4P74A 3A56A 1XJVA 1TT2A 3I90A 1LABA 4HAEA 2XNAC 3MTSA 4X65Q 1V43A 4RHRA 3CCVA 1GKHA 5JPMC 1TVXA 3CPFA 3I4LA 5T1GA 5FLXE 3EVQA 3A5UA 4DR7Q 2VUMH 2HQEA 2F0VA 4IFDI 4JYAQ 2WFWA 2NN6I 1QE6A 2CW0D 2N88A 2B2TC 2CWPA 3HOVH 3DWQA 3GTMB 2NVQB 4JI8Q 4PMBA 1VQMA 4IJLA 4OO1G 1J5EQ 4DUZQ 4R8IA 5JJIA 3X3NA 1JT8A 2F0DA 1U9RA 1SSOA 5HURA 2QKIC 1ASZA 3CMAA 3D31A 5C44B 2KCMA 4ZKBB 4LUZA 2A74C 3MXPA 2JA6G 4A3BG 4MIUA 1EIFA 1Y1VH 1RD9D 4ULLA 1D2BA 1CT1D 4JI0Q 2PZWA 4RA8A 4X62Q 4A3MB 4H7BA 4JBMA 4O1NA 3H3VC 3PIO3 3S2DH 1AFPA 2WV6D 5CR3A 1HZ9A 4DR2L 4KKUA 1JMCA 4K5WA 1V1PB 5DNFA 5IWAL 5EKIA 4KD4A 3D8GA 4OHJA 4KD3A 4F88A 4JK1C 4XYQA 1IL2A 2NUCA 2EYOA 2F0QA 2B63H 1Q81C 4C3IB 1EQVA 3HRZC 4CJ0B 3P1HA 5CV9A 3TP8A 4C3JG 4JI5L 1HA6A 5C3EB 3GTJH 1RIPA 4P71A 2RA4A 1I4XA 1H9SA 1L2FA 1ZXTA 5IP7G 1EY8A 5FO8B 2E2HH 3ONAB 1NY4A 3NTHA 1YJNA 2SNMA 2XRQD 1O80A 1GJXA 4I65A 4OO1H 2BA1A 4QMGA 1Z9FA 1V1QA 4EVOA 1S5BD 3K7UC 4MZ9A 1YBYA 1S72A 4HIMA 3S15H 2R6GA 2PNRC 4N8X1 1HR0Q 5M5YB 2E75C 1QUQB 1DM0B 2PMZB 2I0QA 1I6HB 2LMCB 1SYDA 1KNAA 2D2CC 4EQOA 1YNJD 3J80E 2JA6H 4K0KQ 4A3BH 4ZUIA 3RZDB 5C4XG 2RHSB 3S2HB 4RH6A 1VQNA 3UDXA 3G6EA 5FO7B 3NWTA 4LFCQ 3I72A 4XT3B 2Y0SE 5BN3A 1XNQL 5CGKA 3OW2A 4JVZA 2X69A 1JB3A 1EU3A 4QY7A 1WTXA 2F0LA 5JVH3 4ID6A 1LM0A 2A68C 1N36Q 1D7QA 1CFMA 1TWAH 3M4OB 2NYZD 1LYLA 4NKLA 5IYCH 3S1MB 1PYSB 2R92B 4GS3A 5LL6X 1CZGA 1X9NA 4JI6L 5IP9G 4HJ8A 2UUAL 1CUKA 1UEBA 4DGZA 1B2TA 4A3CG 5IY0A 2ZM6Q 5CV8A 4DK6C 1DXMA 2KENA 3JAME 1HRJA 1EQQA 4FYDA 4RAUC 1D1IA 3HGBA 3K8AA 5C44G 1IW7C 3NBIA 2UXCL 1CSPA 2RVLA 1HHVA 2NB0A 2JA8H 3UDIA 3MFGA 1BF4A 2I5LX 2HCIA 1FL0A 1XWEA 3A8JE 2ASBA 1OO9B 3QO2A 5FLXL 4A3MG 1KTKA 1X3PA 3STBC 5C4XH 4ZK9B 3AFPA 1BKBA 3OIQA 2EXZA 3J80c 3OWFA 3CD6A 4HSVA 2N55A 3NTKA 3BVGA 2Q8RE 3CC4A 4Y7NH 1E1OA 2F1MA 3K59A 1ENAA 1MKHA 2EYFA 1RTNA 3ERQA 4DV1L 4DR3Q 5EPKA 3V05A 4A3KH 1ASYA 1JORA 4XQJA 2B2YC 5I9PA 1E7ZA 3SE0A 2UUCL 3R93A 4GZYC 2EE1A 4C3IG 2ZJQA 2F0JA 4DV7Q 1ZKOA 2A73B 5C3EG 1AZQA 4IZ8A 2OTJA 4DAMA 3RLNA 5JEAJ 5CV6A 3GTMH 2K03A 5NUCA 1XPRA 2NVQH 2DY7A 4DAVA 4GNXC 3ND9A 2IJ0A 1I5FA 1X55A 5IP9H 4BY7H 1SMXA 1KAWA 3HKSA 5KNDA 4JV5Q 1XMOQ 4A3CH 1RODA 3FDTA 1TIID 3KBXA 3TDQA 5IE8A 3J81i 5I2XA 4B3TQ 1WTOA 1VQKA 1NE3A 5C44H 2EJMA 3OWEB 3J7AV 3VYSA 4NXML 3TN2A 3VDYA 1P8LA 3DWAA 5CBEE 2A6HD 3S16B 2LY7A 4UP8A 1XXGA 2AUJD 2QGQA 2PO4A 1SYGA 5JAVA 3CW2C 2NZ1D 2MP1A 2A6ED 4X3UA 3U50C 3M3YB 2F0MA 3DEOA 2B2YA 4OO1I 2KEDA 2R61A 3MXUA 3T4AC 4DK1A 5ELOA 2F0FA 1PFNA 1O7ZA 1KHIA 4C56C 3J81c 3KBGA 4LF4Q
chains in the Genus database with same CATH topology
3I8ZA 5C0XG 2PW7A 2FFKB 4CJ1B 5JEAG 1A15A 4A3IB 4DA2A 1CI3M 4CJ2C 3K57A 4NP5A 4CHTB 3A7AB 1LTID 1O7LA 2AQ2B 2EY5A 4ZLTF 3H6MA 3QOJA 5EBCA 1CZWA 1UAPA 5FKAC 2FJ2A 1ENFA 3G4NA 3AMUA 4HSPA 3UI2A 1PTOC 1JICA 2F0UA 3IFTA 4X3TA 1PREA 3S1RB 3R8BA 1G2TA 3WDNA 2C9OA 1AN8A 1EEFD 4FNFA 5TSSA 1GHKA 3K7AB 1B1ZA 1I4QA 3P20A 3TZUA 1F9PA 1STAA 1KLUD 2BOSA 1JCKB 4ABNA 1B9NA 3Q22A 1KAAA 5KYLA 3QOLA 3JAML 2EDGA 1GUNA 3AU7A 5C0XH 2F03A 3PO3B 3K5NA 2J4XA 3CU7A 2OF1A 1G6ZA 3QJYA 3DXJC 4BBSB 1RTOA 4P2CB 3RD4A 1NSNS 4DAYA 4QUCA 5CORA 2IX0A 2H4OA 4HEDA 4RHSA 4OIJA 2O5JC 4AYBB 1BQQT 5ELFA 5DM63 3WOFA 1BO0A 1Y8NB 1PLFA 5CC4A 5CV7A 2EY2A 1ONLA 4HCEA 2IW3A 1I3QB 4TQUS 3K6OA 3SDZA 4OGQC 3V2TA 1ILQA 1OXSC 2EJGC 1DD2A 4BA2I 3PV0A 3GTOB 5D65A 1JOKA 5I6YA 3BZDB 3DHQA 1RF2D 3HG9A 2R93B 3HOWB 3IAYA 1H9KA 1SMYC 1TY2A 4RKLA 4RGMA 2B39A 2J7ZA 4K14A 3I70A 1U4LA 3D4RA 1PZID 1PZJD 1IYUA 5F2DA 2B63B 3A55A 1A6XA 1YNNC 1EY7A 3MWYW 2E2HB 3TBIB 4PV1C 4R8NA 1OXVA 4KI0A 2DNCA 1FD7D 4XQNA 2F0HA 3S15B 1KNEA 1QCBD 2EVBA 1I6VC 1NCVA 4QUFA 1GHJA 1GUSA 1I4RA 1QOHA 1ET6A 2QCPX 1F2MA 3L9AX 1DONA 1JOOA 3MC0B 4HMIA 1BDOA 3PO2B 1D1KA 4KN4C 1SE2A 4BY1B 5C0XI 1HPCA 2MPMA 2WAQB 5FK9C 4A3DB 3LWEA 4J1MA 1H9MA 2LS01 5IOCA 3GQBA 4E6IA 2XIWA 1HFNA 3EQLC 1QB5D 3FRPB 5K36H 3T16A 5I4DA 5IT9L 1NR2A 1WD1A 2JA8B 1HUMA 2WB1B 4ZAIA 3VYRA 2WKDA 2M2LA 1SNMA 1XTCD 1B50A 1I50B 4Y7NB 1VF5C 2JYOA 1LT6D 2BDOA 3GP7A 4A3KB 3GTKB 4IUPA 1L0XB 2KCNA 2O5IC 1RHPA 3A7LA 1LT4D 3NBHA 1Z47A 2D62A 4C1NK 1JE4A 1SXTA 1SNPA 1O7YA 5DEHA 3MA2B 4BY7B 5K5PA 3OMCA 3W3AA 5CV5A 4B9XA 1BCPC 2A68D 5C4JB 1HTPA 3OHXC 4Q5VA 1JR0D 1TQOA 2CHBD 2XWBB 4NDXA 4ZUJA 2RDGA 1LV9A 1V8QA 3Q23A 4KKSA 1KLGD 1VCIA 1TWCB 1XX8A 1IW7D 1EY5A 2L55A 1Q90A 4TKOB 4IN3A 2RSNA 1Z52A 3P7JA 3BDCA 5EKKA 2ID0A 2Z4HA 5BN5A 2B2TA 5EQ0A 1WCMB 3E6ZX 3H0GB 3NSWA 5COYA 5CV4A 3IKJA 3PUZA 1SE3A 1CTMA 1HCZA 1ML0D 1PXUA 3SK5A 1F77A 4DK0A 1VMCA 5IGCA 4HMJA 4I7ZC 2Z1CA 3R3OA 5EBDA 1AP0A 4C1NI 2WINB 2L1BA 4QCLA 3KUPA 1LACA 2CQAA 3CHBD 2JE6I 5IGGA 4RCOA 5JOBA 3FKIB 1G2SA 2NVTB 2IX3A 1NUCA 2H1EA 4K8JA 5E4XA 3VYTA 5C4ZA 1WTPA 1TKWB 1A2UA 3AB9A 2J0TD 5D3IB 2R3ZA 1EYDA 3NPPA 2CW0C 4KY7A 1QNUA 3SK8A 3C0MA 4K5VA 4DAPA 2JEAI 2AQ1B 3GTQB 5D14A 1Y8PB 2FMMA 3E0JA 3X3MA 1PRTC 2CVRA 3ITPA 1IYVA 2F0GA 2AWOA 4DNTB 1EY4A 1R9TB 1LTBD 1HQRD 3GV3A 2NVXB 2K28A 1K83B 1TS3A 3GD7A 2AUKA 3VR2A 1GXDC 3V96A 3J81E 3K0YA 3PUYA 5J1ZA 2RQXA 1PTOD 2EYHA 1EL0A 1JWUD 1EYAA 1IL8A 4QF4A 1F2ZA 2A69C 3DEPA 1Y1WB 4S3SA 1PZKD 4C3HB 4XYOA 1BBXC 1E2WA 1Z6HA 2BDNA 4FXGC 3S17B 4ILWA 2MJ8A 5C0XJ 1F9QA 3SEBA 1STEA 5G3LD 5C5LA 4M1UB 1JWSD 1MD2D 1DOMA 2D9UA 3MAQA 3FPUB 1PTOH 1AEXA 3HS0C 3MVVA 1X32A 2L9HA 4KV6A 3L3OC 4N9TA 3QWNA 2Z4IA 3I4NB 1PRTF 3BDLA 1ET9A 3A54A 2L5TA 4KHVA 2RBMA 1STBA 4ZKCB 1DOLA 2F0TA 2B2VC 5E4WC 2KQ3A 4HTHA 3MHBA 1EU4A 1WVLA 5JVG3 4DF7A 5ELDA 1SDFA 1LO5D 2RSOA 3Q24A 1PYWD 1EY0A 1FR3A 2F0KA 1S5CD 2K5DA 4N9PA 1J8IA 2K1BA 3J80L 5M5WB 2KCCA 3E5SA 5KRUA 1UEAB 3WOEA 4WJWA 3LWUA 3S9WA 2B8GA 1WTRA 3D4DA 3HOUB 2QF7A 2F0PA 1RKNA 2LFNA 5BN4A 4G7ZC 4R9WA 1STNA 3NP8A 4IUNA 1SMYD 1H9SB 2F3WA 4L8JA 1X3QA 3C3LA 2B2VA 4TSSA 2JXMB 5C3WA 2FHTA 3M4YA 4H13C 2KOLA 2X6LA 1D5XC 1ZYRC 4IUVA 2E2DC 5JPNC 4C3HG 1C4QA 2EY1A 2PPBC 1H9RA 4KN7C 5D3DA 1YNND 3NWSA 3FMCA 4BWGB 5IGFA 1SNDA 1E2VA 1ILPA 3R2TA 1BR9A 4LAAA 1LLRD 2DY8A 2RKSA 3N52A 4HN7A 2I46A 3RMHA 3J81L 1CQFA 4G4KA 4KTAA 4K5XA 2JA7B 1B53A 4MHEA 2XN9C 4OL7A 5J22A 5DAUA 3SK4A 4HCSA 4RKBA 4X3KA 2RDHA 4L63B 1A3TA 1PTOF 1MI2A 1KABA 1TS2A 2K6AA 4M8AA 1U4MA 4FF3A 2EY6A 3GV6A 2IL8A 2Z8LA 4EQNA 5M3FB 2DN8A 4XDXA 1Q1EA 1S4ZA 5G3LF 2RDFA 1EFID 1STHA 4X3SA 4YIJA 3C46A 3TZDA 2ENBA 1V1PA 4QB4A 5LHY1 4LJZC 1QWYA 4IQZA 5EKLA 1FNUA 5IGBA 4DXGA 2K33A 2MHVA 2L0CA 3NQTA 2IT1A 1K8OA 3IFDA 4F87A 1AZPA 4U673 1CA5A 1W6JA 4A93B 2SNSA 4KY5A 2Q8TA 2E74C 4XT1B 3P75A 1TR5A 2E76C 1S5ED 3VA7A 2EYJA 2K05A 1EEID 4A3JB 3NXWA 3M7GA 2PZUA 2XSCA 3BS1A 1TWFB 1NR4A 2KA7A 4IURA 3PUXA 3N6RA 5K36G 3TP6A 1DZ1A 1KDAA 1J9OA 2OXPA 2BCOA 3KF8A 5LL6S 4RWSC 3C1EA 1SYFA 1ICWA 1BCPD 4G7OC 5E1FA 1B44D 1GUTA 2SDFA 4IUQA 4K2LA 1PFMA 4KJOA 4H0LC 3D6WA 4KK7A 1HA5A 2XRSD 2E2IB 3H94A 5KNBA 2ZXPA 4DXFA 3SR1A 1MSHA 2FINB 2AQ3B 3BYYB 4G7HC 4FF4A 3U9SA 4K8IA 2A5HA 1EIHA 3Q0AA 1M4VA 1SFOB 1QJOA 1TS5A 4DNRB 3DMUA 4Q0FA 1SJED 3IL8A 2PYKA 2BE5C 3EA6A 3HOYB 3HKZB 1CA6A 1STYA 3BYTB 4CKEA 3F2UA 1BNZA 3QG1A 3T53B 4PMCA 2D5DA 4NMZA 2VNUD 1WTVA 1A2TA 1LT5D 3EJIA 4XXEA 4KKTA 3C1FA 1HQMC 4NW2A 4A3GB 1MGSA 3PIP3 1XYIA 1STGA 2F0WA 3M85A 4IALA 3MFYA 1JOQA 2F0IA 3W2DA 5M3MB 2EZVA 3SVMA 3I73A 5T1IA 1PTOB 1SYBA 3U9OA 1CHPD 3URYA 4J6HA 4BBRB 4DFAA 4ME5A 1HTLD 5ISRA 1ZEQX 2QILA 2K01A 2MUYA 5CBAE 3HOZB 1SNQA 3ND8A 3TP5A 5C3XA 1SYCA 5ELCA 3HOXB 2MGSA 4B08A 2F4IA 1PRTD 4WRDA 1D6EC 4FXKC 3GTPB 1EYCA 2OT2A 4ZYSA 1LTGD 5C4HA 3QIAA 3TMEA 2K5WA 5JJZA 2IPKD 3CQZB 3FPPA 2R7ZB 5EPJA 2KUMA 5KIXA 4UDUC 2EYMA 2DNEA 3LX0A 2O2LD 2EYLA 3TSSA 2ICIA 3FEWX 1S5DD 5FO9B 1PDQA 4JBWA 3A8IE 1MSGA 1Y8OB 2A69D 5M5XB 1VMPA 1G91A 1OXUA 1QNKA 1HXYD 4WORA 5I6WA 4O42A 1SAPA 3K5LA 1UNSA 2IWHA 4A3EB 5KEEA 3PUWA 2SEBD 1IHZA 5IIFA 1ESFA 1S5FD 1BCPF 2F0OA 4L6TB 3T51B 1FYCA 1E2ZA 2PW5A 2WKCA 2VB2X 2TMPA 1JC7A 2L4NA 3GTLB 1CM9A 3S1QB 3MZ5A 2F0SA 1I4GA 3Q6SA 2OEOA 2IX1A 3K58A 2K5QA 3O13A 4ZRZA 3D3RA 4XQQA 4KMUC 5ELBA 1G291 5AFWA 3CKIB 5A2QE 3NE5B 1TWGB 1GUOA 4QIWB 3I4MB 3GO5A 3OMGA 1TWHB 2I07B 3VA5A 3M7NA 2EYPA 3C0NA 3HP3A 1U4PA 1T5XD 1BUVT 1FGBD 1NAPA 2BA0A 4K6LA 4RGNA 2GA4B 1MBYA 1M8AA 1Q8IA 1F2YA 3RLFA 2JEBI 4UAIA 3KLSX 1E0BA 2WIIB 3BVMA 1LTTD 4H44C 1TU2B 2XVSA 1RCVD 4XTCS 1CQVA 1RJTA 3CRLC 1SNOA 2NTSA 4V0BA 1ZYRD 5KYIA 4PNYA 4RFBA 2X6GA 3GTGB 5EPLA 3D6CA 1DCZA 3NTIA 3OW7A 3VR6A 3TP7A 2JSOA 3DM1A 5C5MA 1Z7TA 1YNJC 3HZXA 1CK1A 1L0YB 4ODGA 4CBVA 4DU9A 3K5OA 1SEBD 2WP8J 1TS4A 4KY6A 1CHQD 3VYUA 3SXHA 2KEEA 2K7VA 2G9DA 2WACA 2HCCA 2NTTA 4LK1C 5EGTA 3HEJA 4ZQ3A 2M9VA 4IUTA 5IGDA 4TRDA 2AWNA 2JA5B 3S14B 2NVYB 4BA1I 2QEJC 4KJNA 3C2PA 4FP5D 4FXDA 3BDOA 2KJXA 1F2LA 1WD0A 1A3VA 1ENCA 3QB3A 1EZ6A 2B2UC 3RZOB 4IFDJ 3T56B 3G4OA 5CYUA 1LTSD 3BVZA 3NQIA 1RDPD 3VR5A 1BCPB 1EZ8A 3MXNA 3PUVA 4KHZA 5A2QL 2EOTA 1SJHD 4Z9CB 2ZXRA 1EY6A 1II3A 2G9HD 3H91A 3VR3A 1FNWA 2HDMA 1HFGA 4MN3A 4CGYB 2NWGA 4B9WA 4V190 2O4XA 4C2MB 4F7XA 4RGTA 2TSSA 5EJWA 1I4HA 3H09A 2B2UA 1DJRD 2E2JB 1IKLA 4XIGS 3BG3A 4IFDG 3EFXD 1F9SA 2NN6G 3OOCA 5JEAH 4LMQD 3A8KE 1SE4A 1H9JA 1PFBA 2A6HC 4EQPA 3J7AF 2SOBA 4K6DA 1IKMA 1R4QB 2Y0SB 1DOKA 2A6EC 5IT9E 4A3FB 2PCFB 5FOBB 1LTRD 1EIGA 3G7LA 2Q8IB 1EY9A 3VR4A 5M9OA 3DUZA 1LT3D 3KK7A 5IGEA 1C8CA 1UUPA 2C5CA 1I4PA 3OPOA 4EGVA 2VUMB 4K2KA 1BOSA 3ZYYX 2F3VA 1D5MC 3FVQA 3HOVB 3OSOA 1TY0A 3J7YW 2B8FA 5A35A 3D4WA 1D5ZC 1V1OA 1Q12A 4J8QA 5KGUA 3LNNA 1FNVA 3NUCA 2YYZA 3OIPA 4U68A 2ICEC 5HGTA 1EWCA 1Q3LA 1VF7A 1GOZA 4IFDH 3I91A 2NN6H 1ESRA 1Y1VB 1EOTA 1WTWA 2BE5D 5IODA 4FF1A 2ZT9C 1B3AA 3SHLA 3RUZA 4BS9A 1EQTA 3S2DB 1KDCA 1EWHA 1G8ZD 2HDLA 2L11A 3SK6A 2QDBA 1PRTB 5E3FA 4WFN3 1OXXK 2K32A 4OIKA 4CKBA 2F0EA 1B4OA 4DN4M 1GUGA 5CMDA 5I2YA 2KHSA 1F9RA 2JP1A 2NBFA 1LTAD 1PMRA 4PMWA 3GTJB 1K8MA 2B2WC 3KLRA 5ELEA 4RCNA 4FVMA 4F8MA 3S1NB 1SYEA 1T5EA 3T13A 1BXTA 4PQXA 2ZXOA 5I9OA 1OXTA 2JA6B 3I3CA 4A3BB 2L12A 2YU9B 1B9MA 2VXWA 1R4PB 2PQEA 1SNCA 3PMFA 1Y69U 3KLSA 2KECA 2PZTA 1KDBA 1HUNA 3C0OA 3R2IA 1VDZA 3NK9A 4FO2A 3G6JB 3NHHA 3MEHA 1GUWA 4IUUA 2EPBA 3L7ZC 2B2WA 1TWAB 3DWPA 2FMCA 1QILA 4C3JB 2EJFC 1W6KA 1JWMD 1Q1BA 2K04A 1WTQA 2M00A 4HR7B 3EROA 1JQYD 1SBBB 1O78A 3CRKC 3MXGA 5DM73 2V4DA 1QG7A 2KVMA 2F0NA 2HUGA 3K5MA 5KNCA 1A3UA 2LKVA 5C6AA 4CKCA 4FF2A 1DYQA 2VB3X 4G57A 1AW7A 2XWJB 5C4XB 1U4RA 4RGOS 1C48A 5J39A 3A56A 1TT2A 3I90A 1LABA 4HAEA 2XNAC 3MTSA 1V43A 4RHRA 5JPMC 1TVXA 3I4LA 5T1GA 5FLXE 3EVQA 2HQEA 2F0VA 4IFDI 2NN6I 1QE6A 2CW0D 2N88A 2B2TC 3DWQA 3GTMB 2NVQB 4PMBA 4OO1G 4R8IA 3X3NA 2F0DA 1U9RA 1SSOA 5HURA 2QKIC 3D31A 5C44B 4ZKBB 2A74C 3MXPA 4MIUA 1RD9D 4ULLA 1D2BA 1CT1D 2PZWA 4RA8A 4A3MB 4H7BA 4O1NA 3H3VC 3PIO3 1AFPA 2WV6D 5CR3A 4KKUA 4K5WA 1V1PB 5DNFA 5EKIA 4KD4A 3D8GA 4OHJA 4KD3A 4F88A 4JK1C 4XYQA 2NUCA 2EYOA 2F0QA 4C3IB 1EQVA 3HRZC 4CJ0B 3P1HA 5CV9A 3TP8A 4C3JG 1HA6A 5C3EB 2RA4A 1I4XA 1H9SA 1ZXTA 1EY8A 5FO8B 3ONAB 3NTHA 2SNMA 2XRQD 1O80A 1GJXA 4I65A 4OO1H 2BA1A 4QMGA 4EVOA 1S5BD 2R6GA 2PNRC 5M5YB 2E75C 1DM0B 2PMZB 1I6HB 2LMCB 1SYDA 1KNAA 2D2CC 4EQOA 1YNJD 3J80E 4ZUIA 3RZDB 3S2HB 4RH6A 5FO7B 3NWTA 3I72A 4XT3B 5BN3A 5CGKA 2X69A 1JB3A 1EU3A 1WTXA 2F0LA 5JVH3 4ID6A 2A68C 1CFMA 3M4OB 2NYZD 4NKLA 3S1MB 2R92B 5LL6X 1CZGA 4DGZA 1B2TA 5CV8A 1DXMA 3JAME 1HRJA 4FYDA 4RAUC 1D1IA 3HGBA 1IW7C 3NBIA 2RVLA 1HHVA 2NB0A 3MFGA 1BF4A 2HCIA 1XWEA 3A8JE 1OO9B 3QO2A 5FLXL 1KTKA 1X3PA 4ZK9B 3OIQA 2EXZA 3OWFA 4HSVA 2N55A 3NTKA 3BVGA 2Q8RE 2F1MA 3K59A 1ENAA 2EYFA 1RTNA 3ERQA 5EPKA 3V05A 1JORA 4XQJA 2B2YC 5I9PA 3SE0A 3R93A 4GZYC 2EE1A 4C3IG 2F0JA 1ZKOA 2A73B 1AZQA 4IZ8A 5JEAJ 5CV6A 2K03A 5NUCA 2DY7A 4DAVA 3ND9A 2IJ0A 5KNDA 1RODA 3FDTA 1TIID 3KBXA 3TDQA 5I2XA 1WTOA 2EJMA 3OWEB 3J7AV 3VYSA 3TN2A 3DWAA 5CBEE 2A6HD 3S16B 2LY7A 1XXGA 2AUJD 2PO4A 5JAVA 1SYGA 2NZ1D 2MP1A 2A6ED 4X3UA 3M3YB 2F0MA 3DEOA 2B2YA 4OO1I 2KEDA 2R61A 3MXUA 3T4AC 4DK1A 2F0FA 1PFNA 1O7ZA 4C56C 3KBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWG B;  1UNS A;  1EEI D;  1QIL A;  1BCP B;  2WV6 D;  1GOZ A;  2NTS A;  1JWM D;  1PRT F;  1BCP C;  3R2T A;  1ET9 A;  1LT5 D;  4RFB A;  1I4R A;  2SEB D;  1LLR D;  1V1P B;  5D3I B;  1ET6 A;  1JQY D;  1ESF A;  1S5F D;  1SBB B;  1BCP F;  4L6T B;  1SJH D;  3MFG A;  4OHJ A;  1JR0 D;  4Z9C B;  3MC0 B;  3C0M A;  2CHB D;  1LTI D;  2RDG A;  2XN9 C;  2G9H D;  1KTK A;  2AQ2 B;  1EU4 A;  3W2D A;  1FNW A;  1G8Z D;  2AQ1 B;  1SE2 A;  1KLG D;  1PRT B;  1CK1 A;  3BVG A;  5ELD A;  1I4X A;  5FK9 C;  1PRT C;  5FKA C;  1LO5 D;  1PTO B;  1L0Y B;  1ENF A;  3G4N A;  1DYQ A;  3BZD B;  4RGT A;  1PYW D;  1RF2 D;  1PTO C;  1I4G A;  1CHP D;  2TSS A;  3URY A;  1BCP D;  1AW7 A;  1I4H A;  2RDH A;  2XRQ D;  4L63 B;  1B44 D;  3V05 A;  1PTO F;  1HTL D;  1LTA D;  1S5C D;  1DJR D;  3O13 A;  4RGO S;  1LTB D;  2QIL A;  1TS2 A;  1HQR D;  1S5B D;  1SEB D;  5ELB A;  1PRE A;  3R8B A;  3DWP A;  1TS4 A;  1TY2 A;  1HA5 A;  2XRS D;  1Z52 A;  3EFX D;  1CHQ D;  1AN8 A;  1EEF D;  2Z8L A;  1TS3 A;  4RGM A;  2XNA C;  5TSS A;  1SE4 A;  4DXF A;  5I4D A;  1B1Z A;  1I4Q A;  5ELC A;  4RHR A;  5ELE A;  1PRT D;  2NTT A;  1D6E C;  1KLU D;  1PTO D;  1PZI D;  2IJ0 A;  1PZJ D;  1JWU D;  4ZYS A;  2AQ3 B;  1EFI D;  1JCK B;  1LTG D;  1SE3 A;  1BXT A;  3BYY B;  4RH6 A;  1XTC D;  3C0N A;  2IPK D;  1PZK D;  1LTR D;  1F77 A;  1V1P A;  3DWQ A;  1LT3 D;  2J4X A;  4UDU C;  1T5X D;  1FGB D;  1LT6 D;  1UUP A;  3OWE B;  1I4P A;  2QEJ C;  1FNU A;  3GP7 A;  2O2L D;  1EU3 A;  4TSS A;  4K6L A;  1M4V A;  4RGN A;  3SEB A;  3DWA A;  1STE A;  4DXG A;  1JWS D;  1TS5 A;  3TSS A;  1D5X C;  2ICI A;  1MD2 D;  1FD7 D;  1L0X B;  1D5M C;  1S5D D;  3CHB D;  1SJE D;  3C0O A;  1XXG A;  1TY0 A;  1PTO H;  3R2I A;  1LT4 D;  4RCO A;  3KLS X;  1D5Z C;  4RHS A;  3EA6 A;  1V1O A;  1RD9 D;  1CT1 D;  3G4O A;  1HXY D;  3BVM A;  1LTT D;  2R61 A;  5D3D A;  1SXT A;  5ELF A;  3BYT B;  1LTS D;  1RCV D;  3BVZ A;  1FNV A;  1RDP D;  1CQV A;  4C56 C;  1S5E D;  4O1N A;  1EWC A; 
#chains in the Genus database with same CATH topology
 3I8Z A;  5C0X G;  3K0X A;  1PH2 A;  2PW7 A;  2FFK B;  4C3I H;  4CJ1 B;  2HHH L;  2CFM A;  5GAE C;  1PA6 A;  5JEA G;  1A15 A;  5C3E H;  4A3I B;  1E24 A;  4DA2 A;  4GNX A;  2R92 G;  1CI3 M;  4CJ2 C;  3K57 A;  4NP5 A;  4CHT B;  1YHA A;  3A7A B;  1LTI D;  1O7L A;  5E7N A;  1ICF B;  2AQ2 B;  2EY5 A;  2ZJR A;  1AH9 A;  4ZLT F;  3H6M A;  4R4T A;  1L0W A;  3QOJ A;  1HZA A;  5EBC A;  1CZW A;  1UAP A;  5FKA C;  4JI7 Q;  1BVS A;  2FJ2 A;  1ENF A;  3G4N A;  1IBK L;  1Y14 B;  4GKK L;  3AMU A;  4HSP A;  2Z6K A;  3UI2 A;  1PTO C;  2VQF Q;  1KXL A;  1L1O A;  2CH4 A;  2DJG C;  1JIC A;  1I6H H;  2F0U A;  2UXB L;  4POG A;  2CWA A;  3IFT A;  4X3T A;  2F4V L;  1QVF A;  4YCV A;  1PRE A;  3RZD H;  3R8B A;  3S1R B;  1G2T A;  4YWL A;  3WDN A;  1S40 A;  2C9O A;  1AN8 A;  1EEF D;  3S2H H;  4FNF A;  5TSS A;  2NVT H;  3W1G A;  1GHK A;  3K7A B;  1B1Z A;  2QEX A;  1I4Q A;  3P20 A;  3TZU A;  2VW9 A;  1F9P A;  2E5L Q;  2MFI A;  1STA A;  1KLU D;  2FXQ A;  2G5D A;  2BOS A;  2IY5 B;  1JCK B;  4ABN A;  1B9N A;  3Q22 A;  1KAA A;  4HID A;  5KYL A;  3QOL A;  2I5M X;  3JAM L;  4OEM B;  2EDG A;  1HNX Q;  1GUN A;  3AU7 A;  5C0X H;  4DPG A;  2F03 A;  3PO3 B;  2PQA B;  3K5N A;  2J4X A;  3M4O H;  3CU7 A;  2OF1 A;  3U58 A;  1G6Z A;  3S1M H;  3QJY A;  2R92 H;  3DXJ C;  4LW1 A;  4BBS B;  1RTO A;  4P2C B;  3RD4 A;  1NSN S;  4R4C A;  4DAY A;  4QUC A;  5COR A;  2B3G A;  1JB7 A;  2IX0 A;  2H4O A;  4HED A;  4RHS A;  4OIJ A;  2O5J C;  4DR6 L;  4AYB B;  1BQQ T;  5ELF A;  4LFA Q;  5DM6 3;  3WOF A;  1BO0 A;  1WJJ A;  1Y8N B;  2I5H A;  1PLF A;  1C9O A;  4MNO A;  5CC4 A;  4JI6 Q;  1K83 H;  5CV7 A;  2EY2 A;  1ONL A;  4HCE A;  2IW3 A;  1I3Q B;  2QDL A;  4TQU S;  3K6O A;  2F3I A;  4KHP Q;  4DV0 Q;  3PQI A;  3SDZ A;  3J81 j;  4OGQ C;  3V2T A;  1ILQ A;  3T1Y L;  1OXS C;  1N33 L;  1VQE A;  2EJG C;  1DD2 A;  1SE8 A;  3KDF A;  4BA2 I;  3PV0 A;  4HIO A;  3GTO B;  1AE3 A;  5D65 A;  1JOK A;  5I6Y A;  2DUD A;  3BZD B;  3DHQ A;  1RF2 D;  4A3I G;  1VQB A;  3HG9 A;  1JJC B;  1W3S A;  1PV4 A;  2R93 B;  3HOW B;  5JJK A;  3IAY A;  1H9K A;  1SMY C;  2MO1 A;  5HGQ A;  1TY2 A;  4QJF A;  4RKL A;  4RGM A;  5GAH C;  2B39 A;  1IBL Q;  2J7Z A;  3I2Z A;  1N8R C;  4K14 A;  2UUB Q;  3I70 A;  1FJG L;  1U4L A;  3D4R A;  3QR8 A;  2PMZ E;  4UPA A;  1PZI D;  1PZJ D;  1IYU A;  1YIJ A;  5F2D A;  3L2P A;  1XMQ Q;  2B63 B;  3A55 A;  1EWI A;  4LF7 Q;  1A6X A;  1HNW L;  4NPS A;  4AH6 A;  1KQS A;  4LUV A;  2LXK A;  1YNN C;  1EY7 A;  3MWY W;  4DR5 L;  2E2H B;  3TBI B;  3M3Y H;  4PV1 C;  4H02 A;  4JPB W;  4R8N A;  5GQO A;  1OXV A;  4KI0 A;  2DNC A;  1FD7 D;  4XQN A;  1XPO A;  4NXM Q;  4DKA C;  4X64 L;  2F0H A;  4IO9 A;  1YEZ A;  4YHH L;  3S15 B;  1KNE A;  3PO3 G;  3NEL A;  1QCB D;  4A3I H;  2EVB A;  2KHJ A;  4BBS G;  4DR1 Q;  4B3S Q;  1Q86 C;  2ZTC A;  2VQE Q;  3OTO L;  1I6V C;  1NCV A;  4QUF A;  1GHJ A;  2K5H A;  4JOI C;  1KRS A;  1GUS A;  3W1B A;  1I4R A;  1QOH A;  1ET6 A;  3HOU H;  2QCP X;  1XPU A;  1NBW A;  1F2M A;  3L9A X;  4DV4 L;  1DON A;  1JOO A;  4AYB G;  2HHH Q;  3TQY A;  3T1H L;  1J6Q A;  3MC0 B;  4HMI A;  1BDO A;  4EX5 A;  3I7F A;  1XNR L;  3PO2 B;  1K0S A;  2DJF C;  1D1K A;  2Z0S A;  4KN4 C;  1YNX A;  1SE2 A;  2VY3 A;  3CAM A;  4BY1 B;  5C0X I;  3S1R H;  1HPC A;  2MPM A;  2WAQ B;  3K81 C;  5FK9 C;  4A3D B;  3LWE A;  3PIP A;  4GKJ L;  4J1M A;  1H9M A;  2LS0 1;  5IOC A;  3GQB A;  2UXD L;  4DV6 Q;  4E6I A;  3A0J A;  2XIW A;  1HFN A;  2N8N A;  3EQL C;  1K8G A;  1QB5 D;  4IOA A;  2F4V Q;  3FRP B;  3A74 A;  1L1O B;  2N3S A;  5K36 H;  3T16 A;  4UHV A;  1HZC A;  5I4D A;  3PO3 H;  5IT9 L;  1NR2 A;  1WD1 A;  1A0I A;  2JA8 B;  2PI2 A;  4NB3 A;  1HUM A;  2R93 G;  3HOW G;  2WB1 B;  3B6Y A;  4ZAI A;  3VYR A;  2WKD A;  2M2L A;  4L5T A;  5FLM G;  4QL5 A;  1SNM A;  1XTC D;  1B50 A;  3UDF A;  1JJ2 A;  2BH2 A;  1I50 B;  4LF8 L;  4Y7N B;  1VF5 C;  1YJW A;  4YY3 Q;  2JYO A;  1LT6 D;  2BDO A;  3GP7 A;  1VQD A;  1X6O A;  4A3K B;  3GTK B;  3M4Q A;  4DV2 Q;  4IUP A;  3A5Z B;  2K52 A;  1L0X B;  2KCN A;  2O5I C;  4A75 A;  2B63 G;  1RHP A;  3A7L A;  1LT4 D;  3NBH A;  1Z47 A;  5FJ8 H;  2D62 A;  4C1N K;  4JI4 Q;  1JE4 A;  1I3Q H;  2CCZ A;  5DLQ E;  1SXT A;  3KJO A;  1SNP A;  4A76 A;  1O7Y A;  4DNI A;  5DEH A;  3MA2 B;  4BY7 B;  1PFS A;  5K5P A;  3OMC A;  3W3A A;  1N34 Q;  5CV5 A;  4B9X A;  1BCP C;  2A68 D;  4AQY L;  2CKZ B;  3GTO H;  5C4J B;  1VQ8 A;  3H15 A;  5ELN A;  1HTP A;  3OHX C;  4Q5V A;  3BJU A;  1JR0 D;  1TQO A;  2CHB D;  2XWB B;  4NDX A;  4ZUJ A;  2RDG A;  1LV9 A;  2R93 H;  3HOW H;  1V8Q A;  3Q23 A;  5LMU L;  1VQL A;  4KKS A;  1KLG D;  1VCI A;  1TWC B;  5FLM H;  3T1Y Q;  1XX8 A;  1YJ9 A;  1N33 Q;  5GAG C;  4DR4 L;  4FDB A;  4ME3 A;  1IW7 D;  3I4O A;  4LF6 Q;  1EY5 A;  2L55 A;  1Q90 A;  3JC6 6;  3KDF B;  4TKO B;  3PO2 G;  4IN3 A;  2RSN A;  1Z52 A;  3U4Z A;  3P7J A;  3BDC A;  4BY1 G;  5EKK A;  2ID0 A;  4A93 H;  3STB D;  2Z4H A;  2WAQ G;  5BN5 A;  2R7D A;  2B2T A;  1I94 L;  4A3D G;  5EQ0 A;  4GOP C;  1PHJ A;  1WCM B;  5IYC G;  2KHI A;  3E6Z X;  3H0G B;  5BR8 Q;  4KLK A;  3NSW A;  5COY A;  5CV4 A;  3IKJ A;  3PUZ A;  1CTM A;  1SE3 A;  4GN4 B;  1HCZ A;  1FJG Q;  1ML0 D;  1PXU A;  3SK5 A;  1F77 A;  4DK0 A;  1VQ5 A;  1VMC A;  5IGC A;  4HMJ A;  4I7Z C;  2Z1C A;  3R3O A;  5EBD A;  1AP0 A;  4C1N I;  5H1S E;  2JA8 G;  2WIN B;  2L1B A;  4QCL A;  3KUP A;  2WB1 G;  4DR5 Q;  1LAC A;  2CQA A;  2ZJP A;  3CHB D;  1VS0 A;  2JE6 I;  5IGG A;  4RCO A;  5JOB A;  3FKI B;  1G2S A;  2MQH A;  3G71 A;  2NVT B;  2JN4 A;  4X64 Q;  4DV3 Q;  2IX3 A;  4OWX B;  3AYH B;  1NUC A;  2H1E A;  4K8J A;  5E4X A;  3VYT A;  5C4Z A;  4A3K G;  1SRU A;  4AYB E;  1M1K C;  1WTP A;  1TKW B;  1A2U A;  3AB9 A;  1NTG A;  2E2I H;  1PH6 A;  1NNX A;  3PO2 H;  2J0T D;  1N9W A;  1YI2 A;  4BY1 H;  3FP9 A;  5D3I B;  2R3Z A;  2LXJ A;  1EYD A;  2HIX A;  3OTO Q;  4A3D H;  3NPP A;  2CW0 C;  4BXX H;  4KY7 A;  1QNU A;  3SK8 A;  3C0M A;  1IYJ B;  1A8V A;  4K5V A;  1G51 A;  2GVB A;  4DAP A;  4AIM A;  4A4I A;  2D0O A;  4BY7 G;  2JEA I;  1YHQ A;  2AQ1 B;  3GTQ B;  5D14 A;  1Y8P B;  2FMM A;  1B8A A;  3E0J A;  3X3M A;  1PRT C;  2ZTE A;  1XNR Q;  2CVR A;  3ITP A;  1IYV A;  3NEM A;  2F0G A;  2AWO A;  4DNT B;  3KJP A;  1JE5 A;  4O0A A;  1EY4 A;  1R9T B;  1D8L A;  1LTB D;  1HQR D;  1PH4 A;  3GV3 A;  2NVX B;  4LF9 L;  2K28 A;  1K83 B;  1TS3 A;  3GD7 A;  2AUK A;  4RMF A;  3VR2 A;  3HOY H;  2YTV A;  1GXD C;  3V96 A;  1I50 H;  4PG3 A;  3PGZ A;  3K0Y A;  3J81 E;  1YHB A;  3PUY A;  2RQX A;  5J1Z A;  1PTO D;  2EYH A;  2KBN A;  1EL0 A;  1JWU D;  1EYA A;  4JCV E;  1VQI A;  1IL8 A;  1RL2 A;  2Q2I A;  4QF4 A;  1F2Z A;  2A69 C;  3DEP A;  1Y1W B;  4S3S A;  3GTK H;  1PZK D;  1X65 A;  4C3H B;  4XYO A;  1BBX C;  1E2W A;  1Z6H A;  2A19 A;  2BDN A;  4FXG C;  1IBM L;  3S17 B;  1WOC A;  4ILW A;  4A3G H;  2MJ8 A;  4OWW B;  1WCM G;  5C0X J;  4LFB Q;  3H0G G;  1F9Q A;  1AE2 A;  3SEB A;  1STE A;  5G3L D;  5C5L A;  4M1U B;  1Q8K A;  1JWS D;  1MD2 D;  1DOM A;  2L15 A;  3PF4 A;  2D9U A;  3MAQ A;  3FPU B;  1PTO H;  1AEX A;  3HS0 C;  5GRO A;  4DUY L;  3MVV A;  1X32 A;  2L9H A;  2ES2 A;  1W2B A;  4KV6 A;  3AEV A;  3L3O C;  4UP7 A;  5C4J H;  4N9T A;  3I56 A;  1G6P A;  2LSS A;  3QWN A;  3KOJ A;  2Z4I A;  3I4N B;  5EAY A;  1PRT F;  3BDL A;  1ET9 A;  4IPG A;  3HOX H;  1TWC H;  3A54 A;  3FKI G;  3CCU A;  2L5T A;  4X6A H;  4KHV A;  2RBM A;  1STB A;  4ZKC B;  1DOL A;  2F0T A;  2B2V C;  5E4W C;  1KD1 C;  2KQ3 A;  4HTH A;  3MHB A;  1EU4 A;  4GN3 B;  1WVL A;  5JVG 3;  2OCE A;  2R7Z H;  4DF7 A;  5ELD A;  1SDF A;  1LO5 D;  2RSO A;  3Q24 A;  1NMG A;  1PYW D;  1OTC A;  1EY0 A;  2HT1 A;  2WAQ E;  1FR3 A;  1UE6 A;  1WCM H;  2F0K A;  3UE0 A;  1S5C D;  2K5D A;  3H0G H;  4N9P A;  4DR4 Q;  1J8I A;  2K1B A;  3J80 L;  5M5W B;  2KCC A;  3E5S A;  4DR2 Q;  1HNZ L;  5KRU A;  1UEA B;  1S3O A;  3EIV A;  3WOE A;  4WJW A;  3LWU A;  5IWA Q;  5M5X H;  2UU9 L;  3S9W A;  2YV5 A;  2B8G A;  1WTR A;  3D4D A;  3HOU B;  2VL6 A;  2QF7 A;  4X66 L;  2F0P A;  1MJC A;  1RKN A;  2LFN A;  5BN4 A;  4JI5 Q;  1KIX A;  4G7Z C;  4R9W A;  2RHQ B;  5JJL A;  1STN A;  3AFQ A;  3NP8 A;  2WB1 E;  1V9P A;  4IUN A;  1SMY D;  4NXN L;  1H9S B;  2F3W A;  4L8J A;  1MHW C;  1X3Q A;  3C3L A;  2B2V A;  4TSS A;  3FKI H;  3CF5 A;  2JXM B;  5C3W A;  2FHT A;  3M4Y A;  4YCU A;  3CP0 A;  2ALY B;  4H13 C;  2KOL A;  2X6L A;  1D5X C;  1ZYR C;  3Q8D A;  3GTL H;  4IUV A;  2E2D C;  1NJI C;  3S1Q H;  3EN2 A;  4CDE C;  4JI3 L;  1Y1W G;  5JPN C;  4C3H G;  1C4Q A;  4P72 A;  4GN5 A;  2EY1 A;  4EQ5 A;  2PPB C;  2PNH A;  1H9R A;  2JK8 A;  3KYH C;  4KN7 C;  5D3D A;  5HY6 A;  1YNN D;  3NWS A;  1VQG A;  4IPC A;  3FMC A;  4BWG B;  5IGF A;  1SND A;  1E2V A;  1ILP A;  1U5K A;  1XNQ Q;  4R4O A;  3R2T A;  3WWV A;  1BR9 A;  3GTQ H;  4LAA A;  1LLR D;  2DY8 A;  3I4M H;  2RKS A;  3N52 A;  4HN7 A;  2I46 A;  4X65 L;  3RMH A;  1TWH H;  3J81 L;  2B29 A;  1CQF A;  4G4K A;  4KTA A;  4K5X A;  2JA7 B;  1B53 A;  4MHE A;  2XN9 C;  4OL7 A;  1R9T H;  5J22 A;  5J3B A;  3TRE A;  4DR7 L;  3I4N G;  2NVX H;  3CC7 A;  5DAU A;  1CKN A;  4JYA L;  3SK4 A;  1H95 A;  2UUA Q;  4HCS A;  3ULL A;  3F1Z A;  4RKB A;  4X3K A;  2RDH A;  4L63 B;  1A3T A;  1O7I A;  1PTO F;  1MI2 A;  1KAB A;  1TS2 A;  2K6A A;  4GLV B;  1J5E L;  4DUZ L;  1B70 B;  4M8A A;  2UXC Q;  3KLW A;  1X3F A;  1U4M A;  1E1T A;  4FF3 A;  1M90 C;  2EY6 A;  3GV6 A;  2IL8 A;  2Z8L A;  4DK3 C;  1Y1W H;  4IJH A;  4C3H H;  3L0O A;  4EQN A;  5M3F B;  3S17 H;  2DN8 A;  4LF9 Q;  4XDX A;  1Q1E A;  1S4Z A;  1WFQ A;  1E3P A;  1YZ6 A;  1A63 A;  2KCT A;  2RDF A;  5G3L F;  1EFI D;  1STH A;  4J15 A;  4X3S A;  4YIJ A;  3C46 A;  3TZD A;  2ENB A;  2K5V A;  4JI0 L;  4X62 L;  3CXC A;  3F2B A;  1VQ7 A;  1V1P A;  2Q2H A;  4QB4 A;  4DV1 Q;  5LHY 1;  3GTG H;  4LJZ C;  4ALP A;  1QWY A;  4IQZ A;  2K75 A;  2OTL A;  5EKL A;  1FNU A;  3HOU G;  3CCR A;  2UUC Q;  5IGB A;  4DXG A;  2K33 A;  2MHV A;  2BH8 A;  2L0C A;  4CDD C;  3NQT A;  2IT1 A;  1K8O A;  3IFD A;  4UY8 C;  4F87 A;  1AZP A;  4U67 3;  1CA5 A;  3I4N H;  1W6J A;  4A93 B;  3KF6 A;  3SGI A;  2SNS A;  3NEN A;  4KY5 A;  2Q8T A;  2NZH A;  4OWT B;  2E74 C;  4XT1 B;  4DUY Q;  3P75 A;  1TR5 A;  2E76 C;  1S5E D;  3VA7 A;  2EYJ A;  3GDE A;  2K05 A;  1EEI D;  4A3J B;  3NXW A;  3M7G A;  2PZU A;  2XSC A;  3BS1 A;  1GO3 E;  1TWF B;  1NR4 A;  2KA7 A;  4IUR A;  5IT9 c;  3PUX A;  3N6R A;  5K36 G;  1HR0 L;  3RNU A;  3TP6 A;  1DZ1 A;  1KDA A;  2AHO B;  3RN5 A;  3ULJ A;  1J9O A;  3HFZ B;  5M5W H;  4MTN A;  1K28 A;  2OXP A;  2BCO A;  3KF8 A;  3ER0 A;  5LL6 S;  2NVY H;  4RWS C;  3S14 H;  2K14 A;  3C1E A;  4LFC L;  1SYF A;  1ICW A;  1BCP D;  4G7O C;  5E1F A;  1B44 D;  1GUT A;  2SDF A;  4HJ5 A;  4IUQ A;  4K2L A;  2R7F A;  1PFM A;  2JA7 G;  4KJO A;  4H0L C;  3D6W A;  3RZO H;  4KK7 A;  1VQA A;  1HA5 A;  2XRS D;  3G4S A;  3TS0 A;  4IPH A;  2E2I B;  3H94 A;  4DV5 L;  1N36 L;  2HIV A;  2DGY A;  2Z9H A;  5KNB A;  2ZXP A;  4DXF A;  1VQ9 A;  1NMF A;  5FJ8 G;  3SR1 A;  4GNX B;  1MSH A;  2UU9 Q;  2FIN B;  2AQ3 B;  1B3Q A;  4PZ6 A;  3FHW A;  3BYY B;  4G7H C;  4FF4 A;  1IBK Q;  3U9S A;  3TS2 A;  4K8I A;  4GKK Q;  2ZM6 L;  2A5H A;  2UXB Q;  1QVC A;  1GVP A;  1EIH A;  5M3F G;  3Q0A A;  4LF5 L;  1M4V A;  4YCW A;  1SFO B;  4NXN Q;  5LMN L;  1QJO A;  1TS5 A;  2H5X A;  4DNR B;  4QQB X;  3DMU A;  3H3V H;  4Q0F A;  1SJE D;  3IL8 A;  2PYK A;  4C2M H;  3I55 A;  2BE5 C;  4JOI A;  3RLO A;  4ZCK A;  2ATW A;  3EA6 A;  1VQH A;  3HOY B;  3HKZ B;  1PH9 A;  1CA6 A;  1HR0 W;  1STY A;  1Q46 A;  3ZJY C;  3BYT B;  4CKE A;  4DR3 L;  3F2U A;  3J7A 5;  1BNZ A;  1EIY B;  3QG1 A;  2JA7 H;  3T53 B;  4PMC A;  2D5D A;  1VQO A;  4NMZ A;  2VNU D;  1WTV A;  1A2T A;  2EXD A;  1LT5 D;  3EJI A;  4XXE A;  4DV7 L;  4KKT A;  3C1F A;  1HQM C;  4NW2 A;  4A93 G;  4LWC A;  3CME A;  4A3G B;  4PZ7 A;  1MGS A;  3PIP 3;  1XYI A;  2JQO A;  1STG A;  2F0W A;  3M85 A;  3DM3 A;  2D0P A;  3PIO A;  4IAL A;  3MFY A;  3CCE A;  2F0I A;  1JOQ A;  3W2D A;  5M3M B;  4A3F H;  2EZV A;  4DAY B;  3SVM A;  4A3J G;  4JV5 L;  1B7Y B;  3I73 A;  5T1I A;  1XMO L;  4DR6 Q;  2OWO A;  1PTO B;  1SYB A;  3U9O A;  1CHP D;  3URY A;  4J6H A;  4BBR B;  4B3T L;  5M3F H;  2Q2U A;  4DFA A;  4ME5 A;  1C7Y A;  1HTL D;  3E9I A;  5ISR A;  1ZEQ X;  2QIL A;  1VQ4 A;  2K01 A;  1K3B C;  2MUY A;  5CBA E;  1CKN B;  3HOZ B;  3E9H A;  1SNQ A;  3KFU A;  3ND8 A;  3BZC A;  3DLL A;  3TP5 A;  5C3X A;  3K80 C;  1SYC A;  5ELC A;  3HOX B;  1PH8 A;  2MGS A;  4B08 A;  2F4I A;  1PRT D;  1A62 A;  4WRD A;  4YWM A;  3CCS A;  1SRO A;  1D6E C;  1LTL A;  4FXK C;  3GTP B;  1EYC A;  2OT2 A;  4ZYS A;  1LTG D;  5C4H A;  5LMN W;  2N49 A;  3QIA A;  3TME A;  2K5W A;  5JJZ A;  2IPK D;  4JI1 L;  3TEH B;  1PH7 A;  3CQZ B;  1KC8 C;  3FPP A;  4LF4 L;  2R7Z B;  5EPJ A;  2KUM A;  2OQ0 A;  5KIX A;  2JJQ A;  4UDU C;  2EYM A;  2DNE A;  2IHF A;  3LX0 A;  4YWK A;  3S24 A;  1UE5 A;  2O2L D;  2MNA A;  1PH3 A;  4LUO A;  4BXX G;  2VZA A;  2EYL A;  3D0F A;  3TSS A;  2ICI A;  1N32 L;  3FEW X;  1S5D D;  3AQQ A;  5FO9 B;  4CDF C;  4APV A;  1PDQ A;  3A8I E;  1MSG A;  1Y8O B;  4JBW A;  2A69 D;  5M5X B;  4A3J H;  1VMP A;  1G91 A;  1OXU A;  2E8G A;  1TWF H;  4JI7 L;  1QNK A;  2XTI A;  1HXY D;  4WOR A;  5I6W A;  4O42 A;  2VQF L;  4CDC C;  3CCM A;  1SAP A;  4A3L G;  1HNW Q;  5FLX c;  3K5L A;  2ZTD A;  1UNS A;  2RF4 A;  2IWH A;  3KF6 B;  4A3E B;  5KEE A;  3PUW A;  1X56 A;  3F8T A;  2SEB D;  1IHZ A;  5IIF A;  1ESF A;  1S5F D;  1BCP F;  2F0O A;  4L6T B;  3T51 B;  3PCO B;  3HKZ G;  3HOY G;  1FYC A;  3S1N H;  1E2Z A;  2PW5 A;  2WKC A;  2IHE A;  2VB2 X;  2TMP A;  2E5L L;  1JC7 A;  2L4N A;  3UE1 A;  4WJ3 M;  4YHH Q;  1GD7 A;  3GTL B;  2HD3 A;  1CM9 A;  1E22 A;  1MIU A;  3S1Q B;  2PQA A;  3MZ5 A;  4B3M L;  4GLX A;  2F0S A;  1HNX L;  4GOP A;  2YU9 H;  1I4G A;  3Q6S A;  4A3G G;  2OEO A;  2IX1 A;  3K58 A;  2K5Q A;  3O13 A;  4ZRZ A;  3D3R A;  4XQQ A;  4KMU C;  5ELB A;  1G29 1;  5AFW A;  3H3V I;  4QGU A;  3CKI B;  5M3M G;  1K0R A;  1K8A C;  1SR3 A;  1K3R A;  3KF8 B;  5A2Q E;  3NE5 B;  4DV4 Q;  1TWG B;  3T1H Q;  3ERS X;  4HJ7 A;  1GUO A;  4QIW B;  4BBR G;  3I4M B;  3GO5 A;  3OMG A;  4DV5 Q;  4IOC A;  1TWH B;  2I07 B;  3VA5 A;  3M7N A;  2NZO A;  1KL9 A;  2EYP A;  4C3J H;  1SFO H;  4LFA L;  4JBK A;  4A3L H;  3C0N A;  3J80 i;  4GKJ Q;  5IP7 H;  3HP3 A;  1U4P A;  3HOZ G;  2K50 A;  2UXD Q;  1T5X D;  1BUV T;  1FGB D;  2K4K A;  3HOX G;  1NAP A;  2BA0 A;  4K6L A;  4RGN A;  2GA4 B;  1T9H A;  4KHP L;  4DV0 L;  1MBY A;  1M8A A;  1Q8I A;  1PH1 A;  3CCJ A;  4LF5 Q;  2HQL A;  1VQ6 A;  1F2Y A;  1WYD A;  5LMN Q;  3RLF A;  2JEB I;  4UAI A;  2R7Z G;  3KLS X;  2C35 B;  4JW0 A;  4IPD A;  1E0B A;  2WII B;  3BVM A;  1LTT D;  4H44 C;  4I7A A;  1CKM A;  1TU2 B;  2XVS A;  3PF5 A;  2OQK A;  4B3R L;  1CSQ A;  1RCV D;  4XTC S;  1CQV A;  4P75 A;  1WTH A;  4GLA C;  1RJT A;  5L37 A;  3IRB A;  4LF8 Q;  3CRL C;  1SNO A;  1HZB A;  2NTS A;  5M3M H;  4OEL B;  1ZYR D;  4V0B A;  5KYI A;  1EUJ A;  4PNY A;  1YIT A;  4JI2 L;  4RFB A;  4JBJ A;  2X6G A;  3GTG B;  5EPL A;  1VQP A;  3D6C A;  1DCZ A;  3NTI A;  1HH2 P;  3OW7 A;  1DGS A;  1IBL L;  5AJ3 L;  3VR6 A;  3RR5 A;  3JAM i;  4POF A;  4BBR H;  2UUB L;  3TP7 A;  3CPW A;  2JSO A;  3DM1 A;  5C5M A;  1EOV A;  1Z7T A;  1BBU A;  1YNJ C;  3HZX A;  1CK1 A;  2RCF A;  4A3E G;  1XMQ L;  1L0Y B;  4HJ9 A;  3HOZ H;  1HJP A;  4OON A;  5IYB G;  4LF7 L;  3NBH B;  4ODG A;  4CBV A;  4DU9 A;  3K5O A;  1C0A A;  1SEB D;  2WP8 J;  3GTP H;  1Q7Y C;  1TS4 A;  4O2D A;  4KY6 A;  4AQY Q;  4OX9 L;  1CHQ D;  4WJ4 A;  1QVG A;  3VYU A;  3SXH A;  2Z6K C;  2KEE A;  3CQZ H;  3JAM c;  1L1O C;  2K7V A;  3F2C A;  2G9D A;  2WAC A;  2HCC A;  3G48 A;  2NTT A;  2JA9 A;  4A3M H;  4LK1 C;  5LMU Q;  5IYD G;  1PVO A;  4DR1 L;  4B3S L;  5EGT A;  3HEJ A;  2GVA A;  1LUZ A;  4ZQ3 A;  2M9V A;  5GAD C;  4IUT A;  2VQE L;  5IGD A;  4TRD A;  2AWN A;  2JA5 B;  1MJE A;  3S14 B;  2NVY B;  4JI1 Q;  2A1A A;  4BA1 I;  2QEJ C;  4KJN A;  3I4M G;  3BU2 A;  3C2P A;  4FP5 D;  4FXD A;  3BDO A;  2KJX A;  1F2L A;  4OXP A;  1WD0 A;  1A3V A;  1ENC A;  3QB3 A;  1EZ6 A;  2B2U C;  3RZO B;  1I94 Q;  4IFD J;  1PYB A;  3T56 B;  2CQO A;  4A3E H;  1N32 Q;  3M4P A;  5IYB H;  3G4O A;  5CYU A;  3PSI A;  1LTS D;  3BVZ A;  3NQI A;  1RDP D;  3HKZ E;  3UDG A;  4DV6 L;  1GM5 A;  3VR5 A;  1BCP B;  4P73 A;  5M5Y H;  1EZ8 A;  3MXN A;  3PUV A;  3ICE A;  4N8F A;  4KHZ A;  5A2Q L;  2EOT A;  1SJH D;  4Z9C B;  2ZXR A;  1EY6 A;  4Y52 H;  1II3 A;  2G9H D;  2YTY A;  3H91 A;  3VR3 A;  1FNW A;  2HDM A;  1HFG A;  5IYD H;  4HJA A;  1EQR A;  4MN3 A;  4CGY B;  2NWG A;  4B9W A;  4V19 0;  2O4X A;  4C2M B;  4F7X A;  4RGT A;  3CCL A;  2TSS A;  3RN2 A;  5EJW A;  1TWG H;  1I4H A;  3H09 A;  4YY3 L;  2B2U A;  1DJR D;  1IZ6 A;  4B3M Q;  1SLJ A;  1EFW A;  2E2J B;  1IKL A;  4XIG S;  3BG3 A;  4IFD G;  2Q2T A;  3EFX D;  3F2D A;  1F9S A;  2NN6 G;  4DV2 L;  3OOC A;  5JEA H;  4LMQ D;  4GOP B;  2V1C C;  3A8K E;  3E0E A;  1SE4 A;  1H9J A;  1PFB A;  1UE1 A;  2A6H C;  4EQP A;  4JI4 L;  2F52 A;  3J7A F;  2SOB A;  4MTK A;  1X3E A;  4K6D A;  1IKM A;  1R4Q B;  4JI8 L;  2Y0S B;  1DOK A;  2A6E C;  5IT9 E;  4A3F B;  2PCF B;  5FOB B;  1LTR D;  1EIG A;  3CC2 A;  3G7L A;  2Q8I B;  1EY9 A;  3VR4 A;  1QZH A;  1N34 L;  5M9O A;  3DUZ A;  1LT3 D;  3KK7 A;  5IGE A;  3U4V A;  1C8C A;  1UUP A;  2C5C A;  1I4P A;  3OPO A;  1U0L A;  4EGV A;  2VUM B;  4K2K A;  1BOS A;  3ZYY X;  3TRZ A;  2F3V A;  1D5M C;  3FVQ A;  3HOV B;  3OSO A;  1IXR A;  1TY0 A;  3J7Y W;  2B8F A;  2GN5 A;  5A35 A;  4R1J A;  3D4W A;  1D5Z C;  2JA5 G;  1JJG A;  1Q82 C;  1V1O A;  1Q12 A;  4J8Q A;  3CCQ A;  3BZK A;  5KGU A;  3LNN A;  1FNV A;  1PH5 A;  3NUC A;  4LF6 L;  2YYZ A;  3OIP A;  4U68 A;  2ICE C;  1EWC A;  5HGT A;  1IBM Q;  1Q3L A;  1XTD A;  1TXY A;  1VF7 A;  1GOZ A;  4B3R Q;  4IFD H;  3I91 A;  2NN6 H;  1ESR A;  1Y1V B;  1EOT A;  3LGJ A;  1WTW A;  2BE5 D;  2N78 A;  5IOD A;  4FF1 A;  2ZT9 C;  1B3A A;  3SHL A;  3RUZ A;  4JI2 Q;  4BS9 A;  1EQT A;  3S2D B;  1KDC A;  1EWH A;  5BR8 L;  1G8Z D;  2HDL A;  2L11 A;  3M9B A;  3SK6 A;  5AJ3 Q;  2QDB A;  1PRT B;  5E3F A;  4WFN 3;  1OXX K;  2K32 A;  4OIK A;  4UP9 A;  4CKB A;  1EYG A;  4JG2 A;  2F0E A;  1B4O A;  1QUQ A;  4DN4 M;  1FGU A;  1GUG A;  3J7Z C;  5CMD A;  5I2Y A;  2KHS A;  1F9R A;  2JP1 A;  2NBF A;  1LTA D;  1PMR A;  3S16 H;  1X54 A;  4PMW A;  1KRT A;  3GTJ B;  3OYY A;  1K8M A;  2B2W C;  4JC0 A;  4K0K L;  4R4I A;  4L5R C;  2YTX A;  4RG1 A;  2MO0 A;  4R4Q A;  3KLR A;  1VQC A;  2XGT A;  5ELE A;  4RCN A;  4OX9 Q;  2JA5 H;  4FVM A;  1X3G A;  4F8M A;  1SN8 A;  3S1N B;  1SYE A;  1T5E A;  4DV3 L;  3E3X A;  4QIW E;  3T13 A;  1BXT A;  3MEF A;  2ZXO A;  4PQX A;  2EIF A;  5I9O A;  1OXT A;  2JA6 B;  3I3C A;  4A3B B;  2L12 A;  1P16 A;  2YU9 B;  1B9M A;  2VXW A;  1R4P B;  1UWV A;  2PQE A;  1SNC A;  1VQF A;  3PMF A;  1Y69 U;  3KLS A;  4LNQ A;  1HNZ Q;  2KEC A;  2A8V A;  2PZT A;  2Z6B A;  4TVA B;  1YVC A;  1KDB A;  2Y0S G;  1HUN A;  3ULP A;  4A3F G;  3C0O A;  3R2I A;  1VDZ A;  4HIK A;  2EQS A;  3NK9 A;  4FO2 A;  3G6J B;  3NHH A;  2P5Z X;  3MEH A;  4X66 Q;  1GUW A;  4IUU A;  2EPB A;  3L7Z C;  1VQJ A;  3W5O A;  2VUM G;  1FVI A;  2B2W A;  1TWA B;  3DWP A;  2FMC A;  2QW7 A;  1WI5 A;  1QIL A;  2AKW B;  4L5Q A;  4C3J B;  3HOV G;  2EJF C;  2PI2 E;  1W6K A;  1JWM D;  1Q1B A;  2K04 A;  1WTQ A;  2VS1 A;  1QZG A;  3K7A H;  2M00 A;  4HR7 B;  2RCN A;  3ERO A;  1JQY D;  1SBB B;  1O78 A;  3CRK C;  3MXG A;  5DM7 3;  1BBW A;  2V4D A;  4L5S A;  1QG7 A;  2KVM A;  2F0N A;  2HUG A;  3K5M A;  2AMC B;  2K5N A;  4JI3 Q;  5KNC A;  1K9M C;  3MXN B;  2E2J H;  1A3U A;  2LKV A;  5C6A A;  4CKC A;  4PZ8 A;  4FF2 A;  2CH4 W;  1UE7 A;  1CKO A;  1DYQ A;  1Y1V G;  2VB3 X;  4G57 A;  1AW7 A;  4BBS H;  2XWJ B;  1K73 C;  5C4X B;  3EBE A;  1U4R A;  4RGO S;  4LFB L;  1C48 A;  5J39 A;  2QA4 A;  4P74 A;  3A56 A;  1XJV A;  1TT2 A;  3I90 A;  1LAB A;  4HAE A;  2XNA C;  3MTS A;  4X65 Q;  1V43 A;  4RHR A;  3CCV A;  1GKH A;  5JPM C;  1TVX A;  3CPF A;  3I4L A;  5T1G A;  5FLX E;  3EVQ A;  3A5U A;  4DR7 Q;  2VUM H;  2HQE A;  2F0V A;  4IFD I;  4JYA Q;  2WFW A;  2NN6 I;  1QE6 A;  2CW0 D;  2N88 A;  2B2T C;  2CWP A;  3HOV H;  3DWQ A;  3GTM B;  2NVQ B;  4JI8 Q;  4PMB A;  1VQM A;  4IJL A;  4OO1 G;  1J5E Q;  4DUZ Q;  4R8I A;  5JJI A;  3X3N A;  1JT8 A;  2F0D A;  1U9R A;  1SSO A;  5HUR A;  2QKI C;  1ASZ A;  3CMA A;  3D31 A;  5C44 B;  2KCM A;  4ZKB B;  4LUZ A;  2A74 C;  3MXP A;  2JA6 G;  4A3B G;  4MIU A;  1EIF A;  1Y1V H;  1RD9 D;  4ULL A;  1D2B A;  1CT1 D;  4JI0 Q;  2PZW A;  4RA8 A;  4X62 Q;  4A3M B;  4H7B A;  4JBM A;  4O1N A;  3H3V C;  3PIO 3;  3S2D H;  1AFP A;  2WV6 D;  5CR3 A;  1HZ9 A;  4DR2 L;  4KKU A;  1JMC A;  4K5W A;  1V1P B;  5DNF A;  5IWA L;  5EKI A;  4KD4 A;  3D8G A;  4OHJ A;  4KD3 A;  4F88 A;  4JK1 C;  4XYQ A;  1IL2 A;  2NUC A;  2EYO A;  2F0Q A;  2B63 H;  1Q81 C;  4C3I B;  1EQV A;  3HRZ C;  4CJ0 B;  3P1H A;  5CV9 A;  3TP8 A;  4C3J G;  4JI5 L;  1HA6 A;  5C3E B;  3GTJ H;  1RIP A;  4P71 A;  2RA4 A;  1I4X A;  1H9S A;  1L2F A;  1ZXT A;  5IP7 G;  1EY8 A;  5FO8 B;  2E2H H;  3ONA B;  1NY4 A;  3NTH A;  1YJN A;  2SNM A;  2XRQ D;  1O80 A;  1GJX A;  4I65 A;  4OO1 H;  2BA1 A;  4QMG A;  1Z9F A;  1V1Q A;  4EVO A;  1S5B D;  3K7U C;  4MZ9 A;  1YBY A;  1S72 A;  4HIM A;  3S15 H;  2R6G A;  2PNR C;  4N8X 1;  1HR0 Q;  5M5Y B;  2E75 C;  1QUQ B;  1DM0 B;  2PMZ B;  2I0Q A;  1I6H B;  2LMC B;  1SYD A;  1KNA A;  2D2C C;  4EQO A;  1YNJ D;  3J80 E;  2JA6 H;  4K0K Q;  4A3B H;  4ZUI A;  3RZD B;  5C4X G;  2RHS B;  3S2H B;  4RH6 A;  1VQN A;  3UDX A;  3G6E A;  5FO7 B;  3NWT A;  4LFC Q;  3I72 A;  4XT3 B;  2Y0S E;  5BN3 A;  1XNQ L;  5CGK A;  3OW2 A;  4JVZ A;  2X69 A;  1JB3 A;  1EU3 A;  4QY7 A;  1WTX A;  2F0L A;  5JVH 3;  4ID6 A;  1LM0 A;  2A68 C;  1N36 Q;  1D7Q A;  1CFM A;  1TWA H;  3M4O B;  2NYZ D;  1LYL A;  4NKL A;  5IYC H;  3S1M B;  1PYS B;  2R92 B;  4GS3 A;  5LL6 X;  1CZG A;  1X9N A;  4JI6 L;  5IP9 G;  4HJ8 A;  2UUA L;  1CUK A;  1UEB A;  4DGZ A;  1B2T A;  4A3C G;  5IY0 A;  2ZM6 Q;  5CV8 A;  4DK6 C;  1DXM A;  2KEN A;  3JAM E;  1HRJ A;  1EQQ A;  4FYD A;  4RAU C;  1D1I A;  3HGB A;  3K8A A;  5C44 G;  1IW7 C;  3NBI A;  2UXC L;  1CSP A;  2RVL A;  1HHV A;  2NB0 A;  2JA8 H;  3UDI A;  3MFG A;  1BF4 A;  2I5L X;  2HCI A;  1FL0 A;  1XWE A;  3A8J E;  2ASB A;  1OO9 B;  3QO2 A;  5FLX L;  4A3M G;  1KTK A;  1X3P A;  3STB C;  5C4X H;  4ZK9 B;  3AFP A;  1BKB A;  3OIQ A;  2EXZ A;  3J80 c;  3OWF A;  3CD6 A;  4HSV A;  2N55 A;  3NTK A;  3BVG A;  2Q8R E;  3CC4 A;  4Y7N H;  1E1O A;  2F1M A;  3K59 A;  1ENA A;  1MKH A;  2EYF A;  1RTN A;  3ERQ A;  4DV1 L;  4DR3 Q;  5EPK A;  3V05 A;  4A3K H;  1ASY A;  1JOR A;  4XQJ A;  2B2Y C;  5I9P A;  1E7Z A;  3SE0 A;  2UUC L;  3R93 A;  4GZY C;  2EE1 A;  4C3I G;  2ZJQ A;  2F0J A;  4DV7 Q;  1ZKO A;  2A73 B;  5C3E G;  1AZQ A;  4IZ8 A;  2OTJ A;  4DAM A;  3RLN A;  5JEA J;  5CV6 A;  3GTM H;  2K03 A;  5NUC A;  1XPR A;  2NVQ H;  2DY7 A;  4DAV A;  4GNX C;  3ND9 A;  2IJ0 A;  1I5F A;  1X55 A;  5IP9 H;  4BY7 H;  1SMX A;  1KAW A;  3HKS A;  5KND A;  4JV5 Q;  1XMO Q;  4A3C H;  1ROD A;  3FDT A;  1TII D;  3KBX A;  3TDQ A;  5IE8 A;  3J81 i;  5I2X A;  4B3T Q;  1WTO A;  1VQK A;  1NE3 A;  5C44 H;  2EJM A;  3OWE B;  3J7A V;  3VYS A;  4NXM L;  3TN2 A;  3VDY A;  1P8L A;  3DWA A;  5CBE E;  2A6H D;  3S16 B;  2LY7 A;  4UP8 A;  1XXG A;  2AUJ D;  2QGQ A;  2PO4 A;  1SYG A;  5JAV A;  3CW2 C;  2NZ1 D;  2MP1 A;  2A6E D;  4X3U A;  3U50 C;  3M3Y B;  2F0M A;  3DEO A;  2B2Y A;  4OO1 I;  2KED A;  2R61 A;  3MXU A;  3T4A C;  4DK1 A;  5ELO A;  2F0F A;  1PFN A;  1O7Z A;  1KHI A;  4C56 C;  3J81 c;  3KBG A;  4LF4 Q; 
#chains in the Genus database with same CATH homology
 3I8Z A;  5C0X G;  2PW7 A;  2FFK B;  4CJ1 B;  5JEA G;  1A15 A;  4A3I B;  4DA2 A;  1CI3 M;  4CJ2 C;  3K57 A;  4NP5 A;  4CHT B;  3A7A B;  1LTI D;  1O7L A;  2AQ2 B;  2EY5 A;  4ZLT F;  3H6M A;  3QOJ A;  5EBC A;  1CZW A;  1UAP A;  5FKA C;  2FJ2 A;  1ENF A;  3G4N A;  3AMU A;  4HSP A;  3UI2 A;  1PTO C;  1JIC A;  2F0U A;  3IFT A;  4X3T A;  1PRE A;  3S1R B;  3R8B A;  1G2T A;  3WDN A;  2C9O A;  1AN8 A;  1EEF D;  4FNF A;  5TSS A;  1GHK A;  3K7A B;  1B1Z A;  1I4Q A;  3P20 A;  3TZU A;  1F9P A;  1STA A;  1KLU D;  2BOS A;  1JCK B;  4ABN A;  1B9N A;  3Q22 A;  1KAA A;  5KYL A;  3QOL A;  3JAM L;  2EDG A;  1GUN A;  3AU7 A;  5C0X H;  2F03 A;  3PO3 B;  3K5N A;  2J4X A;  3CU7 A;  2OF1 A;  1G6Z A;  3QJY A;  3DXJ C;  4BBS B;  1RTO A;  4P2C B;  3RD4 A;  1NSN S;  4DAY A;  4QUC A;  5COR A;  2IX0 A;  2H4O A;  4HED A;  4RHS A;  4OIJ A;  2O5J C;  4AYB B;  1BQQ T;  5ELF A;  5DM6 3;  3WOF A;  1BO0 A;  1Y8N B;  1PLF A;  5CC4 A;  5CV7 A;  2EY2 A;  1ONL A;  4HCE A;  2IW3 A;  1I3Q B;  4TQU S;  3K6O A;  3SDZ A;  4OGQ C;  3V2T A;  1ILQ A;  1OXS C;  2EJG C;  1DD2 A;  4BA2 I;  3PV0 A;  3GTO B;  5D65 A;  1JOK A;  5I6Y A;  3BZD B;  3DHQ A;  1RF2 D;  3HG9 A;  2R93 B;  3HOW B;  3IAY A;  1H9K A;  1SMY C;  1TY2 A;  4RKL A;  4RGM A;  2B39 A;  2J7Z A;  4K14 A;  3I70 A;  1U4L A;  3D4R A;  1PZI D;  1PZJ D;  1IYU A;  5F2D A;  2B63 B;  3A55 A;  1A6X A;  1YNN C;  1EY7 A;  3MWY W;  2E2H B;  3TBI B;  4PV1 C;  4R8N A;  1OXV A;  4KI0 A;  2DNC A;  1FD7 D;  4XQN A;  2F0H A;  3S15 B;  1KNE A;  1QCB D;  2EVB A;  1I6V C;  1NCV A;  4QUF A;  1GHJ A;  1GUS A;  1I4R A;  1QOH A;  1ET6 A;  2QCP X;  1F2M A;  3L9A X;  1DON A;  1JOO A;  3MC0 B;  4HMI A;  1BDO A;  3PO2 B;  1D1K A;  4KN4 C;  1SE2 A;  4BY1 B;  5C0X I;  1HPC A;  2MPM A;  2WAQ B;  5FK9 C;  4A3D B;  3LWE A;  4J1M A;  1H9M A;  2LS0 1;  5IOC A;  3GQB A;  4E6I A;  2XIW A;  1HFN A;  3EQL C;  1QB5 D;  3FRP B;  5K36 H;  3T16 A;  5I4D A;  5IT9 L;  1NR2 A;  1WD1 A;  2JA8 B;  1HUM A;  2WB1 B;  4ZAI A;  3VYR A;  2WKD A;  2M2L A;  1SNM A;  1XTC D;  1B50 A;  1I50 B;  4Y7N B;  1VF5 C;  2JYO A;  1LT6 D;  2BDO A;  3GP7 A;  4A3K B;  3GTK B;  4IUP A;  1L0X B;  2KCN A;  2O5I C;  1RHP A;  3A7L A;  1LT4 D;  3NBH A;  1Z47 A;  2D62 A;  4C1N K;  1JE4 A;  1SXT A;  1SNP A;  1O7Y A;  5DEH A;  3MA2 B;  4BY7 B;  5K5P A;  3OMC A;  3W3A A;  5CV5 A;  4B9X A;  1BCP C;  2A68 D;  5C4J B;  1HTP A;  3OHX C;  4Q5V A;  1JR0 D;  1TQO A;  2CHB D;  2XWB B;  4NDX A;  4ZUJ A;  2RDG A;  1LV9 A;  1V8Q A;  3Q23 A;  4KKS A;  1KLG D;  1VCI A;  1TWC B;  1XX8 A;  1IW7 D;  1EY5 A;  2L55 A;  1Q90 A;  4TKO B;  4IN3 A;  2RSN A;  1Z52 A;  3P7J A;  3BDC A;  5EKK A;  2ID0 A;  2Z4H A;  5BN5 A;  2B2T A;  5EQ0 A;  1WCM B;  3E6Z X;  3H0G B;  3NSW A;  5COY A;  5CV4 A;  3IKJ A;  3PUZ A;  1SE3 A;  1CTM A;  1HCZ A;  1ML0 D;  1PXU A;  3SK5 A;  1F77 A;  4DK0 A;  1VMC A;  5IGC A;  4HMJ A;  4I7Z C;  2Z1C A;  3R3O A;  5EBD A;  1AP0 A;  4C1N I;  2WIN B;  2L1B A;  4QCL A;  3KUP A;  1LAC A;  2CQA A;  3CHB D;  2JE6 I;  5IGG A;  4RCO A;  5JOB A;  3FKI B;  1G2S A;  2NVT B;  2IX3 A;  1NUC A;  2H1E A;  4K8J A;  5E4X A;  3VYT A;  5C4Z A;  1WTP A;  1TKW B;  1A2U A;  3AB9 A;  2J0T D;  5D3I B;  2R3Z A;  1EYD A;  3NPP A;  2CW0 C;  4KY7 A;  1QNU A;  3SK8 A;  3C0M A;  4K5V A;  4DAP A;  2JEA I;  2AQ1 B;  3GTQ B;  5D14 A;  1Y8P B;  2FMM A;  3E0J A;  3X3M A;  1PRT C;  2CVR A;  3ITP A;  1IYV A;  2F0G A;  2AWO A;  4DNT B;  1EY4 A;  1R9T B;  1LTB D;  1HQR D;  3GV3 A;  2NVX B;  2K28 A;  1K83 B;  1TS3 A;  3GD7 A;  2AUK A;  3VR2 A;  1GXD C;  3V96 A;  3J81 E;  3K0Y A;  3PUY A;  5J1Z A;  2RQX A;  1PTO D;  2EYH A;  1EL0 A;  1JWU D;  1EYA A;  1IL8 A;  4QF4 A;  1F2Z A;  2A69 C;  3DEP A;  1Y1W B;  4S3S A;  1PZK D;  4C3H B;  4XYO A;  1BBX C;  1E2W A;  1Z6H A;  2BDN A;  4FXG C;  3S17 B;  4ILW A;  2MJ8 A;  5C0X J;  1F9Q A;  3SEB A;  1STE A;  5G3L D;  5C5L A;  4M1U B;  1JWS D;  1MD2 D;  1DOM A;  2D9U A;  3MAQ A;  3FPU B;  1PTO H;  1AEX A;  3HS0 C;  3MVV A;  1X32 A;  2L9H A;  4KV6 A;  3L3O C;  4N9T A;  3QWN A;  2Z4I A;  3I4N B;  1PRT F;  3BDL A;  1ET9 A;  3A54 A;  2L5T A;  4KHV A;  2RBM A;  1STB A;  4ZKC B;  1DOL A;  2F0T A;  2B2V C;  5E4W C;  2KQ3 A;  4HTH A;  3MHB A;  1EU4 A;  1WVL A;  5JVG 3;  4DF7 A;  5ELD A;  1SDF A;  1LO5 D;  2RSO A;  3Q24 A;  1PYW D;  1EY0 A;  1FR3 A;  2F0K A;  1S5C D;  2K5D A;  4N9P A;  1J8I A;  2K1B A;  3J80 L;  5M5W B;  2KCC A;  3E5S A;  5KRU A;  1UEA B;  3WOE A;  4WJW A;  3LWU A;  3S9W A;  2B8G A;  1WTR A;  3D4D A;  3HOU B;  2QF7 A;  2F0P A;  1RKN A;  2LFN A;  5BN4 A;  4G7Z C;  4R9W A;  1STN A;  3NP8 A;  4IUN A;  1SMY D;  1H9S B;  2F3W A;  4L8J A;  1X3Q A;  3C3L A;  2B2V A;  4TSS A;  2JXM B;  5C3W A;  2FHT A;  3M4Y A;  4H13 C;  2KOL A;  2X6L A;  1D5X C;  1ZYR C;  4IUV A;  2E2D C;  5JPN C;  4C3H G;  1C4Q A;  2EY1 A;  2PPB C;  1H9R A;  4KN7 C;  5D3D A;  1YNN D;  3NWS A;  3FMC A;  4BWG B;  5IGF A;  1SND A;  1E2V A;  1ILP A;  3R2T A;  1BR9 A;  4LAA A;  1LLR D;  2DY8 A;  2RKS A;  3N52 A;  4HN7 A;  2I46 A;  3RMH A;  3J81 L;  1CQF A;  4G4K A;  4KTA A;  4K5X A;  2JA7 B;  1B53 A;  4MHE A;  2XN9 C;  4OL7 A;  5J22 A;  5DAU A;  3SK4 A;  4HCS A;  4RKB A;  4X3K A;  2RDH A;  4L63 B;  1A3T A;  1PTO F;  1MI2 A;  1KAB A;  1TS2 A;  2K6A A;  4M8A A;  1U4M A;  4FF3 A;  2EY6 A;  3GV6 A;  2IL8 A;  2Z8L A;  4EQN A;  5M3F B;  2DN8 A;  4XDX A;  1Q1E A;  1S4Z A;  5G3L F;  2RDF A;  1EFI D;  1STH A;  4X3S A;  4YIJ A;  3C46 A;  3TZD A;  2ENB A;  1V1P A;  4QB4 A;  5LHY 1;  4LJZ C;  1QWY A;  4IQZ A;  5EKL A;  1FNU A;  5IGB A;  4DXG A;  2K33 A;  2MHV A;  2L0C A;  3NQT A;  2IT1 A;  1K8O A;  3IFD A;  4F87 A;  1AZP A;  4U67 3;  1CA5 A;  1W6J A;  4A93 B;  2SNS A;  4KY5 A;  2Q8T A;  2E74 C;  4XT1 B;  3P75 A;  1TR5 A;  2E76 C;  1S5E D;  3VA7 A;  2EYJ A;  2K05 A;  1EEI D;  4A3J B;  3NXW A;  3M7G A;  2PZU A;  2XSC A;  3BS1 A;  1TWF B;  1NR4 A;  2KA7 A;  4IUR A;  3PUX A;  3N6R A;  5K36 G;  3TP6 A;  1DZ1 A;  1KDA A;  1J9O A;  2OXP A;  2BCO A;  3KF8 A;  5LL6 S;  4RWS C;  3C1E A;  1SYF A;  1ICW A;  1BCP D;  4G7O C;  5E1F A;  1B44 D;  1GUT A;  2SDF A;  4IUQ A;  4K2L A;  1PFM A;  4KJO A;  4H0L C;  3D6W A;  4KK7 A;  1HA5 A;  2XRS D;  2E2I B;  3H94 A;  5KNB A;  2ZXP A;  4DXF A;  3SR1 A;  1MSH A;  2FIN B;  2AQ3 B;  3BYY B;  4G7H C;  4FF4 A;  3U9S A;  4K8I A;  2A5H A;  1EIH A;  3Q0A A;  1M4V A;  1SFO B;  1QJO A;  1TS5 A;  4DNR B;  3DMU A;  4Q0F A;  1SJE D;  3IL8 A;  2PYK A;  2BE5 C;  3EA6 A;  3HOY B;  3HKZ B;  1CA6 A;  1STY A;  3BYT B;  4CKE A;  3F2U A;  1BNZ A;  3QG1 A;  3T53 B;  4PMC A;  2D5D A;  4NMZ A;  2VNU D;  1WTV A;  1A2T A;  1LT5 D;  3EJI A;  4XXE A;  4KKT A;  3C1F A;  1HQM C;  4NW2 A;  4A3G B;  1MGS A;  3PIP 3;  1XYI A;  1STG A;  2F0W A;  3M85 A;  4IAL A;  3MFY A;  1JOQ A;  2F0I A;  3W2D A;  5M3M B;  2EZV A;  3SVM A;  3I73 A;  5T1I A;  1PTO B;  1SYB A;  3U9O A;  1CHP D;  3URY A;  4J6H A;  4BBR B;  4DFA A;  4ME5 A;  1HTL D;  5ISR A;  1ZEQ X;  2QIL A;  2K01 A;  2MUY A;  5CBA E;  3HOZ B;  1SNQ A;  3ND8 A;  3TP5 A;  5C3X A;  1SYC A;  5ELC A;  3HOX B;  2MGS A;  4B08 A;  2F4I A;  1PRT D;  4WRD A;  1D6E C;  4FXK C;  3GTP B;  1EYC A;  2OT2 A;  4ZYS A;  1LTG D;  5C4H A;  3QIA A;  3TME A;  2K5W A;  5JJZ A;  2IPK D;  3CQZ B;  3FPP A;  2R7Z B;  5EPJ A;  2KUM A;  5KIX A;  4UDU C;  2EYM A;  2DNE A;  3LX0 A;  2O2L D;  2EYL A;  3TSS A;  2ICI A;  3FEW X;  1S5D D;  5FO9 B;  1PDQ A;  4JBW A;  3A8I E;  1MSG A;  1Y8O B;  2A69 D;  5M5X B;  1VMP A;  1G91 A;  1OXU A;  1QNK A;  1HXY D;  4WOR A;  5I6W A;  4O42 A;  1SAP A;  3K5L A;  1UNS A;  2IWH A;  4A3E B;  5KEE A;  3PUW A;  2SEB D;  1IHZ A;  5IIF A;  1ESF A;  1S5F D;  1BCP F;  2F0O A;  4L6T B;  3T51 B;  1FYC A;  1E2Z A;  2PW5 A;  2WKC A;  2VB2 X;  2TMP A;  1JC7 A;  2L4N A;  3GTL B;  1CM9 A;  3S1Q B;  3MZ5 A;  2F0S A;  1I4G A;  3Q6S A;  2OEO A;  2IX1 A;  3K58 A;  2K5Q A;  3O13 A;  4ZRZ A;  3D3R A;  4XQQ A;  4KMU C;  5ELB A;  1G29 1;  5AFW A;  3CKI B;  5A2Q E;  3NE5 B;  1TWG B;  1GUO A;  4QIW B;  3I4M B;  3GO5 A;  3OMG A;  1TWH B;  2I07 B;  3VA5 A;  3M7N A;  2EYP A;  3C0N A;  3HP3 A;  1U4P A;  1T5X D;  1BUV T;  1FGB D;  1NAP A;  2BA0 A;  4K6L A;  4RGN A;  2GA4 B;  1MBY A;  1M8A A;  1Q8I A;  1F2Y A;  3RLF A;  2JEB I;  4UAI A;  3KLS X;  1E0B A;  2WII B;  3BVM A;  1LTT D;  4H44 C;  1TU2 B;  2XVS A;  1RCV D;  4XTC S;  1CQV A;  1RJT A;  3CRL C;  1SNO A;  2NTS A;  4V0B A;  1ZYR D;  5KYI A;  4PNY A;  4RFB A;  2X6G A;  3GTG B;  5EPL A;  3D6C A;  1DCZ A;  3NTI A;  3OW7 A;  3VR6 A;  3TP7 A;  2JSO A;  3DM1 A;  5C5M A;  1Z7T A;  1YNJ C;  3HZX A;  1CK1 A;  1L0Y B;  4ODG A;  4CBV A;  4DU9 A;  3K5O A;  1SEB D;  2WP8 J;  1TS4 A;  4KY6 A;  1CHQ D;  3VYU A;  3SXH A;  2KEE A;  2K7V A;  2G9D A;  2WAC A;  2HCC A;  2NTT A;  4LK1 C;  5EGT A;  3HEJ A;  4ZQ3 A;  2M9V A;  4IUT A;  5IGD A;  4TRD A;  2AWN A;  2JA5 B;  3S14 B;  2NVY B;  4BA1 I;  2QEJ C;  4KJN A;  3C2P A;  4FP5 D;  4FXD A;  3BDO A;  2KJX A;  1F2L A;  1WD0 A;  1A3V A;  1ENC A;  3QB3 A;  1EZ6 A;  2B2U C;  3RZO B;  4IFD J;  3T56 B;  3G4O A;  5CYU A;  1LTS D;  3BVZ A;  3NQI A;  1RDP D;  3VR5 A;  1BCP B;  1EZ8 A;  3MXN A;  3PUV A;  4KHZ A;  5A2Q L;  2EOT A;  1SJH D;  4Z9C B;  2ZXR A;  1EY6 A;  1II3 A;  2G9H D;  3H91 A;  3VR3 A;  1FNW A;  2HDM A;  1HFG A;  4MN3 A;  4CGY B;  2NWG A;  4B9W A;  4V19 0;  2O4X A;  4C2M B;  4F7X A;  4RGT A;  2TSS A;  5EJW A;  1I4H A;  3H09 A;  2B2U A;  1DJR D;  2E2J B;  1IKL A;  4XIG S;  3BG3 A;  4IFD G;  3EFX D;  1F9S A;  2NN6 G;  3OOC A;  5JEA H;  4LMQ D;  3A8K E;  1SE4 A;  1H9J A;  1PFB A;  2A6H C;  4EQP A;  3J7A F;  2SOB A;  4K6D A;  1IKM A;  1R4Q B;  2Y0S B;  1DOK A;  2A6E C;  5IT9 E;  4A3F B;  2PCF B;  5FOB B;  1LTR D;  1EIG A;  3G7L A;  2Q8I B;  1EY9 A;  3VR4 A;  5M9O A;  3DUZ A;  1LT3 D;  3KK7 A;  5IGE A;  1C8C A;  1UUP A;  2C5C A;  1I4P A;  3OPO A;  4EGV A;  2VUM B;  4K2K A;  1BOS A;  3ZYY X;  2F3V A;  1D5M C;  3FVQ A;  3HOV B;  3OSO A;  1TY0 A;  3J7Y W;  2B8F A;  5A35 A;  3D4W A;  1D5Z C;  1V1O A;  1Q12 A;  4J8Q A;  5KGU A;  3LNN A;  1FNV A;  3NUC A;  2YYZ A;  3OIP A;  4U68 A;  2ICE C;  5HGT A;  1EWC A;  1Q3L A;  1VF7 A;  1GOZ A;  4IFD H;  3I91 A;  2NN6 H;  1ESR A;  1Y1V B;  1EOT A;  1WTW A;  2BE5 D;  5IOD A;  4FF1 A;  2ZT9 C;  1B3A A;  3SHL A;  3RUZ A;  4BS9 A;  1EQT A;  3S2D B;  1KDC A;  1EWH A;  1G8Z D;  2HDL A;  2L11 A;  3SK6 A;  2QDB A;  1PRT B;  5E3F A;  4WFN 3;  1OXX K;  2K32 A;  4OIK A;  4CKB A;  2F0E A;  1B4O A;  4DN4 M;  1GUG A;  5CMD A;  5I2Y A;  2KHS A;  1F9R A;  2JP1 A;  2NBF A;  1LTA D;  1PMR A;  4PMW A;  3GTJ B;  1K8M A;  2B2W C;  3KLR A;  5ELE A;  4RCN A;  4FVM A;  4F8M A;  3S1N B;  1SYE A;  1T5E A;  3T13 A;  1BXT A;  4PQX A;  2ZXO A;  5I9O A;  1OXT A;  2JA6 B;  3I3C A;  4A3B B;  2L12 A;  2YU9 B;  1B9M A;  2VXW A;  1R4P B;  2PQE A;  1SNC A;  3PMF A;  1Y69 U;  3KLS A;  2KEC A;  2PZT A;  1KDB A;  1HUN A;  3C0O A;  3R2I A;  1VDZ A;  3NK9 A;  4FO2 A;  3G6J B;  3NHH A;  3MEH A;  1GUW A;  4IUU A;  2EPB A;  3L7Z C;  2B2W A;  1TWA B;  3DWP A;  2FMC A;  1QIL A;  4C3J B;  2EJF C;  1W6K A;  1JWM D;  1Q1B A;  2K04 A;  1WTQ A;  2M00 A;  4HR7 B;  3ERO A;  1JQY D;  1SBB B;  1O78 A;  3CRK C;  3MXG A;  5DM7 3;  2V4D A;  1QG7 A;  2KVM A;  2F0N A;  2HUG A;  3K5M A;  5KNC A;  1A3U A;  2LKV A;  5C6A A;  4CKC A;  4FF2 A;  1DYQ A;  2VB3 X;  4G57 A;  1AW7 A;  2XWJ B;  5C4X B;  1U4R A;  4RGO S;  1C48 A;  5J39 A;  3A56 A;  1TT2 A;  3I90 A;  1LAB A;  4HAE A;  2XNA C;  3MTS A;  1V43 A;  4RHR A;  5JPM C;  1TVX A;  3I4L A;  5T1G A;  5FLX E;  3EVQ A;  2HQE A;  2F0V A;  4IFD I;  2NN6 I;  1QE6 A;  2CW0 D;  2N88 A;  2B2T C;  3DWQ A;  3GTM B;  2NVQ B;  4PMB A;  4OO1 G;  4R8I A;  3X3N A;  2F0D A;  1U9R A;  1SSO A;  5HUR A;  2QKI C;  3D31 A;  5C44 B;  4ZKB B;  2A74 C;  3MXP A;  4MIU A;  1RD9 D;  4ULL A;  1D2B A;  1CT1 D;  2PZW A;  4RA8 A;  4A3M B;  4H7B A;  4O1N A;  3H3V C;  3PIO 3;  1AFP A;  2WV6 D;  5CR3 A;  4KKU A;  4K5W A;  1V1P B;  5DNF A;  5EKI A;  4KD4 A;  3D8G A;  4OHJ A;  4KD3 A;  4F88 A;  4JK1 C;  4XYQ A;  2NUC A;  2EYO A;  2F0Q A;  4C3I B;  1EQV A;  3HRZ C;  4CJ0 B;  3P1H A;  5CV9 A;  3TP8 A;  4C3J G;  1HA6 A;  5C3E B;  2RA4 A;  1I4X A;  1H9S A;  1ZXT A;  1EY8 A;  5FO8 B;  3ONA B;  3NTH A;  2SNM A;  2XRQ D;  1O80 A;  1GJX A;  4I65 A;  4OO1 H;  2BA1 A;  4QMG A;  4EVO A;  1S5B D;  2R6G A;  2PNR C;  5M5Y B;  2E75 C;  1DM0 B;  2PMZ B;  1I6H B;  2LMC B;  1SYD A;  1KNA A;  2D2C C;  4EQO A;  1YNJ D;  3J80 E;  4ZUI A;  3RZD B;  3S2H B;  4RH6 A;  5FO7 B;  3NWT A;  3I72 A;  4XT3 B;  5BN3 A;  5CGK A;  2X69 A;  1JB3 A;  1EU3 A;  1WTX A;  2F0L A;  5JVH 3;  4ID6 A;  2A68 C;  1CFM A;  3M4O B;  2NYZ D;  4NKL A;  3S1M B;  2R92 B;  5LL6 X;  1CZG A;  4DGZ A;  1B2T A;  5CV8 A;  1DXM A;  3JAM E;  1HRJ A;  4FYD A;  4RAU C;  1D1I A;  3HGB A;  1IW7 C;  3NBI A;  2RVL A;  1HHV A;  2NB0 A;  3MFG A;  1BF4 A;  2HCI A;  1XWE A;  3A8J E;  1OO9 B;  3QO2 A;  5FLX L;  1KTK A;  1X3P A;  4ZK9 B;  3OIQ A;  2EXZ A;  3OWF A;  4HSV A;  2N55 A;  3NTK A;  3BVG A;  2Q8R E;  2F1M A;  3K59 A;  1ENA A;  2EYF A;  1RTN A;  3ERQ A;  5EPK A;  3V05 A;  1JOR A;  4XQJ A;  2B2Y C;  5I9P A;  3SE0 A;  3R93 A;  4GZY C;  2EE1 A;  4C3I G;  2F0J A;  1ZKO A;  2A73 B;  1AZQ A;  4IZ8 A;  5JEA J;  5CV6 A;  2K03 A;  5NUC A;  2DY7 A;  4DAV A;  3ND9 A;  2IJ0 A;  5KND A;  1ROD A;  3FDT A;  1TII D;  3KBX A;  3TDQ A;  5I2X A;  1WTO A;  2EJM A;  3OWE B;  3J7A V;  3VYS A;  3TN2 A;  3DWA A;  5CBE E;  2A6H D;  3S16 B;  2LY7 A;  1XXG A;  2AUJ D;  2PO4 A;  5JAV A;  1SYG A;  2NZ1 D;  2MP1 A;  2A6E D;  4X3U A;  3M3Y B;  2F0M A;  3DEO A;  2B2Y A;  4OO1 I;  2KED A;  2R61 A;  3MXU A;  3T4A C;  4DK1 A;  2F0F A;  1PFN A;  1O7Z A;  4C56 C;  3KBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...