1BCPB

Binary complex of pertussis toxin and atp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
197
structure length
197
Chain Sequence
b'PGIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN
publication title Crystal structure of the pertussis toxin-ATP complex: a molecular sensor.
pubmed doi rcsb
molecule tags Toxin
total genus 42
structure length 197
sequence length 197
chains with identical sequence H
ec nomenclature ec 2.4.2.-:
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
B PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bcpB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1bcpB01
1EU3A 2ICIA 1UUPA 1AN8A 2SEBD 1B1ZA 2XNAC 1FGBD 2R61A 4Z9CB 1S5BD 1T5XD 1RF2D 1D5XC 1I4RA 1PYWD 4RGNA 1S5FD 3C0MA 1D5MC 2QEJC 1ET6A 1B44D 3EA6A 1ET9A 1LTID 2AQ2B 4DXGA 1FNUA 2XRSD 1PTOB 1PZKD 1KLGD 3DWAA 3G4OA 1L0YB 4RFBA 2XRQD 1LTAD 1PRTC 5I4DA 3KLSX 1TS4A 4RCOA 1S5CD 1JWUD 1BXTA 1I4XA 1LT6D 1PZID 3BVZA 4L63B 1DJRD 1PTOD 2XN9C 4ZYSA 3BYYB 3R2TA 1EEID 1I4GA 5ELBA 1LLRD 4RGMA 1SE4A 2Z8LA 3TSSA 5FK9C 4RGOS 1JCKB 1I4QA 1CK1A 3URYA 1PREA 1UNSA 1SE3A 1JWMD 4K6LA 2AQ1B 4RHSA 1PRTF 3CHBD 1L0XB 1EFID 1TY2A 3G4NA 1LT4D 1TS2A 1BCPC 1SBBB 1TS5A 1TY0A 3V05A 1TS3A 3DWQA 3MFGA 1FNVA 2WV6D 3O13A 2RDHA 5FKAC 1FNWA 1EU4A 1RCVD 1I4HA 1LTRD 1LTGD 1HXYD 4OHJA 2IPKD 1D6EC 1XTCD 1FD7D 1PRTB 1F77A 1LTSD 5ELDA 4RH6A 1LO5D 2QILA 1HA5A 1CHQD 1V1PB 3SEBA 3R8BA 2NTTA 1BCPF 1S5DD 3BVMA 1S5ED 4BWGB 1GOZA 2AQ3B 1KLUD 1PRTD 1LTBD 4O1NA 1V1OA 1HTLD 1SJHD 5ELFA 1CHPD 1G8ZD 2O2LD 1SJED 1JQYD 1SXTA 2NTSA 1MD2D 3BZDB 3MC0B 3BYTB 1BCPB 3OWEB 3BVGA 5D3DA 4UDUC 2G9HD 1EWCA 2IJ0A 1HQRD 1SEBD 3R2IA 2RDGA 5D3IB 1JR0D 4C56C 1PTOC 1BCPD 1RD9D 5ELCA 1Z52A 1AW7A 2TSSA 3C0OA 1LT3D 1LTTD 1QILA 1STEA 3DWPA 1ESFA 1SE2A 1M4VA 1I4PA 4RHRA 1RDPD 1CT1D 1EEFD 5TSSA 3GP7A 1CQVA 2J4XA 1JWSD 1KTKA 2CHBD 1PZJD 1ENFA 3EFXD 3W2DA 1PTOF 1D5ZC 1V1PA 5ELEA 1DYQA 1LT5D 1PTOH 1XXGA 4DXFA 4L6TB 4RGTA 4TSSA 3C0NA
chains in the Genus database with same CATH superfamily
2PW7A 1WD1A 3I7FA 4QUCA 4XYOA 4BS9A 2XRSD 3G4SA 4A3JB 3UDGA 1I6HH 4A3BG 5I4DA 4JV5Q 1S5CD 3PCOB 3U9OA 1VQJA 3UDIA 1GUGA 1K73C 1ASZA 5IYDG 2N3SA 1PTOD 5C3EB 3CCMA 1YHBA 4LF7Q 4IPHA 4LUVA 3V2TA 4B3TL 2Y0SG 1SE4A 3A5UA 4X3KA 1XMOQ 3S2DB 5C44B 2EYLA 1KDAA 2IX3A 2CFMA 1OXTA 1UNSA 1XNRL 1I3QB 2MUYA 1QVCA 1TY2A 3K7AH 3G4NA 1CKOA 1GD7A 2A6HC 5EBCA 4DPGA 4FXDA 1RIPA 3HOVG 5G3LD 4BA2I 2F0PA 4KD3A 2LXJA 1D6EC 1QWYA 3A8KE 5FLXL 2JA6G 4DR7Q 3KF8A 4YWMA 1WCMH 2JA8H 3I91A 1S5ED 1FGUA 1C4QA 3CP0A 3OW7A 2CKZB 2AQ3B 1IW7D 5CBEE 1G6PA 3VA7A 2BCOA 4CBVA 2RA4A 1HTLD 5F2DA 2JSOA 3HS0C 5I6YA 5IGGA 2HDMA 4KD4A 3RNUA 1MJCA 1GKHA 3M4OB 2FJ2A 2E74C 5GAHC 3P7JA 3FPPA 1E1OA 4IUQA 2Q2IA 5IIFA 2YTVA 1K28A 1VQFA 5C0XI 1E2ZA 4QUFA 4JI8Q 3T13A 4DV0Q 3AU7A 4LFAL 2KEEA 2VQEL 4A3KH 1BOSA 1A0IA 2K01A 3NQTA 2NUCA 1SYEA 1N8RC 3C0OA 2N8NA 5DM63 3J7A5 3SHLA 4DF7A 4KJNA 3PIOA 1EYAA 1SMYD 5IT9E 4NMZA 4GKJQ 4FNFA 4JI5L 2ENBA 2F0IA 2F3VA 3ULJA 5IGFA 3T51B 3H94A 4JI7L 3GTJB 4KV6A 1B50A 5C4XG 5ISRA 3CXCA 1HNWQ 4I65A 1L0WA 4M1UB 1X3FA 1GUWA 1LUZA 1TWFH 1X3QA 5DAUA 4IN3A 4DR1Q 4IALA 2JA5B 4NB3A 1O80A 2XVSA 4LJZC 3Q6SA 1N33L 1LTAD 3IL8A 2L9HA 1HNZQ 4IOCA 2A19A 1QG7A 2F0MA 1VF5C 4X64L 2XN9C 4L5SA 2DNEA 1EL0A 5JEAH 1BVSA 3A7AB 1KL9A 3GD7A 4DK6C 4DR5Q 4ZAIA 1YNJD 2R7FA 3CD6A 1I6HB 2K05A 3KJPA 1X3PA 3FRPB 3SGIA 4N8FA 3A8JE 4G4KA 2IX0A 1F2ZA 4OIKA 3TQYA 4JI6L 5GAEC 2F0HA 1JOOA 1VQPA 1WTPA 1LTRD 2H1EA 3M7GA 5C6AA 1BBUA 1U4LA 4ODGA 5KNCA 1EQTA 1F77A 3K7AB 4K0KL 1GUTA 3I8ZA 4DR2L 3KDFA 2R93H 1LM0A 1PH4A 4C3IG 2MO0A 5C4HA 4LFBL 2KUMA 3TMEA 1LTBD 1PFNA 3T4AC 1AP0A 3X3MA 3GTMH 4K8IA 3T1YL 1RTOA 1Q8IA 1WCMB 4R4TA 2JA8B 3M4QA 4R4CA 3MC0B 4QGUA 4PQXA 1F9PA 1B9MA 3NK9A 2ALYB 1QOHA 3UI2A 1N32Q 3CKIB 3RZDH 4XYQA 3TRZA 5CV8A 4DUYQ 4J15A 3DEOA 1X6OA 4PZ7A 3HZXA 4JV5L 2Q8IB 2J7ZA 1RODA 2BDNA 4GLAC 5LMUL 4HN7A 2HUGA 4LF4L 4LF7L 1SYBA 3JC66 1M4VA 4P71A 4X65Q 2OCEA 1ZYRC 1PYSB 5JAVA 2GVBA 3ND9A 4NKLA 3MWYW 3NXWA 4ULLA 3FMCA 5I2YA 4A3KB 4C3HB 1CKNA 4KK7A 3CC4A 3DXJC 3K5LA 4A3GG 2WAQB 4XQNA 1QZHA 2RSNA 3H09A 1WTWA 1JICA 4TSSA 1PH8A 2JK8A 5IYDH 1E2WA 3CCQA 2B29A 3BU2A 4C1NK 5FLXE 2NVYH 1YEZA 3G6JB 2TMPA 4N8X1 4GLVB 2XRQD 4DR7L 4PMCA 1VMPA 1JWUD 1BXTA 1I4XA 1IYUA 1LT6D 1TWFB 5M3FH 3E5SA 2L1BA 4XQQA 5C5LA 4BY7H 2HCCA 5BR8L 4HSPA 1QNKA 3G48A 3HOVH 1I4GA 1AH9A 1SNDA 4PMBA 2MP1A 1UEBA 4ABNA 4AYBE 1IZ6A 4QB4A 1I4QA 2JA6H 2F0JA 3PF5A 3TEHB 4RHSA 2OQKA 1L0XB 2IY5B 2I07B 1TY0A 2HIXA 3GO5A 4A93H 2R7ZG 2JYOA 2WV6D 2RDHA 3CW2C 1VQMA 2PQAA 5LL6S 2K75A 4A3JG 2F0VA 3VYSA 1CTMA 4OHJA 1VQ9A 1O78A 1UE1A 4GN4B 5C3EG 2OTJA 4YCVA 3GDEA 2NYZD 5IGDA 4BWGB 3MA2B 1MI2A 5I6WA 4ID6A 5K5PA 2MNAA 2IT1A 3HGBA 2EYPA 5M5YH 2CH4W 4GNXB 5C44G 3S1RH 1ICFB 4N9PA 5M3MH 4DV6Q 1OTCA 1YJNA 2A69D 2R93B 2NTSA 1HZAA 3N6RA 5M5XH 3BZDB 1KDBA 1Q1EA 4X62Q 4A3LG 1U0LA 3M85A 1E1TA 3OWEB 2RKSA 4KKTA 4DR1L 3C2PA 4Y52H 3ZYYX 2G9HD 3J80c 2HD3A 4H02A 1JR0D 1EY5A 1WD0A 4K2KA 1BCPD 1YNND 3CCJA 4A3CG 1HNZL 2VZAA 5C4XH 3RZDB 4DAPA 3M3YH 1NE3A 4DUZQ 3K5OA 3H3VC 4DU9A 2A68D 1H95A 4MNOA 2DY7A 5IOCA 3D8GA 2MHVA 3S24A 2BA0A 1I6VC 3W2DA 4ZK9B 5ELEA 3BS1A 2JA7H 1DOMA 1II3A 2RDFA 3H3VI 3K59A 2EYHA 1TR5A 3EN2A 1AN8A 4NDXA 1VDZA 1UEAB 4B3MQ 5C0XH 4FF1A 5IWAL 3VYTA 1N34Q 3GTOH 1FJGL 1J9OA 4U68A 2XSCA 3E3XA 3DHQA 4RCOA 3VR5A 3CF5A 3E6ZX 3BVZA 4L63B 3E0EA 2PI2A 4H13C 4JPBW 4KY6A 3LNNA 1KXLA 4K2LA 4B3RL 1GXDC 3U58A 4FVMA 4YCWA 1A2TA 4IPCA 3OHXC 1IXRA 3WOFA 2WKCA 1VQEA 5M3FB 1NR4A 4BY7B 3J81j 5JOBA 3V05A 3Q8DA 2ZT9C 4IO9A 2EY5A 4C3IH 3ZJYC 4NP5A 2JA5G 2A8VA 1RCVD 2PZUA 4PNYA 1VQOA 1YJWA 1I4HA 4CJ1B 5FO9B 3K0YA 3I4OA 4QL5A 4HJ9A 1HZ9A 4A3DH 2RHQB 1D2BA 2Z1CA 1FD7D 2EQSA 4JI2L 2L12A 1U4MA 4GZYC 4A93B 3OIQA 3CCLA 4KY7A 1CA6A 1G2SA 2L5TA 4FDBA 2KENA 1CSPA 1KLUD 5IYBH 2HT1A 2D0PA 4O1NA 2IHFA 3TS2A 4B3SL 2O2LD 5FJ8H 3S14B 1MD2D 4X3TA 3CPWA 3S1MH 3HKZE 1LV9A 1PFMA 4IUTA 1A6XA 5M5YB 1IL8A 2O5JC 4DV2L 3S1RB 1LACA 5M3MB 2UU9L 1SMXA 4DV1Q 1HRJA 3LWEA 1Y1VG 1JC7A 4K5XA 3S2HB 5LL6X 3L2PA 1QILA 2EY1A 4KLKA 2Q2TA 1IYJB 5EKIA 5TSSA 2L15A 2K4KA 4A4IA 4DV7L 1H9RA 2YU9H 3ULLA 5CV9A 1WCMG 2V1CC 1MSGA 1PTOF 3T16A 2HHHL 2UUCQ 2JA8G 3M3YB 2G5DA 3EJIA 4HIMA 2F0DA 4FO2A 1S4ZA 3CMAA 3SDZA 4L5TA 4O2DA 1S5BD 4TVAB 1EYCA 4NXNL 2JA7B 1E7ZA 3G7LA 3FEWX 1AE2A 4PV1C 3MEFA 4DK1A 5G3LF 2DJFC 3Q22A 1K8AC 3HKSA 1H9MA 4H7BA 2GVAA 1EZ8A 2R7ZH 2OWOA 4HCSA 4DV6L 1N9WA 2WINB 4C3HG 4A75A 1IBML 2F03A 3GTOB 4A3JH 3GTGH 2WIIB 2M00A 1VQ4A 2WAQG 1C9OA 1JOKA 1V9PA 1K3BC 2I5MX 2SDFA 4IURA 2HQLA 1BNZA 3S1NH 2E5LL 2B2WA 2KCMA 4DR6Q 1JT8A 2F1MA 2NZHA 5C44H 2RQXA 2E2JB 2XGTA 1HXYD 1EYDA 1R9TH 2GA4B 1CI3M 3GV3A 1JJGA 3LX0A 1UE7A 4JW0A 2CW0D 5EBDA 4S3SA 4CDDC 1ASYA 2QDBA 4C3IB 4ZKBB 4KI0A 1PV4A 4G7HC 3T1HQ 4A3DB 2C5CA 2QGQA 1V1OA 5ELFA 4RA8A 1V43A 3F2DA 4A3CH 1VQNA 4YY3L 5EPKA 1U9RA 3NPPA 3TP6A 2VB3X 1L1OB 1O7ZA 1Z47A 1L2FA 3BYTB 2KCCA 4B3ML 4CDFC 4GKKQ 1RTNA 2I0QA 3NTIA 1J8IA 1N34L 1S40A 2VL6A 4ALPA 2PCFB 5C5MA 4C56C 1BDOA 4K8JA 5KRUA 3S15B 2K28A 3S1MB 5ELNA 1AW7A 2TSSA 4IJLA 1IKMA 2SNMA 4E6IA 5C3XA 2BH8A 4IFDI 1X3GA 1CQVA 3OIPA 4EQOA 3FKIH 4A3IH 3CC2A 4LF8Q 2MJ8A 2R93G 5AFWA 4LUOA 1OXVA 1VQIA 4LFCQ 2UXDQ 1LT5D 3CCVA 3J81c 1PTOH 4LW1A 2R6GA 4RGTA 4GNXA 1C8CA 4OX9Q 5DNFA 2VB2X 3F1ZA 3W3AA 1BF4A 2YU9B 1B1ZA 4YWKA 4X6AH 1SR3A 2R61A 4MIUA 3ERQA 3RR5A 2QEJC 2ZM6Q 1YNNC 2AQ2B 1BBXC 1NBWA 3W1BA 5IE8A 4A76A 5DEHA 3BZKA 3G71A 4RFBA 1Z7TA 4BY1H 4ZRZA 1U5KA 1EUJA 3FDTA 2Z4IA 4DR3L 1VQBA 5FLMG 4R8NA 1MBYA 4DK3C 1J5EQ 2JA5H 1BR9A 1GVPA 2D9UA 1STYA 3S1QH 2B3GA 2IW3A 5NUCA 2LMCB 4LF9Q 4JI3L 4FYDA 3K80C 3TSSA 2OT2A 4DNTB 5CBAE 5GAGC 2J0TD 3HP3A 1A3VA 1SYFA 2B8FA 1FL0A 2R92G 2R7ZB 1EFID 3L7ZC 2KECA 3H3VH 1VQAA 4IFDG 1UE6A 2I5LX 3KF6B 2X6GA 3PQIA 4CHTB 3GTGB 1FNVA 1IBKQ 3F2UA 4DV1L 4UHVA 3PIP3 3EROA 3QJYA 4R4IA 3AB9A 4HJAA 1G2TA 1WTOA 4X66Q 3LGJA 3S1NB 1XTCD 3A74A 2CH4A 4B9XA 4GS3A 2QCPX 4EQNA 4A3FG 1HA5A 1CHQD 5JPMC 4ME3A 2VQFL 4P74A 3DLLA 1EQVA 3I56A 1PRTD 5CMDA 1SRUA 2DJGC 1R9TB 1SNQA 4DK0A 1Y1VH 1SJHD 4WJ4A 5M3FG 4LAAA 4PZ6A 1XNQL 4BY7G 3K57A 5CV7A 2F0OA 1P16A 3TREA 3HOZB 2YTYA 1Y1WH 3BVGA 5HY6A 4BBRH 3RMHA 5JJLA 3NEMA 4A93G 3PUZA 3PF4A 4G7ZC 2NVTH 4FF4A 1O7IA 1T9HA 1QVFA 5E1FA 4XT3B 2F0GA 4I7AA 3FPUB 4C3JH 1ZXTA 4LF5Q 2ATWA 5C4JB 1EY0A 1I94Q 2B39A 5E3FA 4AH6A 2F0FA 2LSSA 3L9AX 2PNHA 4OGQC 1DYQA 3NUCA 1PH6A 2NVXH 3ONAB 5EKLA 3VYRA 1HHVA 1BQQT 4DR6L 5M3MG 4N9TA 2RSOA 3FKIB 4A3IB 4JBWA 3VYUA 1A3TA 2B2UC 2NN6I 4C3HH 4OL7A 2IHEA 2EE1A 4QMGA 3SK8A 4DXGA 1PTOB 2ZXRA 1JORA 4P75A 1KD1C 2HCIA 2B2TC 1HQMC 4LMQD 3T1HL 5BN3A 5EGTA 3AYHB 3Q0AA 4DV3Q 1VQ7A 3KFUA 1VS0A 2UXCQ 3IAYA 4BY1B 2HDLA 5CV6A 5FK9C 4APVA 2DY8A 1GM5A 4X3SA 2F0SA 1JWMD 2F4VQ 4IUPA 2HIVA 4Q0FA 2H4OA 1L1OC 3STBD 3VDYA 3S1QB 3O13A 1XJVA 1JB7A 1QNUA 2JA7G 1IKLA 3IRBA 4XTCS 4DR4Q 3D3RA 5CV4A 1K83H 1PMRA 2AUJD 2WACA 5C0XG 1A3UA 1LO5D 2F4IA 2QILA 4NPSA 3SEBA 1BCPF 3D4RA 4TQUS 2NN6G 2L11A 4M8AA 1IHZA 4YHHQ 4LFCL 2F0QA 2UXDL 2OQ0A 3CCEA 2IWHA 1CHPD 2F0KA 4KY5A 4RAUC 1WFQA 1SXTA 2ZXOA 1EOTA 1I50H 4OX9L 4IUUA 3A0JA 1N36Q 1DOKA 5A2QL 3J80L 1V8QA 5D3DA 1WOCA 2F0WA 2ZM6L 1NCVA 1HQRD 1Y1VB 3T56B 3ER0A 4IPGA 1C7YA 5D65A 4L8JA 2UUAQ 3E0JA 3EIVA 2K52A 3D4WA 5ELCA 2CW0C 1LT3D 1Y1WB 1J5EL 4BBRB 5BN5A 5K36H 3N52A 2Z4HA 4JI4Q 4LF9L 4A3DG 1JJCB 2PZTA 3DEPA 4GLXA 2B2TA 3KLRA 5IY0A 1F2MA 4J6HA 1U4RA 2NVTB 3PSIA 1R4QB 2QKIC 4C3JB 3C1EA 5IYBG 1KQSA 5FLMH 3C0NA 4O0AA 2ICIA 1M8AA 4IJHA 3CMEA 1B53A 4RMFA 4Z9CB 1T5XD 5CGKA 1W6JA 5FJ8G 3C0MA 1D5MC 1O7YA 2L55A 1B44D 3MXUA 4X66L 1HPCA 1FNUA 1L1OA 2NVXB 2EYJA 5FOBB 2IL8A 2E75C 5AJ3Q 3SK4A 2R92H 4Y7NH 2JEBI 1XMOL 3MZ5A 3TP8A 1G91A 1M1KC 4IFDH 4OWXB 2A1AA 1DM0B 4WFN3 1Q1BA 2UUBQ 1X54A 2B2VC 1H9SB 1KAAA 2AQ1B 4EQPA 4HJ8A 3HOXB 4A3FH 2JXMB 3BZCA 1C0AA 1TS3A 2JP1A 3EQLC 1JMCA 1FNWA 2EXZA 1IYVA 5EQ0A 1EIGA 2D5DA 1Y14B 2I5HA 4V0BA 4AIMA 3PUYA 2E2DC 4LF5L 2FMCA 3S16H 1A62A 1I94L 1QE6A 2Z6KC 4DN4M 3OW2A 3BDOA 4HIOA 4DNIA 1K83B 2K5WA 3I73A 1K9MC 3MEHA 4KHPQ 2K04A 4KN4C 1MGSA 4JI8L 4DV0L 4AYBB 1D1KA 1X55A 2ZXPA 2E8GA 2Q8TA 2BE5D 3NHHA 4YIJA 1JJ2A 1PTOC 1I50B 3S14H 4GKJL 5JJKA 3KF6A 2DGYA 1SDFA 2EY6A 2CQOA 2KHIA 4EQ5A 1ESFA 3JAMc 3I90A 2JA9A 2F0UA 1YHAA 1H9KA 1HNWL 1YIJA 3TN2A 3S2HH 4UP8A 1OXUA 1DOLA 1KRSA 2K5HA 5GROA 2CCZA 3HOZG 3P75A 2NZOA 3DM1A 1XX8A 4ILWA 4H0LC 4KMUC 5A35A 3ULPA 3HOYB 2V4DA 5C4ZA 2B2VA 3WOEA 3D0FA 1NY4A 3CRLC 3EA6A 2HQEA 3BDLA 4LUZA 1WTHA 4DR5L 3J7AV 1IW7C 1SFOH 4YWLA 3K7UC 3DM3A 3OTOQ 4LF6Q 2A6ED 2MQHA 4OXPA 1PH7A 1YVCA 4YHHL 1PLFA 2F0NA 1WJJA 4PG3A 1HFNA 2R7DA 4DKAC 3PIPA 2PZWA 4H44C 5A2QE 1Q86C 2N78A 4Y7NB 1JCKB 1ENAA 2R92B 4IUNA 4KHZA 4K6LA 3C3LA 3FKIG 4A3IG 1YJ9A 1XYIA 4CDCC 4A3EG 1SBBB 4G57A 4XDXA 3DWQA 4IOAA 1ESRA 2NN6H 2UUAL 2K32A 3VR2A 2K6AA 4EX5A 1B3QA 5JEAJ 4DAYB 2A5HA 3CCSA 1SMYC 2KBNA 2PO4A 5IP7G 3A5ZB 4KHVA 4MHEA 4A3FB 3FVQA 1PA6A 1MSHA 4HJ7A 4JI4L 1VMCA 4RCNA 2Y0SE 3E9IA 1NMGA 2NTTA 2B2YC 1EYGA 2E2JH 4JI0Q 3RLNA 1PH2A 4BY1G 2PMZE 3NP8A 4RKLA 1N32L 2K1BA 3PUXA 1QUQB 4DUYL 2EJGC 2JE6I 3PGZA 3S16B 4QQBX 2WKDA 1PVOA 2A74C 3U9SA 2OTLA 2CQAA 1A2UA 1BCPB 4TRDA 2PQEA 1F2LA 3MXGA 1E0BA 1OO9B 2Z6BA 1Q81C 1SEBD 4X65L 5CR3A 2A6HD 5J3BA 1AZPA 1STEA 1JB3A 1STNA 1YNJC 2KCNA 3H91A 1TVXA 2NZ1D 5LMNQ 4JYAQ 1RDPD 4JBMA 1JWSD 1K0SA 1HH2P 1Q82C 3AFQA 5KNBA 3S15H 2K03A 1ENFA 2LS01 5COYA 3J81L 2N55A 2PW5A 1A15A 2F3WA 1CKMA 2VW9A 1X32A 2XNAC 1XPOA 5C3WA 4QIWE 2QF7A 1VQCA 2F0LA 3HKZB 3SK6A 4C2MH 2L4NA 5EKKA 1Y1WG 2EYOA 4IFDJ 2K5VA 2WFWA 3MVVA 1BBWA 1TS4A 4BBRG 2ZTDA 1Q12A 2AWNA 3V96A 1QJOA 4UP9A 1CA5A 1NSNS 3EVQA 4K5VA 1EZ6A 4KHPL 1EEID 2EXDA 4OWWB 2ES2A 1KAWA 1PXUA 1SFOB 3NWSA 1HJPA 2D0OA 4C3JG 4WJWA 2B2YA 1YI2A 4EVOA 1PRTF 3NBHB 5M5WH 4B3TQ 3H15A 5BN4A 5E4WC 3T53B 4F88A 2ZJPA 1EWHA 2AHOB 4HMJA 3MFGA 1HUMA 3PUWA 3PV0A 1ILQA 4HJ5A 1XNRQ 2AMCB 1EWIA 2K50A 4KKSA 4CDEC 2IPKD 1SNPA 3L3OC 4B08A 5KIXA 1NJIC 1VQDA 3KK7A 1IBLQ 1F9QA 3SE0A 5KYIA 1EY4A 1S5DD 5H1SE 1PH1A 3OOCA 3PUVA 4IUVA 3J7ZC 4X62L 2RBMA 4L5RC 3KJOA 1WTQA 3F8TA 4CGYB 3KOJA 1B8AA 3HOXG 5J1ZA 2WB1E 2XWBB 3HOUB 3VA5A 1F9SA 3I4MH 3Q23A 1ONLA 1H9SA 1Y8NB 5J39A 4HTHA 4DUZL 3SVMA 3RN2A 5KGUA 1GUNA 4F87A 1DD2A 4WORA 2YTXA 4LF6L 3HOZH 3GP7A 3E9HA 1BO0A 4BXXH 3EFXD 4JCVE 1ILPA 4I7ZC 4AYBG 4L6TB 1Y8PB 3CCUA 2KCTA 1K3RA 5C4JH 2Z0SA 2RVLA 3C46A 2BE5C 1VQ5A 1AZQA 1D5XC 1PYWD 4JI7Q 3DUZA 5FO7B 2K5NA 2SNSA 4XQJA 4X3UA 2KEDA 3DWAA 1KLGD 1L0YB 4XT1B 3GTQB 2JQOA 4BA1I 3TDQA 3I4NG 5J22A 4R9WA 1E3PA 3C1FA 4IQZA 4A3EH 3MFYA 3HOWG 2EYFA 3L0OA 4ZQ3A 3K5NA 4JI0L 3OWFA 2A69C 5ELOA 3U50C 4C2MB 1N33Q 3J80i 4K5WA 5ELBA 1UAPA 2EPBA 4OEMB 5C0XJ 2VS1A 5M9OA 1F9RA 1TXYA 1JOQA 1J6QA 2ID0A 5IP7H 5K36G 1ZYRD 4X64Q 2MGSA 3URYA 3OYYA 1UWVA 2YYZA 3HOYG 2EDGA 4J1MA 1X3EA 1BCPC 1TS5A 5E7NA 3BDCA 5FKAC 1M90C 4OO1I 1EY9A 4GN3B 2VXWA 2K5DA 1RKNA 3CQZH 4FXGC 5M5WB 4JG2A 2A68C 3CCRA 1KHIA 1TWHH 4JYAL 4KN7C 1PH5A 4RH6A 3PO2G 1VQLA 1SNCA 1E24A 3R8BA 1F2YA 1AEXA 1GOZA 1YZ6A 5KYLA 3OMCA 3D6CA 4JC0A 1JQYD 4OONA 3A7LA 4LFBQ 4BBSH 1PHJA 4J8QA 2PQAB 1Y8OB 1ZKOA 3SK5A 1SLJA 3CRKC 1K8MA 2IJ0A 4O42A 3T1YQ 2RDGA 1PH9A 1VQKA 2F0TA 4POGA 5IYCG 3NE5B 2EVBA 1D8LA 4MTKA 3I4MB 3QOJA 3FP9A 2UUCL 3NBIA 4DAYA 2K7VA 2UXBQ 4OO1G 1X9NA 2CHBD 1HUNA 4DAVA 5LMUQ 1DGSA 1X56A 4LF4Q 1TQOA 4DGZA 4R4OA 4P73A 1QUQA 2VY3A 1RF2D 1D7QA 4QF4A 1W2BA 3G4OA 3HRZC 4ME5A 1IBLL 3RZOH 4OELB 2NVQH 2MPMA 5JJIA 1B4OA 1G291 2YV5A 1PZID 3K0XA 4JBKA 3B6YA 3D6WA 4ZYSA 5HGQA 1KNEA 1BUVT 1HR0W 2Z8LA 3QO2A 5IT9c 4A3EB 1PFBA 1SE3A 3GQBA 3WWVA 5BR8Q 4QCLA 3F2CA 1YITA 3I3CA 2PI2E 1CM9A 3P20A 3HKZG 4CJ0B 1QB5D 1QZGA 2FFKB 1MIUA 1YBYA 4QY7A 3HOXH 1PRTB 4MZ9A 3H0GG 1Q90A 3BVMA 5LMNW 3SR1A 4HIDA 1KC8C 3NWTA 3CQZB 1E22A 1KDCA 5JPNC 1TWHB 1GO3E 4GKKL 2XIWA 3HFZB 3KLSA 2KOLA 2ZJQA 1KRTA 1B2TA 2FHTA 3IFTA 2JEAI 5GADC 2B63B 1STBA 1SYGA 1YNXA 1IL2A 2ZTEA 2O4XA 3NBHA 3MAQA 2P5ZX 3GTLH 1EQRA 1VQ6A 4UY8C 3RD4A 1NUCA 4BBSB 3JAML 3F2BA 2EJFC 4DA2A 4JVZA 4LF8L 1R4PB 2DUDA 5HURA 1NMFA 2IX1A 3PO3G 2BOSA 1KNAA 2E76C 5JVH3 2OF1A 2EIFA 1SE8A 3GTPH 5E4XA 3I70A 2KHSA 2NBFA 5HGTA 3R3OA 3I4NH 3K5MA 4DXFA 4GOPB 5EPLA 3GTKH 3HOUG 3HOWH 3SXHA 2CVRA 1U4PA 1FGBD 2G9DA 2B2UA 3EBEA 3KYHC 1HNXQ 2WB1G 3WDNA 4RWSC 1SYCA 1EY7A 3UDFA 2F52A 3M9BA 1PDQA 2I46A 3HOYH 2VUMH 1O7LA 4Q5VA 2KVMA 1DJRD 5CV5A 5IWAQ 2RF4A 2AKWB 1FJGQ 2ZJRA 2DN8A 4RGMA 2EOTA 2QEXA 3RZOB 3MXNB 2NVQB 1IBKL 1Q46A 1G6ZA 1EIHA 3K8AA 3OPOA 4RG1A 4YCUA 3PO2H 1NTGA 3D4DA 1B70B 4EGVA 1EY6A 1HZCA 3M4YA 4KTAA 1QCBD 2O5IC 2QDLA 4B3RQ 1WI5A 3BJUA 4MTNA 1CSQA 4V190 4IPDA 3ICEA 2OEOA 4TKOB 1XWEA 1A63A 3J81i 1LTSD 5FLXc 4LNQA 4CKEA 2RCFA 4PZ8A 2UXBL 1V1PB 4NW2A 2FXQA 5T1GA 1XPRA 2WAQE 2D62A 4JI2Q 2XWJB 2E2HH 1CFMA 4A3MG 3QR8A 5IYCH 4G7OC 1FR3A 4DFAA 5IODA 1XMQQ 1B7YB 4B3SQ 4A3BH 2AUKA 4OO1H 2KHJA 4QJFA 1DONA 3TP5A 4DV2Q 2UU9Q 4HCEA 1GJXA 3MXPA 2J4XA 1KTKA 1T5EA 2M2LA 3GTLB 1PZJD 3I2ZA 5IGBA 4FP5D 3Q24A 1TWAH 3AQQA 4XIGS 4P2CB 4ZKCB 4DV7Q 5IGCA 3W1GA 1WVLA 4DAMA 3GTPB 1S3OA 5EAYA 2HHHQ 3CAMA 1S5FD 1RJTA 4ZUJA 3IKJA 1ET6A 1ET9A 3I4NB 2LY7A 1PZKD 4K6DA 3GTKB 5I2XA 5CC4A 1DCZA 3QIAA 4DV3L 3I4MG 3HOWB 1PRTC 2K33A 1W6KA 2UXCL 1SROA 2KJXA 2N88A 3K58A 4AQYQ 2F4VL 2QA4A 4NXNQ 4POFA 2NWGA 3BYYB 3LWUA 5KEEA 2CWPA 4DV4Q 1K8OA 2CWAA 2SOBA 1G51A 1PREA 2VUMB 4DR4L 1W3SA 1RL2A 1LABA 5IP9G 3H0GH 1IBMQ 3CHBD 2DNCA 1LT4D 2LFNA 4BXXG 1CQFA 4UPAA 2PNRC 3RN5A 4HEDA 4F8MA 3JAME 1LTGD 2E5LQ 1A8VA 5I9OA 1PYBA 3I4LA 3PO2B 2K5QA 3GTMB 2BA1A 5ELDA 4PMWA 3UE1A 4KKUA 5EPJA 1V1QA 4JBJA 2K14A 4C1NI 1EIFA 3J80E 1N36L 1D1IA 3VR4A 4B9WA 1VQHA 4NXMQ 2Z6KA 1ZEQX 1HA6A 1WTRA 2Q2UA 2R3ZA 1OXSC 1WYDA 4HSVA 3DMUA 3RLFA 2C9OA 4UP7A 1CZWA 1SJED 5L37A 4GOPC 4JK1C 2JN4A 3D31A 2Q8RE 1I5FA 4P72A 4R8IA 2BH2A 4JOIC 1JE4A 1UE5A 1VQGA 2RCNA 1HNXL 3PO3H 3MTSA 1LTLA 2E2HB 4YY3Q 2FMMA 1NNXA 1K8GA 5CYUA 1STGA 2C35B 1HR0Q 3QB3A 1Q7YC 3HOUH 3DWPA 4DV5Q 1SE2A 2JJQA 4A3BB 1TWGH 2PYKA 4JI1Q 5LHY1 2N49A 3ND8A 1C48A 2B8GA 2MFIA 3STBC 2NVYB 2Y0SB 5IGEA 2B63G 2PMZB 3PIO3 1KABA 3UDXA 4FF3A 1TKWB 3QWNA 1RHPA 3X3NA 1EU3A 1TIID 1ENCA 1UUPA 4CKCA 5AJ3L 3CPFA 1BKBA 1STHA 1VCIA 1DXMA 1I4RA 4RGNA 2OXPA 4KJOA 5GQOA 1TWAB 3TP7A 3KF8B 1VF7A 5EJWA 3HOVB 4BBSG 4HR7B 4MN3A 2A73B 1GUSA 3K81C 1VQ8A 3S17H 5D14A 4HMIA 3AEVA 1ML0D 1K0RA 2JA6B 2UUBL 1NR2A 1SAPA 2GN5A 1EQQA 3ERSX 2ZTCA 4LK1C 1LLRD 2E2IH 3GTQH 4DR3Q 4RGOS 1WTXA 2KA7A 1CK1A 2MO1A 1MHWC 2B2WC 1EFWA 2EJMA 4FF2A 4CKBA 4OWTB 1XMQL 1WTVA 4FXKC 1TS2A 3M7NA 4JI3Q 1HZBA 1ICWA 4ZUIA 4K14A 1P8LA 3G6EA 4GOPA 2WP8J 3KLWA 4JOIA 3A55A 3H0GB 3NELA 3MHBA 4QIWB 4A3MH 3PMFA 1PH3A 5M5XB 1GHJA 3NSWA 1X65A 4A3GH 4HIKA 3OMGA 3RUZA 1Z9FA 3KUPA 3FHWA 3TBIB 3VR3A 1STAA 1LYLA 5JJZA 2LXKA 3I72A 1G8ZD 2VQFQ 3TZUA 4LWCA 3A8IE 3HEJA 4XXEA 4ZLTF 5JVG3 5KNDA 3TZDA 5C4XB 3MXNA 4UDUC 1XNQQ 1JE5A 1HTPA 3GV6A 5D3IB 3S9WA 1RD9D 4R4QA 1TWCH 1PFSA 2RHSB 4UAIA 1QVGA 1LTTD 1HFGA 4AQYL 3PO3B 2QW7A 4RHRA 1CT1D 1EEFD 1GUOA 2FINB 3NQIA 4DV4L 3HG9A 3AFPA 1DZ1A 1TU2B 3QG1A 2L0CA 4A3KG 1V1PA 1D5ZC 2M9VA 1TWGB 1XXGA 4GNXC 1SNOA 1NAPA 1XPUA 1H9JA 2SEBD 2VNUD 1FYCA 2X6LA 3K6OA 2WB1B 1MJEA 3OTOL 5C3EH 1B3AA 3J7AF 2EY2A 3KDFB 5CORA 1LTID 1E2VA 2AWOA 1TT2A 3W5OA 3S2DH 4LFAQ 3KLSX 1SN8A 2VQEQ 5IP9H 2D2CC 2NB0A 1AFPA 3I55A 4NXML 1I3QH 5T1IA 2Q2HA 2EYMA 3AMUA 4WJ3M 3R2TA 3OSOA 2BDOA 4A3LH 2ICEC 1CUKA 4OIJA 4JI5Q 3S17B 5IT9L 3A56A 1YHQA 1MKHA 4HAEA 3A54A 3NENA 1CZGA 4GN5A 3CC7A 3JAMi 5I9PA 2XTIA 3IFDA 3H6MA 4R1JA 5JEAG 2E2IB 1EU4A 1EY8A 1OXXK 1Q3LA 2LKVA 1SYDA 3P1HA 1GHKA 1SNMA 1HR0L 2F3IA 3NTKA 4IZ8A 4DV5L 1KIXA 2X69A 4L5QA 3U4ZA 2EZVA 1CKNB 4RKBA 3CU7A 1S72A 1Y69U 3J7YW 4JI1L 3M4OH 2PPBC 1Q8KA 1EIYB 3KBXA 1EOVA 1Z6HA 4A3MB 2VUMG 4F7XA 4CJ2C 5DLQE 2ASBA 3R93A 1HCZA 4A3GB 3RLOA 3NTHA 3KBGA 3M4PA 1XTDA 1EWCA 5LMNL 3R2IA 4JI6Q 2Z9HA 1AE3A 5DM73 4ZCKA 2A6EC 2KQ3A 3U4VA 2H5XA 5FO8B 1Z52A 3TS0A 3J81E 3BG3A 2B63H 4WRDA 3UE0A 3QOLA 1I4PA 3GTJH 4K0KQ 4DR2Q 4DNRB 1TWCB 3ITPA 2F0EA 1SSOA 1B9NA 3VR6A 4U673 1FVIA
chains in the Genus database with same CATH topology
2PW7A 1WD1A 4QUCA 4XYOA 4BS9A 2XRSD 4A3JB 5I4DA 1S5CD 3U9OA 1GUGA 1PTOD 5C3EB 3V2TA 1SE4A 4X3KA 3S2DB 5C44B 2EYLA 1KDAA 2IX3A 1OXTA 1UNSA 1I3QB 2MUYA 1TY2A 3G4NA 2A6HC 5EBCA 4FXDA 5G3LD 4BA2I 2F0PA 4KD3A 1D6EC 1QWYA 3A8KE 5FLXL 3KF8A 3I91A 1S5ED 3OW7A 1C4QA 2AQ3B 1IW7D 5CBEE 3VA7A 2BCOA 4CBVA 2RA4A 1HTLD 5F2DA 2JSOA 3HS0C 5I6YA 5IGGA 2HDMA 4KD4A 3M4OB 2FJ2A 2E74C 3P7JA 3FPPA 5IIFA 4IUQA 5C0XI 1E2ZA 4QUFA 3T13A 3AU7A 2KEEA 1BOSA 2K01A 3NQTA 2NUCA 1SYEA 3C0OA 5DM63 3SHLA 4DF7A 4KJNA 1EYAA 1SMYD 5IT9E 4NMZA 4FNFA 2ENBA 2F0IA 2F3VA 5IGFA 3T51B 3H94A 3GTJB 4KV6A 1B50A 5ISRA 4I65A 4M1UB 1GUWA 1X3QA 5DAUA 4IN3A 4IALA 2JA5B 1O80A 2XVSA 4LJZC 3Q6SA 1LTAD 3IL8A 2L9HA 1QG7A 2F0MA 1VF5C 2XN9C 2DNEA 1EL0A 5JEAH 3A7AB 3GD7A 4ZAIA 1YNJD 1I6HB 2K05A 1X3PA 3FRPB 3A8JE 4G4KA 2IX0A 1F2ZA 4OIKA 2F0HA 1JOOA 1WTPA 1LTRD 2H1EA 3M7GA 5C6AA 1U4LA 4ODGA 5KNCA 1EQTA 1F77A 3K7AB 1GUTA 3I8ZA 4C3IG 5C4HA 2KUMA 3TMEA 1LTBD 1PFNA 3T4AC 1AP0A 3X3MA 4K8IA 1RTOA 1Q8IA 1WCMB 2JA8B 3MC0B 4PQXA 1F9PA 1B9MA 3NK9A 1QOHA 3UI2A 3CKIB 4XYQA 5CV8A 3DEOA 3HZXA 2Q8IB 2J7ZA 1RODA 2BDNA 4HN7A 2HUGA 1SYBA 1M4VA 1ZYRC 5JAVA 3ND9A 4NKLA 3MWYW 3NXWA 4ULLA 3FMCA 5I2YA 4A3KB 4C3HB 4KK7A 3DXJC 3K5LA 2WAQB 4XQNA 2RSNA 3H09A 1WTWA 1JICA 4TSSA 1E2WA 4C1NK 5FLXE 3G6JB 2TMPA 2XRQD 4PMCA 1VMPA 1JWUD 1BXTA 1I4XA 1IYUA 1LT6D 1TWFB 3E5SA 2L1BA 4XQQA 5C5LA 2HCCA 4HSPA 1QNKA 1I4GA 1SNDA 4PMBA 2MP1A 4ABNA 4QB4A 1I4QA 2F0JA 4RHSA 1L0XB 2I07B 1TY0A 3GO5A 2JYOA 2WV6D 2RDHA 5LL6S 2F0VA 3VYSA 1CTMA 4OHJA 1O78A 2NYZD 5IGDA 4BWGB 3MA2B 1MI2A 5I6WA 4ID6A 5K5PA 2IT1A 3HGBA 2EYPA 4N9PA 2A69D 2R93B 2NTSA 3N6RA 3BZDB 1KDBA 1Q1EA 3M85A 3OWEB 2RKSA 4KKTA 3C2PA 3ZYYX 2G9HD 1JR0D 1EY5A 1WD0A 4K2KA 1BCPD 1YNND 3RZDB 4DAPA 3K5OA 3H3VC 4DU9A 2A68D 2DY7A 5IOCA 3D8GA 2MHVA 2BA0A 1I6VC 3W2DA 4ZK9B 5ELEA 3BS1A 1DOMA 1II3A 2RDFA 3K59A 2EYHA 1TR5A 1AN8A 4NDXA 1VDZA 1UEAB 5C0XH 4FF1A 3VYTA 1J9OA 4U68A 2XSCA 3DHQA 4RCOA 3VR5A 3E6ZX 3BVZA 4L63B 4H13C 4KY6A 3LNNA 4K2LA 1GXDC 4FVMA 1A2TA 5M3FB 3OHXC 3WOFA 2WKCA 1NR4A 4BY7B 5JOBA 3V05A 2ZT9C 2EY5A 4NP5A 1RCVD 2PZUA 4PNYA 1I4HA 4CJ1B 5FO9B 3K0YA 1D2BA 2Z1CA 1FD7D 2L12A 1U4MA 4GZYC 4A93B 3OIQA 4KY7A 1CA6A 1G2SA 2L5TA 1KLUD 4O1NA 2O2LD 3S14B 1MD2D 4X3TA 1LV9A 1PFMA 4IUTA 1A6XA 5M5YB 1IL8A 2O5JC 3S1RB 1LACA 5M3MB 1HRJA 3LWEA 1JC7A 4K5XA 3S2HB 5LL6X 1QILA 2EY1A 5EKIA 5TSSA 1H9RA 5CV9A 3T16A 1MSGA 1PTOF 3M3YB 3EJIA 2F0DA 4FO2A 1S4ZA 3SDZA 1S5BD 1EYCA 2JA7B 3G7LA 3FEWX 4PV1C 4DK1A 5G3LF 3Q22A 1H9MA 4H7BA 1EZ8A 4HCSA 2WINB 2F03A 4C3HG 3GTOB 2WIIB 2M00A 1JOKA 2SDFA 4IURA 1BNZA 2B2WA 2F1MA 2RQXA 2E2JB 1HXYD 1EYDA 2GA4B 1CI3M 3GV3A 3LX0A 5EBDA 2CW0D 4S3SA 2QDBA 4C3IB 4ZKBB 4KI0A 4G7HC 4A3DB 2C5CA 1V1OA 5ELFA 4RA8A 1V43A 5EPKA 1U9RA 3NPPA 3TP6A 2VB3X 1O7ZA 1Z47A 3BYTB 2KCCA 1J8IA 1RTNA 3NTIA 2PCFB 5C5MA 4C56C 1BDOA 4K8JA 5KRUA 3S15B 2K28A 3S1MB 1AW7A 2TSSA 1IKMA 2SNMA 4E6IA 5C3XA 4IFDI 1CQVA 3OIPA 4EQOA 2MJ8A 5AFWA 1OXVA 1LT5D 1PTOH 2R6GA 4RGTA 1C8CA 5DNFA 2VB2X 3W3AA 1BF4A 2YU9B 1B1ZA 2R61A 4MIUA 3ERQA 2QEJC 1YNNC 2AQ2B 1BBXC 5DEHA 4RFBA 1Z7TA 4ZRZA 3FDTA 2Z4IA 4R8NA 1MBYA 1BR9A 2D9UA 1STYA 2IW3A 5NUCA 2LMCB 4FYDA 3TSSA 2OT2A 4DNTB 5CBAE 2J0TD 3HP3A 1A3VA 1SYFA 2B8FA 2R7ZB 1EFID 3L7ZC 2KECA 4IFDG 4CHTB 2X6GA 3GTGB 1FNVA 3F2UA 3PIP3 3EROA 3QJYA 3AB9A 1G2TA 1WTOA 3S1NB 1XTCD 4B9XA 2QCPX 4EQNA 1HA5A 1CHQD 5JPMC 1EQVA 1PRTD 5CMDA 1R9TB 1SNQA 4DK0A 1SJHD 4LAAA 3K57A 5CV7A 2F0OA 3HOZB 3BVGA 3RMHA 3PUZA 4G7ZC 4FF4A 5E1FA 4XT3B 2F0GA 3FPUB 1ZXTA 5C4JB 1EY0A 2B39A 5E3FA 2F0FA 3L9AX 4OGQC 1DYQA 3NUCA 3ONAB 5EKLA 3VYRA 1HHVA 1BQQT 4N9TA 2RSOA 3FKIB 4A3IB 4JBWA 3VYUA 1A3TA 2B2UC 2NN6I 4OL7A 2EE1A 4QMGA 3SK8A 4DXGA 1PTOB 2ZXRA 1JORA 2HCIA 2B2TC 1HQMC 4LMQD 5BN3A 5EGTA 3Q0AA 3IAYA 4BY1B 2HDLA 5CV6A 5FK9C 2DY8A 4X3SA 2F0SA 1JWMD 4IUPA 4Q0FA 2H4OA 3S1QB 3O13A 1QNUA 1IKLA 4XTCS 3D3RA 5CV4A 1PMRA 2AUJD 2WACA 5C0XG 1A3UA 1LO5D 2F4IA 2QILA 3SEBA 1BCPF 3D4RA 4TQUS 2NN6G 2L11A 4M8AA 1IHZA 2F0QA 2IWHA 1CHPD 2F0KA 4KY5A 4RAUC 1SXTA 2ZXOA 1EOTA 4IUUA 1DOKA 5A2QL 3J80L 1V8QA 5D3DA 2F0WA 1NCVA 1HQRD 1Y1VB 3T56B 5D65A 4L8JA 3E0JA 3D4WA 5ELCA 2CW0C 1LT3D 1Y1WB 4BBRB 5BN5A 5K36H 3N52A 2Z4HA 2PZTA 3DEPA 2B2TA 3KLRA 1F2MA 4J6HA 1U4RA 2NVTB 1R4QB 2QKIC 4C3JB 3C1EA 3C0NA 2ICIA 1M8AA 1B53A 4Z9CB 1T5XD 5CGKA 1W6JA 3C0MA 1D5MC 1O7YA 2L55A 1B44D 3MXUA 1HPCA 1FNUA 2NVXB 2EYJA 5FOBB 2IL8A 2E75C 3SK4A 2JEBI 3MZ5A 3TP8A 1G91A 4IFDH 1DM0B 4WFN3 1Q1BA 2B2VC 1H9SB 1KAAA 2AQ1B 4EQPA 3HOXB 2JXMB 1TS3A 2JP1A 3EQLC 1FNWA 2EXZA 1IYVA 5EQ0A 1EIGA 2D5DA 4V0BA 3PUYA 2E2DC 2FMCA 1QE6A 4DN4M 3BDOA 1K83B 2K5WA 3I73A 3MEHA 2K04A 4KN4C 1MGSA 4AYBB 1D1KA 2ZXPA 2Q8TA 2BE5D 3NHHA 4YIJA 1PTOC 1I50B 1SDFA 2EY6A 1ESFA 3I90A 2F0UA 1H9KA 3TN2A 1OXUA 1DOLA 3P75A 3DM1A 4ILWA 4KMUC 1XX8A 4H0LC 5A35A 3HOYB 2V4DA 5C4ZA 2B2VA 3WOEA 3CRLC 3EA6A 2HQEA 3BDLA 3J7AV 1IW7C 2A6ED 1PLFA 2F0NA 1HFNA 2PZWA 4H44C 5A2QE 2R92B 4Y7NB 1JCKB 1ENAA 4IUNA 4KHZA 4K6LA 3C3LA 1XYIA 1SBBB 4G57A 4XDXA 3DWQA 1ESRA 2NN6H 2K32A 3VR2A 2K6AA 5JEAJ 2A5HA 1SMYC 2PO4A 4KHVA 4MHEA 4A3FB 3FVQA 1MSHA 1VMCA 4RCNA 2NTTA 2B2YC 3NP8A 4RKLA 2K1BA 3PUXA 2EJGC 2JE6I 3S16B 2WKDA 2A74C 3U9SA 2CQAA 1A2UA 1BCPB 4TRDA 2PQEA 1F2LA 3MXGA 1E0BA 1OO9B 1SEBD 5CR3A 2A6HD 1AZPA 1STEA 1JB3A 1STNA 1YNJC 2KCNA 3H91A 1TVXA 2NZ1D 1RDPD 1JWSD 5KNBA 2K03A 1ENFA 2LS01 5COYA 3J81L 2N55A 2PW5A 1A15A 2F3WA 1X32A 2XNAC 5C3WA 3SK6A 2F0LA 2QF7A 3HKZB 2L4NA 5EKKA 2EYOA 4IFDJ 3MVVA 1TS4A 1Q12A 2AWNA 3V96A 1QJOA 1CA5A 1NSNS 3EVQA 4K5VA 1EZ6A 1EEID 1PXUA 1SFOB 3NWSA 4C3JG 4WJWA 2B2YA 4EVOA 1PRTF 5BN4A 5E4WC 3T53B 4F88A 1EWHA 4HMJA 3MFGA 1HUMA 3PUWA 3PV0A 1ILQA 4KKSA 2IPKD 1SNPA 3L3OC 4B08A 5KIXA 3KK7A 1F9QA 3SE0A 5KYIA 1EY4A 1S5DD 3OOCA 3PUVA 4IUVA 2RBMA 1WTQA 4CGYB 5J1ZA 2XWBB 3HOUB 3VA5A 1F9SA 3Q23A 1ONLA 1H9SA 1Y8NB 5J39A 4HTHA 3SVMA 5KGUA 1GUNA 4F87A 1DD2A 4WORA 3GP7A 1BO0A 3EFXD 1ILPA 4I7ZC 4L6TB 1Y8PB 2RVLA 3C46A 2BE5C 1AZQA 1D5XC 1PYWD 3DUZA 5FO7B 2SNSA 4XQJA 4X3UA 2KEDA 3DWAA 1KLGD 1L0YB 4XT1B 3GTQB 4BA1I 3TDQA 5J22A 4R9WA 3C1FA 4IQZA 3MFYA 2EYFA 4ZQ3A 3K5NA 3OWFA 2A69C 4C2MB 4K5WA 5ELBA 1UAPA 2EPBA 5C0XJ 5M9OA 1F9RA 1JOQA 2ID0A 5K36G 1ZYRD 2MGSA 3URYA 2YYZA 2EDGA 4J1MA 1BCPC 1TS5A 3BDCA 5FKAC 4OO1I 1EY9A 2VXWA 2K5DA 1RKNA 4FXGC 5M5WB 2A68C 4KN7C 4RH6A 1SNCA 3R8BA 1F2YA 1AEXA 1GOZA 5KYLA 3OMCA 3D6CA 1JQYD 3A7LA 4J8QA 1Y8OB 1ZKOA 3SK5A 3CRKC 1K8MA 2IJ0A 4O42A 2RDGA 2F0TA 3NE5B 2EVBA 3I4MB 3QOJA 3NBIA 4DAYA 2K7VA 4OO1G 2CHBD 1HUNA 4DAVA 1TQOA 4DGZA 1RF2D 4QF4A 3G4OA 3HRZC 4ME5A 2MPMA 1B4OA 1G291 1PZID 3D6WA 4ZYSA 1KNEA 1BUVT 2Z8LA 3QO2A 4A3EB 1PFBA 1SE3A 3GQBA 4QCLA 3I3CA 1CM9A 3P20A 4CJ0B 1QB5D 2FFKB 1PRTB 1Q90A 3BVMA 3SR1A 3NWTA 3CQZB 1KDCA 5JPNC 1TWHB 2XIWA 3KLSA 2KOLA 1B2TA 2FHTA 3IFTA 2JEAI 2B63B 1STBA 1SYGA 2O4XA 3NBHA 3MAQA 3RD4A 1NUCA 4BBSB 3JAML 2EJFC 4DA2A 1R4PB 5HURA 2IX1A 2BOSA 1KNAA 2E76C 5JVH3 2OF1A 5E4XA 3I70A 2KHSA 2NBFA 5HGTA 3R3OA 3K5MA 4DXFA 5EPLA 3SXHA 2CVRA 1U4PA 1FGBD 2G9DA 2B2UA 3WDNA 4RWSC 1SYCA 1EY7A 1PDQA 2I46A 1O7LA 4Q5VA 2KVMA 1DJRD 5CV5A 2DN8A 4RGMA 2EOTA 3RZOB 2NVQB 1G6ZA 1EIHA 3OPOA 3D4DA 4EGVA 1EY6A 3M4YA 4KTAA 1QCBD 2O5IC 4V190 2OEOA 4TKOB 1XWEA 1LTSD 4CKEA 1V1PB 4NW2A 5T1GA 2D62A 2XWJB 1CFMA 4G7OC 1FR3A 4DFAA 5IODA 2AUKA 4OO1H 1DONA 3TP5A 4HCEA 1GJXA 3MXPA 2J4XA 1KTKA 1T5EA 2M2LA 3GTLB 1PZJD 5IGBA 4FP5D 3Q24A 4XIGS 4P2CB 4ZKCB 5IGCA 1WVLA 3GTPB 1S5FD 1RJTA 4ZUJA 3IKJA 1ET6A 1ET9A 3I4NB 2LY7A 1PZKD 4K6DA 3GTKB 5I2XA 5CC4A 1DCZA 3QIAA 3HOWB 1PRTC 2K33A 1W6KA 2KJXA 2N88A 3K58A 2NWGA 3BYYB 3LWUA 5KEEA 1K8OA 2SOBA 1PREA 2VUMB 1LABA 3CHBD 2DNCA 1LT4D 2LFNA 1CQFA 2PNRC 4HEDA 4F8MA 3JAME 1LTGD 5I9OA 3I4LA 3PO2B 2K5QA 3GTMB 2BA1A 5ELDA 4PMWA 4KKUA 5EPJA 4C1NI 3J80E 1D1IA 3VR4A 4B9WA 1ZEQX 1HA6A 1WTRA 2R3ZA 1OXSC 4HSVA 3DMUA 3RLFA 2C9OA 1CZWA 1SJED 4JK1C 3D31A 2Q8RE 4R8IA 1JE4A 3MTSA 2E2HB 2FMMA 5CYUA 1STGA 3QB3A 3DWPA 1SE2A 4A3BB 2PYKA 5LHY1 3ND8A 1C48A 2B8GA 2NVYB 2Y0SB 5IGEA 2PMZB 3PIO3 1KABA 4FF3A 1TKWB 3QWNA 1RHPA 3X3NA 1EU3A 1TIID 1ENCA 4CKCA 1UUPA 1VCIA 1STHA 1DXMA 1I4RA 4RGNA 2OXPA 4KJOA 1TWAB 3TP7A 1VF7A 5EJWA 3HOVB 4HR7B 4MN3A 2A73B 1GUSA 5D14A 4HMIA 1ML0D 2JA6B 1NR2A 1SAPA 4LK1C 1LLRD 4RGOS 1WTXA 2KA7A 1CK1A 2B2WC 2EJMA 4FF2A 4CKBA 1WTVA 4FXKC 1TS2A 3M7NA 1ICWA 4ZUIA 4K14A 2WP8J 3A55A 3H0GB 3MHBA 4QIWB 3PMFA 5M5XB 1GHJA 3NSWA 3OMGA 3RUZA 3KUPA 3TBIB 3VR3A 1STAA 5JJZA 3I72A 1G8ZD 3TZUA 3A8IE 3HEJA 4XXEA 4ZLTF 5JVG3 5KNDA 3TZDA 5C4XB 3MXNA 4UDUC 1HTPA 3GV6A 5D3IB 3S9WA 1RD9D 4UAIA 1LTTD 1HFGA 3PO3B 4RHRA 1CT1D 1EEFD 1GUOA 2FINB 3NQIA 3HG9A 1DZ1A 1TU2B 3QG1A 2L0CA 1V1PA 1D5ZC 2M9VA 1TWGB 1XXGA 1SNOA 1NAPA 1H9JA 2SEBD 2VNUD 1FYCA 2X6LA 3K6OA 2WB1B 1B3AA 3J7AF 2EY2A 5CORA 1LTID 1E2VA 2AWOA 1TT2A 3KLSX 2D2CC 2NB0A 1AFPA 5T1IA 2EYMA 3AMUA 3R2TA 3OSOA 2BDOA 2ICEC 4OIJA 3S17B 5IT9L 3A56A 4HAEA 3A54A 1CZGA 5I9PA 3IFDA 3H6MA 5JEAG 2E2IB 1EU4A 1EY8A 1OXXK 1Q3LA 2LKVA 1SYDA 3P1HA 1GHKA 1SNMA 3NTKA 4IZ8A 2X69A 2EZVA 4RKBA 3CU7A 1Y69U 3J7YW 2PPBC 3KBXA 1Z6HA 4A3MB 4F7XA 4CJ2C 3R93A 1HCZA 4A3GB 3NTHA 3KBGA 1EWCA 3R2IA 5DM73 2A6EC 2KQ3A 5FO8B 1Z52A 3J81E 3BG3A 4WRDA 3QOLA 1I4PA 4DNRB 1TWCB 3ITPA 2F0EA 1SSOA 1B9NA 3VR6A 4U673
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EU3 A;  2ICI A;  1UUP A;  1AN8 A;  2SEB D;  1B1Z A;  2XNA C;  1FGB D;  2R61 A;  4Z9C B;  1S5B D;  1T5X D;  1RF2 D;  1D5X C;  1I4R A;  1PYW D;  4RGN A;  1S5F D;  3C0M A;  1D5M C;  2QEJ C;  1ET6 A;  1B44 D;  3EA6 A;  1ET9 A;  1LTI D;  2AQ2 B;  4DXG A;  1FNU A;  2XRS D;  1PTO B;  1PZK D;  1KLG D;  3DWA A;  3G4O A;  1L0Y B;  4RFB A;  2XRQ D;  1LTA D;  1PRT C;  5I4D A;  3KLS X;  1TS4 A;  4RCO A;  1S5C D;  1JWU D;  1BXT A;  1I4X A;  1LT6 D;  1PZI D;  3BVZ A;  4L63 B;  1DJR D;  1PTO D;  2XN9 C;  4ZYS A;  3BYY B;  3R2T A;  1EEI D;  1I4G A;  5ELB A;  1LLR D;  4RGM A;  1SE4 A;  2Z8L A;  3TSS A;  5FK9 C;  4RGO S;  1JCK B;  1I4Q A;  1CK1 A;  3URY A;  1PRE A;  1UNS A;  1SE3 A;  1JWM D;  4K6L A;  2AQ1 B;  4RHS A;  1PRT F;  3CHB D;  1L0X B;  1EFI D;  1TY2 A;  3G4N A;  1LT4 D;  1TS2 A;  1BCP C;  1SBB B;  1TS5 A;  1TY0 A;  3V05 A;  1TS3 A;  3DWQ A;  3MFG A;  1FNV A;  2WV6 D;  3O13 A;  2RDH A;  5FKA C;  1FNW A;  1EU4 A;  1RCV D;  1I4H A;  1LTR D;  1LTG D;  1HXY D;  4OHJ A;  2IPK D;  1D6E C;  1XTC D;  1FD7 D;  1PRT B;  1F77 A;  1LTS D;  5ELD A;  4RH6 A;  1LO5 D;  2QIL A;  1HA5 A;  1CHQ D;  1V1P B;  3SEB A;  3R8B A;  2NTT A;  1BCP F;  1S5D D;  3BVM A;  1S5E D;  4BWG B;  1GOZ A;  2AQ3 B;  1KLU D;  1PRT D;  1LTB D;  4O1N A;  1V1O A;  1HTL D;  1SJH D;  5ELF A;  1CHP D;  1G8Z D;  2O2L D;  1SJE D;  1JQY D;  1SXT A;  2NTS A;  1MD2 D;  3BZD B;  3MC0 B;  3BYT B;  1BCP B;  3OWE B;  3BVG A;  5D3D A;  4UDU C;  2G9H D;  1EWC A;  2IJ0 A;  1HQR D;  1SEB D;  3R2I A;  2RDG A;  5D3I B;  1JR0 D;  4C56 C;  1PTO C;  1BCP D;  1RD9 D;  5ELC A;  1Z52 A;  1AW7 A;  2TSS A;  3C0O A;  1LT3 D;  1LTT D;  1QIL A;  1STE A;  3DWP A;  1ESF A;  1SE2 A;  1M4V A;  1I4P A;  4RHR A;  1RDP D;  1CT1 D;  1EEF D;  5TSS A;  3GP7 A;  1CQV A;  2J4X A;  1JWS D;  1KTK A;  2CHB D;  1PZJ D;  1ENF A;  3EFX D;  3W2D A;  1PTO F;  1D5Z C;  1V1P A;  5ELE A;  1DYQ A;  1LT5 D;  1PTO H;  1XXG A;  4DXF A;  4L6T B;  4RGT A;  4TSS A;  3C0N A; 
#chains in the Genus database with same CATH topology
 2PW7 A;  1WD1 A;  3I7F A;  4QUC A;  4XYO A;  4BS9 A;  2XRS D;  3G4S A;  4A3J B;  3UDG A;  1I6H H;  4A3B G;  5I4D A;  4JV5 Q;  1S5C D;  3PCO B;  3U9O A;  1VQJ A;  3UDI A;  1GUG A;  1K73 C;  1ASZ A;  5IYD G;  2N3S A;  1PTO D;  5C3E B;  3CCM A;  1YHB A;  4LF7 Q;  4IPH A;  4LUV A;  3V2T A;  4B3T L;  2Y0S G;  1SE4 A;  3A5U A;  4X3K A;  1XMO Q;  3S2D B;  5C44 B;  2EYL A;  1KDA A;  2IX3 A;  2CFM A;  1OXT A;  1UNS A;  1XNR L;  1I3Q B;  2MUY A;  1QVC A;  1TY2 A;  3K7A H;  3G4N A;  1CKO A;  1GD7 A;  2A6H C;  5EBC A;  4DPG A;  4FXD A;  1RIP A;  3HOV G;  5G3L D;  4BA2 I;  2F0P A;  4KD3 A;  2LXJ A;  1D6E C;  1QWY A;  3A8K E;  5FLX L;  2JA6 G;  4DR7 Q;  3KF8 A;  4YWM A;  1WCM H;  2JA8 H;  3I91 A;  1S5E D;  1FGU A;  1C4Q A;  3CP0 A;  3OW7 A;  2CKZ B;  2AQ3 B;  1IW7 D;  5CBE E;  1G6P A;  3VA7 A;  2BCO A;  4CBV A;  2RA4 A;  1HTL D;  5F2D A;  2JSO A;  3HS0 C;  5I6Y A;  5IGG A;  2HDM A;  4KD4 A;  3RNU A;  1MJC A;  1GKH A;  3M4O B;  2FJ2 A;  2E74 C;  5GAH C;  3P7J A;  3FPP A;  1E1O A;  4IUQ A;  2Q2I A;  5IIF A;  2YTV A;  1K28 A;  1VQF A;  5C0X I;  1E2Z A;  4QUF A;  4JI8 Q;  3T13 A;  4DV0 Q;  3AU7 A;  4LFA L;  2KEE A;  2VQE L;  4A3K H;  1BOS A;  1A0I A;  2K01 A;  3NQT A;  2NUC A;  1SYE A;  1N8R C;  3C0O A;  2N8N A;  5DM6 3;  3J7A 5;  3SHL A;  4DF7 A;  4KJN A;  3PIO A;  1EYA A;  1SMY D;  5IT9 E;  4NMZ A;  4GKJ Q;  4FNF A;  4JI5 L;  2ENB A;  2F0I A;  2F3V A;  3ULJ A;  5IGF A;  3T51 B;  3H94 A;  4JI7 L;  3GTJ B;  4KV6 A;  1B50 A;  5C4X G;  5ISR A;  3CXC A;  1HNW Q;  4I65 A;  1L0W A;  4M1U B;  1X3F A;  1GUW A;  1LUZ A;  1TWF H;  1X3Q A;  5DAU A;  4IN3 A;  4DR1 Q;  4IAL A;  2JA5 B;  4NB3 A;  1O80 A;  2XVS A;  4LJZ C;  3Q6S A;  1N33 L;  1LTA D;  3IL8 A;  2L9H A;  1HNZ Q;  4IOC A;  2A19 A;  1QG7 A;  2F0M A;  1VF5 C;  4X64 L;  2XN9 C;  4L5S A;  2DNE A;  1EL0 A;  5JEA H;  1BVS A;  3A7A B;  1KL9 A;  3GD7 A;  4DK6 C;  4DR5 Q;  4ZAI A;  1YNJ D;  2R7F A;  3CD6 A;  1I6H B;  2K05 A;  3KJP A;  1X3P A;  3FRP B;  3SGI A;  4N8F A;  3A8J E;  4G4K A;  2IX0 A;  1F2Z A;  4OIK A;  3TQY A;  4JI6 L;  5GAE C;  2F0H A;  1JOO A;  1VQP A;  1WTP A;  1LTR D;  2H1E A;  3M7G A;  5C6A A;  1BBU A;  1U4L A;  4ODG A;  5KNC A;  1EQT A;  1F77 A;  3K7A B;  4K0K L;  1GUT A;  3I8Z A;  4DR2 L;  3KDF A;  2R93 H;  1LM0 A;  1PH4 A;  4C3I G;  2MO0 A;  5C4H A;  4LFB L;  2KUM A;  3TME A;  1LTB D;  1PFN A;  3T4A C;  1AP0 A;  3X3M A;  3GTM H;  4K8I A;  3T1Y L;  1RTO A;  1Q8I A;  1WCM B;  4R4T A;  2JA8 B;  3M4Q A;  4R4C A;  3MC0 B;  4QGU A;  4PQX A;  1F9P A;  1B9M A;  3NK9 A;  2ALY B;  1QOH A;  3UI2 A;  1N32 Q;  3CKI B;  3RZD H;  4XYQ A;  3TRZ A;  5CV8 A;  4DUY Q;  4J15 A;  3DEO A;  1X6O A;  4PZ7 A;  3HZX A;  4JV5 L;  2Q8I B;  2J7Z A;  1ROD A;  2BDN A;  4GLA C;  5LMU L;  4HN7 A;  2HUG A;  4LF4 L;  4LF7 L;  1SYB A;  3JC6 6;  1M4V A;  4P71 A;  4X65 Q;  2OCE A;  1ZYR C;  1PYS B;  5JAV A;  2GVB A;  3ND9 A;  4NKL A;  3MWY W;  3NXW A;  4ULL A;  3FMC A;  5I2Y A;  4A3K B;  4C3H B;  1CKN A;  4KK7 A;  3CC4 A;  3DXJ C;  3K5L A;  4A3G G;  2WAQ B;  4XQN A;  1QZH A;  2RSN A;  3H09 A;  1WTW A;  1JIC A;  4TSS A;  1PH8 A;  2JK8 A;  5IYD H;  1E2W A;  3CCQ A;  2B29 A;  3BU2 A;  4C1N K;  5FLX E;  2NVY H;  1YEZ A;  3G6J B;  2TMP A;  4N8X 1;  4GLV B;  2XRQ D;  4DR7 L;  4PMC A;  1VMP A;  1JWU D;  1BXT A;  1I4X A;  1IYU A;  1LT6 D;  1TWF B;  5M3F H;  3E5S A;  2L1B A;  4XQQ A;  5C5L A;  4BY7 H;  2HCC A;  5BR8 L;  4HSP A;  1QNK A;  3G48 A;  3HOV H;  1I4G A;  1AH9 A;  1SND A;  4PMB A;  2MP1 A;  1UEB A;  4ABN A;  4AYB E;  1IZ6 A;  4QB4 A;  1I4Q A;  2JA6 H;  2F0J A;  3PF5 A;  3TEH B;  4RHS A;  2OQK A;  1L0X B;  2IY5 B;  2I07 B;  1TY0 A;  2HIX A;  3GO5 A;  4A93 H;  2R7Z G;  2JYO A;  2WV6 D;  2RDH A;  3CW2 C;  1VQM A;  2PQA A;  5LL6 S;  2K75 A;  4A3J G;  2F0V A;  3VYS A;  1CTM A;  4OHJ A;  1VQ9 A;  1O78 A;  1UE1 A;  4GN4 B;  5C3E G;  2OTJ A;  4YCV A;  3GDE A;  2NYZ D;  5IGD A;  4BWG B;  3MA2 B;  1MI2 A;  5I6W A;  4ID6 A;  5K5P A;  2MNA A;  2IT1 A;  3HGB A;  2EYP A;  5M5Y H;  2CH4 W;  4GNX B;  5C44 G;  3S1R H;  1ICF B;  4N9P A;  5M3M H;  4DV6 Q;  1OTC A;  1YJN A;  2A69 D;  2R93 B;  2NTS A;  1HZA A;  3N6R A;  5M5X H;  3BZD B;  1KDB A;  1Q1E A;  4X62 Q;  4A3L G;  1U0L A;  3M85 A;  1E1T A;  3OWE B;  2RKS A;  4KKT A;  4DR1 L;  3C2P A;  4Y52 H;  3ZYY X;  2G9H D;  3J80 c;  2HD3 A;  4H02 A;  1JR0 D;  1EY5 A;  1WD0 A;  4K2K A;  1BCP D;  1YNN D;  3CCJ A;  4A3C G;  1HNZ L;  2VZA A;  5C4X H;  3RZD B;  4DAP A;  3M3Y H;  1NE3 A;  4DUZ Q;  3K5O A;  3H3V C;  4DU9 A;  2A68 D;  1H95 A;  4MNO A;  2DY7 A;  5IOC A;  3D8G A;  2MHV A;  3S24 A;  2BA0 A;  1I6V C;  3W2D A;  4ZK9 B;  5ELE A;  3BS1 A;  2JA7 H;  1DOM A;  1II3 A;  2RDF A;  3H3V I;  3K59 A;  2EYH A;  1TR5 A;  3EN2 A;  1AN8 A;  4NDX A;  1VDZ A;  1UEA B;  4B3M Q;  5C0X H;  4FF1 A;  5IWA L;  3VYT A;  1N34 Q;  3GTO H;  1FJG L;  1J9O A;  4U68 A;  2XSC A;  3E3X A;  3DHQ A;  4RCO A;  3VR5 A;  3CF5 A;  3E6Z X;  3BVZ A;  4L63 B;  3E0E A;  2PI2 A;  4H13 C;  4JPB W;  4KY6 A;  3LNN A;  1KXL A;  4K2L A;  4B3R L;  1GXD C;  3U58 A;  4FVM A;  4YCW A;  1A2T A;  4IPC A;  3OHX C;  1IXR A;  3WOF A;  2WKC A;  1VQE A;  5M3F B;  1NR4 A;  4BY7 B;  3J81 j;  5JOB A;  3V05 A;  3Q8D A;  2ZT9 C;  4IO9 A;  2EY5 A;  4C3I H;  3ZJY C;  4NP5 A;  2JA5 G;  2A8V A;  1RCV D;  2PZU A;  4PNY A;  1VQO A;  1YJW A;  1I4H A;  4CJ1 B;  5FO9 B;  3K0Y A;  3I4O A;  4QL5 A;  4HJ9 A;  1HZ9 A;  4A3D H;  2RHQ B;  1D2B A;  2Z1C A;  1FD7 D;  2EQS A;  4JI2 L;  2L12 A;  1U4M A;  4GZY C;  4A93 B;  3OIQ A;  3CCL A;  4KY7 A;  1CA6 A;  1G2S A;  2L5T A;  4FDB A;  2KEN A;  1CSP A;  1KLU D;  5IYB H;  2HT1 A;  2D0P A;  4O1N A;  2IHF A;  3TS2 A;  4B3S L;  2O2L D;  5FJ8 H;  3S14 B;  1MD2 D;  4X3T A;  3CPW A;  3S1M H;  3HKZ E;  1LV9 A;  1PFM A;  4IUT A;  1A6X A;  5M5Y B;  1IL8 A;  2O5J C;  4DV2 L;  3S1R B;  1LAC A;  5M3M B;  2UU9 L;  1SMX A;  4DV1 Q;  1HRJ A;  3LWE A;  1Y1V G;  1JC7 A;  4K5X A;  3S2H B;  5LL6 X;  3L2P A;  1QIL A;  2EY1 A;  4KLK A;  2Q2T A;  1IYJ B;  5EKI A;  5TSS A;  2L15 A;  2K4K A;  4A4I A;  4DV7 L;  1H9R A;  2YU9 H;  3ULL A;  5CV9 A;  1WCM G;  2V1C C;  1MSG A;  1PTO F;  3T16 A;  2HHH L;  2UUC Q;  2JA8 G;  3M3Y B;  2G5D A;  3EJI A;  4HIM A;  2F0D A;  4FO2 A;  1S4Z A;  3CMA A;  3SDZ A;  4L5T A;  4O2D A;  1S5B D;  4TVA B;  1EYC A;  4NXN L;  2JA7 B;  1E7Z A;  3G7L A;  3FEW X;  1AE2 A;  4PV1 C;  3MEF A;  4DK1 A;  5G3L F;  2DJF C;  3Q22 A;  1K8A C;  3HKS A;  1H9M A;  4H7B A;  2GVA A;  1EZ8 A;  2R7Z H;  2OWO A;  4HCS A;  4DV6 L;  1N9W A;  2WIN B;  4C3H G;  4A75 A;  1IBM L;  2F03 A;  3GTO B;  4A3J H;  3GTG H;  2WII B;  2M00 A;  1VQ4 A;  2WAQ G;  1C9O A;  1JOK A;  1V9P A;  1K3B C;  2I5M X;  2SDF A;  4IUR A;  2HQL A;  1BNZ A;  3S1N H;  2E5L L;  2B2W A;  2KCM A;  4DR6 Q;  1JT8 A;  2F1M A;  2NZH A;  5C44 H;  2RQX A;  2E2J B;  2XGT A;  1HXY D;  1EYD A;  1R9T H;  2GA4 B;  1CI3 M;  3GV3 A;  1JJG A;  3LX0 A;  1UE7 A;  4JW0 A;  2CW0 D;  5EBD A;  4S3S A;  4CDD C;  1ASY A;  2QDB A;  4C3I B;  4ZKB B;  4KI0 A;  1PV4 A;  4G7H C;  3T1H Q;  4A3D B;  2C5C A;  2QGQ A;  1V1O A;  5ELF A;  4RA8 A;  1V43 A;  3F2D A;  4A3C H;  1VQN A;  4YY3 L;  5EPK A;  1U9R A;  3NPP A;  3TP6 A;  2VB3 X;  1L1O B;  1O7Z A;  1Z47 A;  1L2F A;  3BYT B;  2KCC A;  4B3M L;  4CDF C;  4GKK Q;  1RTN A;  2I0Q A;  3NTI A;  1J8I A;  1N34 L;  1S40 A;  2VL6 A;  4ALP A;  2PCF B;  5C5M A;  4C56 C;  1BDO A;  4K8J A;  5KRU A;  3S15 B;  2K28 A;  3S1M B;  5ELN A;  1AW7 A;  2TSS A;  4IJL A;  1IKM A;  2SNM A;  4E6I A;  5C3X A;  2BH8 A;  4IFD I;  1X3G A;  1CQV A;  3OIP A;  4EQO A;  3FKI H;  4A3I H;  3CC2 A;  4LF8 Q;  2MJ8 A;  2R93 G;  5AFW A;  4LUO A;  1OXV A;  1VQI A;  4LFC Q;  2UXD Q;  1LT5 D;  3CCV A;  3J81 c;  1PTO H;  4LW1 A;  2R6G A;  4RGT A;  4GNX A;  1C8C A;  4OX9 Q;  5DNF A;  2VB2 X;  3F1Z A;  3W3A A;  1BF4 A;  2YU9 B;  1B1Z A;  4YWK A;  4X6A H;  1SR3 A;  2R61 A;  4MIU A;  3ERQ A;  3RR5 A;  2QEJ C;  2ZM6 Q;  1YNN C;  2AQ2 B;  1BBX C;  1NBW A;  3W1B A;  5IE8 A;  4A76 A;  5DEH A;  3BZK A;  3G71 A;  4RFB A;  1Z7T A;  4BY1 H;  4ZRZ A;  1U5K A;  1EUJ A;  3FDT A;  2Z4I A;  4DR3 L;  1VQB A;  5FLM G;  4R8N A;  1MBY A;  4DK3 C;  1J5E Q;  2JA5 H;  1BR9 A;  1GVP A;  2D9U A;  1STY A;  3S1Q H;  2B3G A;  2IW3 A;  5NUC A;  2LMC B;  4LF9 Q;  4JI3 L;  4FYD A;  3K80 C;  3TSS A;  2OT2 A;  4DNT B;  5CBA E;  5GAG C;  2J0T D;  3HP3 A;  1A3V A;  1SYF A;  2B8F A;  1FL0 A;  2R92 G;  2R7Z B;  1EFI D;  3L7Z C;  2KEC A;  3H3V H;  1VQA A;  4IFD G;  1UE6 A;  2I5L X;  3KF6 B;  2X6G A;  3PQI A;  4CHT B;  3GTG B;  1FNV A;  1IBK Q;  3F2U A;  4DV1 L;  4UHV A;  3PIP 3;  3ERO A;  3QJY A;  4R4I A;  3AB9 A;  4HJA A;  1G2T A;  1WTO A;  4X66 Q;  3LGJ A;  3S1N B;  1XTC D;  3A74 A;  2CH4 A;  4B9X A;  4GS3 A;  2QCP X;  4EQN A;  4A3F G;  1HA5 A;  1CHQ D;  5JPM C;  4ME3 A;  2VQF L;  4P74 A;  3DLL A;  1EQV A;  3I56 A;  1PRT D;  5CMD A;  1SRU A;  2DJG C;  1R9T B;  1SNQ A;  4DK0 A;  1Y1V H;  1SJH D;  4WJ4 A;  5M3F G;  4LAA A;  4PZ6 A;  1XNQ L;  4BY7 G;  3K57 A;  5CV7 A;  2F0O A;  1P16 A;  3TRE A;  3HOZ B;  2YTY A;  1Y1W H;  3BVG A;  5HY6 A;  4BBR H;  3RMH A;  5JJL A;  3NEM A;  4A93 G;  3PUZ A;  3PF4 A;  4G7Z C;  2NVT H;  4FF4 A;  1O7I A;  1T9H A;  1QVF A;  5E1F A;  4XT3 B;  2F0G A;  4I7A A;  3FPU B;  4C3J H;  1ZXT A;  4LF5 Q;  2ATW A;  5C4J B;  1EY0 A;  1I94 Q;  2B39 A;  5E3F A;  4AH6 A;  2F0F A;  2LSS A;  3L9A X;  2PNH A;  4OGQ C;  1DYQ A;  3NUC A;  1PH6 A;  2NVX H;  3ONA B;  5EKL A;  3VYR A;  1HHV A;  1BQQ T;  4DR6 L;  5M3M G;  4N9T A;  2RSO A;  3FKI B;  4A3I B;  4JBW A;  3VYU A;  1A3T A;  2B2U C;  2NN6 I;  4C3H H;  4OL7 A;  2IHE A;  2EE1 A;  4QMG A;  3SK8 A;  4DXG A;  1PTO B;  2ZXR A;  1JOR A;  4P75 A;  1KD1 C;  2HCI A;  2B2T C;  1HQM C;  4LMQ D;  3T1H L;  5BN3 A;  5EGT A;  3AYH B;  3Q0A A;  4DV3 Q;  1VQ7 A;  3KFU A;  1VS0 A;  2UXC Q;  3IAY A;  4BY1 B;  2HDL A;  5CV6 A;  5FK9 C;  4APV A;  2DY8 A;  1GM5 A;  4X3S A;  2F0S A;  1JWM D;  2F4V Q;  4IUP A;  2HIV A;  4Q0F A;  2H4O A;  1L1O C;  3STB D;  3VDY A;  3S1Q B;  3O13 A;  1XJV A;  1JB7 A;  1QNU A;  2JA7 G;  1IKL A;  3IRB A;  4XTC S;  4DR4 Q;  3D3R A;  5CV4 A;  1K83 H;  1PMR A;  2AUJ D;  2WAC A;  5C0X G;  1A3U A;  1LO5 D;  2F4I A;  2QIL A;  4NPS A;  3SEB A;  1BCP F;  3D4R A;  4TQU S;  2NN6 G;  2L11 A;  4M8A A;  1IHZ A;  4YHH Q;  4LFC L;  2F0Q A;  2UXD L;  2OQ0 A;  3CCE A;  2IWH A;  1CHP D;  2F0K A;  4KY5 A;  4RAU C;  1WFQ A;  1SXT A;  2ZXO A;  1EOT A;  1I50 H;  4OX9 L;  4IUU A;  3A0J A;  1N36 Q;  1DOK A;  5A2Q L;  3J80 L;  1V8Q A;  5D3D A;  1WOC A;  2F0W A;  2ZM6 L;  1NCV A;  1HQR D;  1Y1V B;  3T56 B;  3ER0 A;  4IPG A;  1C7Y A;  5D65 A;  4L8J A;  2UUA Q;  3E0J A;  3EIV A;  2K52 A;  3D4W A;  5ELC A;  2CW0 C;  1LT3 D;  1Y1W B;  1J5E L;  4BBR B;  5BN5 A;  5K36 H;  3N52 A;  2Z4H A;  4JI4 Q;  4LF9 L;  4A3D G;  1JJC B;  2PZT A;  3DEP A;  4GLX A;  2B2T A;  3KLR A;  5IY0 A;  1F2M A;  4J6H A;  1U4R A;  2NVT B;  3PSI A;  1R4Q B;  2QKI C;  4C3J B;  3C1E A;  5IYB G;  1KQS A;  5FLM H;  3C0N A;  4O0A A;  2ICI A;  1M8A A;  4IJH A;  3CME A;  1B53 A;  4RMF A;  4Z9C B;  1T5X D;  5CGK A;  1W6J A;  5FJ8 G;  3C0M A;  1D5M C;  1O7Y A;  2L55 A;  1B44 D;  3MXU A;  4X66 L;  1HPC A;  1FNU A;  1L1O A;  2NVX B;  2EYJ A;  5FOB B;  2IL8 A;  2E75 C;  5AJ3 Q;  3SK4 A;  2R92 H;  4Y7N H;  2JEB I;  1XMO L;  3MZ5 A;  3TP8 A;  1G91 A;  1M1K C;  4IFD H;  4OWX B;  2A1A A;  1DM0 B;  4WFN 3;  1Q1B A;  2UUB Q;  1X54 A;  2B2V C;  1H9S B;  1KAA A;  2AQ1 B;  4EQP A;  4HJ8 A;  3HOX B;  4A3F H;  2JXM B;  3BZC A;  1C0A A;  1TS3 A;  2JP1 A;  3EQL C;  1JMC A;  1FNW A;  2EXZ A;  1IYV A;  5EQ0 A;  1EIG A;  2D5D A;  1Y14 B;  2I5H A;  4V0B A;  4AIM A;  3PUY A;  2E2D C;  4LF5 L;  2FMC A;  3S16 H;  1A62 A;  1I94 L;  1QE6 A;  2Z6K C;  4DN4 M;  3OW2 A;  3BDO A;  4HIO A;  4DNI A;  1K83 B;  2K5W A;  3I73 A;  1K9M C;  3MEH A;  4KHP Q;  2K04 A;  4KN4 C;  1MGS A;  4JI8 L;  4DV0 L;  4AYB B;  1D1K A;  1X55 A;  2ZXP A;  2E8G A;  2Q8T A;  2BE5 D;  3NHH A;  4YIJ A;  1JJ2 A;  1PTO C;  1I50 B;  3S14 H;  4GKJ L;  5JJK A;  3KF6 A;  2DGY A;  1SDF A;  2EY6 A;  2CQO A;  2KHI A;  4EQ5 A;  1ESF A;  3JAM c;  3I90 A;  2JA9 A;  2F0U A;  1YHA A;  1H9K A;  1HNW L;  1YIJ A;  3TN2 A;  3S2H H;  4UP8 A;  1OXU A;  1DOL A;  1KRS A;  2K5H A;  5GRO A;  2CCZ A;  3HOZ G;  3P75 A;  2NZO A;  3DM1 A;  1XX8 A;  4ILW A;  4H0L C;  4KMU C;  5A35 A;  3ULP A;  3HOY B;  2V4D A;  5C4Z A;  2B2V A;  3WOE A;  3D0F A;  1NY4 A;  3CRL C;  3EA6 A;  2HQE A;  3BDL A;  4LUZ A;  1WTH A;  4DR5 L;  3J7A V;  1IW7 C;  1SFO H;  4YWL A;  3K7U C;  3DM3 A;  3OTO Q;  4LF6 Q;  2A6E D;  2MQH A;  4OXP A;  1PH7 A;  1YVC A;  4YHH L;  1PLF A;  2F0N A;  1WJJ A;  4PG3 A;  1HFN A;  2R7D A;  4DKA C;  3PIP A;  2PZW A;  4H44 C;  5A2Q E;  1Q86 C;  2N78 A;  4Y7N B;  1JCK B;  1ENA A;  2R92 B;  4IUN A;  4KHZ A;  4K6L A;  3C3L A;  3FKI G;  4A3I G;  1YJ9 A;  1XYI A;  4CDC C;  4A3E G;  1SBB B;  4G57 A;  4XDX A;  3DWQ A;  4IOA A;  1ESR A;  2NN6 H;  2UUA L;  2K32 A;  3VR2 A;  2K6A A;  4EX5 A;  1B3Q A;  5JEA J;  4DAY B;  2A5H A;  3CCS A;  1SMY C;  2KBN A;  2PO4 A;  5IP7 G;  3A5Z B;  4KHV A;  4MHE A;  4A3F B;  3FVQ A;  1PA6 A;  1MSH A;  4HJ7 A;  4JI4 L;  1VMC A;  4RCN A;  2Y0S E;  3E9I A;  1NMG A;  2NTT A;  2B2Y C;  1EYG A;  2E2J H;  4JI0 Q;  3RLN A;  1PH2 A;  4BY1 G;  2PMZ E;  3NP8 A;  4RKL A;  1N32 L;  2K1B A;  3PUX A;  1QUQ B;  4DUY L;  2EJG C;  2JE6 I;  3PGZ A;  3S16 B;  4QQB X;  2WKD A;  1PVO A;  2A74 C;  3U9S A;  2OTL A;  2CQA A;  1A2U A;  1BCP B;  4TRD A;  2PQE A;  1F2L A;  3MXG A;  1E0B A;  1OO9 B;  2Z6B A;  1Q81 C;  1SEB D;  4X65 L;  5CR3 A;  2A6H D;  5J3B A;  1AZP A;  1STE A;  1JB3 A;  1STN A;  1YNJ C;  2KCN A;  3H91 A;  1TVX A;  2NZ1 D;  5LMN Q;  4JYA Q;  1RDP D;  4JBM A;  1JWS D;  1K0S A;  1HH2 P;  1Q82 C;  3AFQ A;  5KNB A;  3S15 H;  2K03 A;  1ENF A;  2LS0 1;  5COY A;  3J81 L;  2N55 A;  2PW5 A;  1A15 A;  2F3W A;  1CKM A;  2VW9 A;  1X32 A;  2XNA C;  1XPO A;  5C3W A;  4QIW E;  2QF7 A;  1VQC A;  2F0L A;  3HKZ B;  3SK6 A;  4C2M H;  2L4N A;  5EKK A;  1Y1W G;  2EYO A;  4IFD J;  2K5V A;  2WFW A;  3MVV A;  1BBW A;  1TS4 A;  4BBR G;  2ZTD A;  1Q12 A;  2AWN A;  3V96 A;  1QJO A;  4UP9 A;  1CA5 A;  1NSN S;  3EVQ A;  4K5V A;  1EZ6 A;  4KHP L;  1EEI D;  2EXD A;  4OWW B;  2ES2 A;  1KAW A;  1PXU A;  1SFO B;  3NWS A;  1HJP A;  2D0O A;  4C3J G;  4WJW A;  2B2Y A;  1YI2 A;  4EVO A;  1PRT F;  3NBH B;  5M5W H;  4B3T Q;  3H15 A;  5BN4 A;  5E4W C;  3T53 B;  4F88 A;  2ZJP A;  1EWH A;  2AHO B;  4HMJ A;  3MFG A;  1HUM A;  3PUW A;  3PV0 A;  1ILQ A;  4HJ5 A;  1XNR Q;  2AMC B;  1EWI A;  2K50 A;  4KKS A;  4CDE C;  2IPK D;  1SNP A;  3L3O C;  4B08 A;  5KIX A;  1NJI C;  1VQD A;  3KK7 A;  1IBL Q;  1F9Q A;  3SE0 A;  5KYI A;  1EY4 A;  1S5D D;  5H1S E;  1PH1 A;  3OOC A;  3PUV A;  4IUV A;  3J7Z C;  4X62 L;  2RBM A;  4L5R C;  3KJO A;  1WTQ A;  3F8T A;  4CGY B;  3KOJ A;  1B8A A;  3HOX G;  5J1Z A;  2WB1 E;  2XWB B;  3HOU B;  3VA5 A;  1F9S A;  3I4M H;  3Q23 A;  1ONL A;  1H9S A;  1Y8N B;  5J39 A;  4HTH A;  4DUZ L;  3SVM A;  3RN2 A;  5KGU A;  1GUN A;  4F87 A;  1DD2 A;  4WOR A;  2YTX A;  4LF6 L;  3HOZ H;  3GP7 A;  3E9H A;  1BO0 A;  4BXX H;  3EFX D;  4JCV E;  1ILP A;  4I7Z C;  4AYB G;  4L6T B;  1Y8P B;  3CCU A;  2KCT A;  1K3R A;  5C4J H;  2Z0S A;  2RVL A;  3C46 A;  2BE5 C;  1VQ5 A;  1AZQ A;  1D5X C;  1PYW D;  4JI7 Q;  3DUZ A;  5FO7 B;  2K5N A;  2SNS A;  4XQJ A;  4X3U A;  2KED A;  3DWA A;  1KLG D;  1L0Y B;  4XT1 B;  3GTQ B;  2JQO A;  4BA1 I;  3TDQ A;  3I4N G;  5J22 A;  4R9W A;  1E3P A;  3C1F A;  4IQZ A;  4A3E H;  3MFY A;  3HOW G;  2EYF A;  3L0O A;  4ZQ3 A;  3K5N A;  4JI0 L;  3OWF A;  2A69 C;  5ELO A;  3U50 C;  4C2M B;  1N33 Q;  3J80 i;  4K5W A;  5ELB A;  1UAP A;  2EPB A;  4OEM B;  5C0X J;  2VS1 A;  5M9O A;  1F9R A;  1TXY A;  1JOQ A;  1J6Q A;  2ID0 A;  5IP7 H;  5K36 G;  1ZYR D;  4X64 Q;  2MGS A;  3URY A;  3OYY A;  1UWV A;  2YYZ A;  3HOY G;  2EDG A;  4J1M A;  1X3E A;  1BCP C;  1TS5 A;  5E7N A;  3BDC A;  5FKA C;  1M90 C;  4OO1 I;  1EY9 A;  4GN3 B;  2VXW A;  2K5D A;  1RKN A;  3CQZ H;  4FXG C;  5M5W B;  4JG2 A;  2A68 C;  3CCR A;  1KHI A;  1TWH H;  4JYA L;  4KN7 C;  1PH5 A;  4RH6 A;  3PO2 G;  1VQL A;  1SNC A;  1E24 A;  3R8B A;  1F2Y A;  1AEX A;  1GOZ A;  1YZ6 A;  5KYL A;  3OMC A;  3D6C A;  4JC0 A;  1JQY D;  4OON A;  3A7L A;  4LFB Q;  4BBS H;  1PHJ A;  4J8Q A;  2PQA B;  1Y8O B;  1ZKO A;  3SK5 A;  1SLJ A;  3CRK C;  1K8M A;  2IJ0 A;  4O42 A;  3T1Y Q;  2RDG A;  1PH9 A;  1VQK A;  2F0T A;  4POG A;  5IYC G;  3NE5 B;  2EVB A;  1D8L A;  4MTK A;  3I4M B;  3QOJ A;  3FP9 A;  2UUC L;  3NBI A;  4DAY A;  2K7V A;  2UXB Q;  4OO1 G;  1X9N A;  2CHB D;  1HUN A;  4DAV A;  5LMU Q;  1DGS A;  1X56 A;  4LF4 Q;  1TQO A;  4DGZ A;  4R4O A;  4P73 A;  1QUQ A;  2VY3 A;  1RF2 D;  1D7Q A;  4QF4 A;  1W2B A;  3G4O A;  3HRZ C;  4ME5 A;  1IBL L;  3RZO H;  4OEL B;  2NVQ H;  2MPM A;  5JJI A;  1B4O A;  1G29 1;  2YV5 A;  1PZI D;  3K0X A;  4JBK A;  3B6Y A;  3D6W A;  4ZYS A;  5HGQ A;  1KNE A;  1BUV T;  1HR0 W;  2Z8L A;  3QO2 A;  5IT9 c;  4A3E B;  1PFB A;  1SE3 A;  3GQB A;  3WWV A;  5BR8 Q;  4QCL A;  3F2C A;  1YIT A;  3I3C A;  2PI2 E;  1CM9 A;  3P20 A;  3HKZ G;  4CJ0 B;  1QB5 D;  1QZG A;  2FFK B;  1MIU A;  1YBY A;  4QY7 A;  3HOX H;  1PRT B;  4MZ9 A;  3H0G G;  1Q90 A;  3BVM A;  5LMN W;  3SR1 A;  4HID A;  1KC8 C;  3NWT A;  3CQZ B;  1E22 A;  1KDC A;  5JPN C;  1TWH B;  1GO3 E;  4GKK L;  2XIW A;  3HFZ B;  3KLS A;  2KOL A;  2ZJQ A;  1KRT A;  1B2T A;  2FHT A;  3IFT A;  2JEA I;  5GAD C;  2B63 B;  1STB A;  1SYG A;  1YNX A;  1IL2 A;  2ZTE A;  2O4X A;  3NBH A;  3MAQ A;  2P5Z X;  3GTL H;  1EQR A;  1VQ6 A;  4UY8 C;  3RD4 A;  1NUC A;  4BBS B;  3JAM L;  3F2B A;  2EJF C;  4DA2 A;  4JVZ A;  4LF8 L;  1R4P B;  2DUD A;  5HUR A;  1NMF A;  2IX1 A;  3PO3 G;  2BOS A;  1KNA A;  2E76 C;  5JVH 3;  2OF1 A;  2EIF A;  1SE8 A;  3GTP H;  5E4X A;  3I70 A;  2KHS A;  2NBF A;  5HGT A;  3R3O A;  3I4N H;  3K5M A;  4DXF A;  4GOP B;  5EPL A;  3GTK H;  3HOU G;  3HOW H;  3SXH A;  2CVR A;  1U4P A;  1FGB D;  2G9D A;  2B2U A;  3EBE A;  3KYH C;  1HNX Q;  2WB1 G;  3WDN A;  4RWS C;  1SYC A;  1EY7 A;  3UDF A;  2F52 A;  3M9B A;  1PDQ A;  2I46 A;  3HOY H;  2VUM H;  1O7L A;  4Q5V A;  2KVM A;  1DJR D;  5CV5 A;  5IWA Q;  2RF4 A;  2AKW B;  1FJG Q;  2ZJR A;  2DN8 A;  4RGM A;  2EOT A;  2QEX A;  3RZO B;  3MXN B;  2NVQ B;  1IBK L;  1Q46 A;  1G6Z A;  1EIH A;  3K8A A;  3OPO A;  4RG1 A;  4YCU A;  3PO2 H;  1NTG A;  3D4D A;  1B70 B;  4EGV A;  1EY6 A;  1HZC A;  3M4Y A;  4KTA A;  1QCB D;  2O5I C;  2QDL A;  4B3R Q;  1WI5 A;  3BJU A;  4MTN A;  1CSQ A;  4V19 0;  4IPD A;  3ICE A;  2OEO A;  4TKO B;  1XWE A;  1A63 A;  3J81 i;  1LTS D;  5FLX c;  4LNQ A;  4CKE A;  2RCF A;  4PZ8 A;  2UXB L;  1V1P B;  4NW2 A;  2FXQ A;  5T1G A;  1XPR A;  2WAQ E;  2D62 A;  4JI2 Q;  2XWJ B;  2E2H H;  1CFM A;  4A3M G;  3QR8 A;  5IYC H;  4G7O C;  1FR3 A;  4DFA A;  5IOD A;  1XMQ Q;  1B7Y B;  4B3S Q;  4A3B H;  2AUK A;  4OO1 H;  2KHJ A;  4QJF A;  1DON A;  3TP5 A;  4DV2 Q;  2UU9 Q;  4HCE A;  1GJX A;  3MXP A;  2J4X A;  1KTK A;  1T5E A;  2M2L A;  3GTL B;  1PZJ D;  3I2Z A;  5IGB A;  4FP5 D;  3Q24 A;  1TWA H;  3AQQ A;  4XIG S;  4P2C B;  4ZKC B;  4DV7 Q;  5IGC A;  3W1G A;  1WVL A;  4DAM A;  3GTP B;  1S3O A;  5EAY A;  2HHH Q;  3CAM A;  1S5F D;  1RJT A;  4ZUJ A;  3IKJ A;  1ET6 A;  1ET9 A;  3I4N B;  2LY7 A;  1PZK D;  4K6D A;  3GTK B;  5I2X A;  5CC4 A;  1DCZ A;  3QIA A;  4DV3 L;  3I4M G;  3HOW B;  1PRT C;  2K33 A;  1W6K A;  2UXC L;  1SRO A;  2KJX A;  2N88 A;  3K58 A;  4AQY Q;  2F4V L;  2QA4 A;  4NXN Q;  4POF A;  2NWG A;  3BYY B;  3LWU A;  5KEE A;  2CWP A;  4DV4 Q;  1K8O A;  2CWA A;  2SOB A;  1G51 A;  1PRE A;  2VUM B;  4DR4 L;  1W3S A;  1RL2 A;  1LAB A;  5IP9 G;  3H0G H;  1IBM Q;  3CHB D;  2DNC A;  1LT4 D;  2LFN A;  4BXX G;  1CQF A;  4UPA A;  2PNR C;  3RN5 A;  4HED A;  4F8M A;  3JAM E;  1LTG D;  2E5L Q;  1A8V A;  5I9O A;  1PYB A;  3I4L A;  3PO2 B;  2K5Q A;  3GTM B;  2BA1 A;  5ELD A;  4PMW A;  3UE1 A;  4KKU A;  5EPJ A;  1V1Q A;  4JBJ A;  2K14 A;  4C1N I;  1EIF A;  3J80 E;  1N36 L;  1D1I A;  3VR4 A;  4B9W A;  1VQH A;  4NXM Q;  2Z6K A;  1ZEQ X;  1HA6 A;  1WTR A;  2Q2U A;  2R3Z A;  1OXS C;  1WYD A;  4HSV A;  3DMU A;  3RLF A;  2C9O A;  4UP7 A;  1CZW A;  1SJE D;  5L37 A;  4GOP C;  4JK1 C;  2JN4 A;  3D31 A;  2Q8R E;  1I5F A;  4P72 A;  4R8I A;  2BH2 A;  4JOI C;  1JE4 A;  1UE5 A;  1VQG A;  2RCN A;  1HNX L;  3PO3 H;  3MTS A;  1LTL A;  2E2H B;  4YY3 Q;  2FMM A;  1NNX A;  1K8G A;  5CYU A;  1STG A;  2C35 B;  1HR0 Q;  3QB3 A;  1Q7Y C;  3HOU H;  3DWP A;  4DV5 Q;  1SE2 A;  2JJQ A;  4A3B B;  1TWG H;  2PYK A;  4JI1 Q;  5LHY 1;  2N49 A;  3ND8 A;  1C48 A;  2B8G A;  2MFI A;  3STB C;  2NVY B;  2Y0S B;  5IGE A;  2B63 G;  2PMZ B;  3PIO 3;  1KAB A;  3UDX A;  4FF3 A;  1TKW B;  3QWN A;  1RHP A;  3X3N A;  1EU3 A;  1TII D;  1ENC A;  1UUP A;  4CKC A;  5AJ3 L;  3CPF A;  1BKB A;  1STH A;  1VCI A;  1DXM A;  1I4R A;  4RGN A;  2OXP A;  4KJO A;  5GQO A;  1TWA B;  3TP7 A;  3KF8 B;  1VF7 A;  5EJW A;  3HOV B;  4BBS G;  4HR7 B;  4MN3 A;  2A73 B;  1GUS A;  3K81 C;  1VQ8 A;  3S17 H;  5D14 A;  4HMI A;  3AEV A;  1ML0 D;  1K0R A;  2JA6 B;  2UUB L;  1NR2 A;  1SAP A;  2GN5 A;  1EQQ A;  3ERS X;  2ZTC A;  4LK1 C;  1LLR D;  2E2I H;  3GTQ H;  4DR3 Q;  4RGO S;  1WTX A;  2KA7 A;  1CK1 A;  2MO1 A;  1MHW C;  2B2W C;  1EFW A;  2EJM A;  4FF2 A;  4CKB A;  4OWT B;  1XMQ L;  1WTV A;  4FXK C;  1TS2 A;  3M7N A;  4JI3 Q;  1HZB A;  1ICW A;  4ZUI A;  4K14 A;  1P8L A;  3G6E A;  4GOP A;  2WP8 J;  3KLW A;  4JOI A;  3A55 A;  3H0G B;  3NEL A;  3MHB A;  4QIW B;  4A3M H;  3PMF A;  1PH3 A;  5M5X B;  1GHJ A;  3NSW A;  1X65 A;  4A3G H;  4HIK A;  3OMG A;  3RUZ A;  1Z9F A;  3KUP A;  3FHW A;  3TBI B;  3VR3 A;  1STA A;  1LYL A;  5JJZ A;  2LXK A;  3I72 A;  1G8Z D;  2VQF Q;  3TZU A;  4LWC A;  3A8I E;  3HEJ A;  4XXE A;  4ZLT F;  5JVG 3;  5KND A;  3TZD A;  5C4X B;  3MXN A;  4UDU C;  1XNQ Q;  1JE5 A;  1HTP A;  3GV6 A;  5D3I B;  3S9W A;  1RD9 D;  4R4Q A;  1TWC H;  1PFS A;  2RHS B;  4UAI A;  1QVG A;  1LTT D;  1HFG A;  4AQY L;  3PO3 B;  2QW7 A;  4RHR A;  1CT1 D;  1EEF D;  1GUO A;  2FIN B;  3NQI A;  4DV4 L;  3HG9 A;  3AFP A;  1DZ1 A;  1TU2 B;  3QG1 A;  2L0C A;  4A3K G;  1V1P A;  1D5Z C;  2M9V A;  1TWG B;  1XXG A;  4GNX C;  1SNO A;  1NAP A;  1XPU A;  1H9J A;  2SEB D;  2VNU D;  1FYC A;  2X6L A;  3K6O A;  2WB1 B;  1MJE A;  3OTO L;  5C3E H;  1B3A A;  3J7A F;  2EY2 A;  3KDF B;  5COR A;  1LTI D;  1E2V A;  2AWO A;  1TT2 A;  3W5O A;  3S2D H;  4LFA Q;  3KLS X;  1SN8 A;  2VQE Q;  5IP9 H;  2D2C C;  2NB0 A;  1AFP A;  3I55 A;  4NXM L;  1I3Q H;  5T1I A;  2Q2H A;  2EYM A;  3AMU A;  4WJ3 M;  3R2T A;  3OSO A;  2BDO A;  4A3L H;  2ICE C;  1CUK A;  4OIJ A;  4JI5 Q;  3S17 B;  5IT9 L;  3A56 A;  1YHQ A;  1MKH A;  4HAE A;  3A54 A;  3NEN A;  1CZG A;  4GN5 A;  3CC7 A;  3JAM i;  5I9P A;  2XTI A;  3IFD A;  3H6M A;  4R1J A;  5JEA G;  2E2I B;  1EU4 A;  1EY8 A;  1OXX K;  1Q3L A;  2LKV A;  1SYD A;  3P1H A;  1GHK A;  1SNM A;  1HR0 L;  2F3I A;  3NTK A;  4IZ8 A;  4DV5 L;  1KIX A;  2X69 A;  4L5Q A;  3U4Z A;  2EZV A;  1CKN B;  4RKB A;  3CU7 A;  1S72 A;  1Y69 U;  3J7Y W;  4JI1 L;  3M4O H;  2PPB C;  1Q8K A;  1EIY B;  3KBX A;  1EOV A;  1Z6H A;  4A3M B;  2VUM G;  4F7X A;  4CJ2 C;  5DLQ E;  2ASB A;  3R93 A;  1HCZ A;  4A3G B;  3RLO A;  3NTH A;  3KBG A;  3M4P A;  1XTD A;  1EWC A;  5LMN L;  3R2I A;  4JI6 Q;  2Z9H A;  1AE3 A;  5DM7 3;  4ZCK A;  2A6E C;  2KQ3 A;  3U4V A;  2H5X A;  5FO8 B;  1Z52 A;  3TS0 A;  3J81 E;  3BG3 A;  2B63 H;  4WRD A;  3UE0 A;  3QOL A;  1I4P A;  3GTJ H;  4K0K Q;  4DR2 Q;  4DNR B;  1TWC B;  3ITP A;  2F0E A;  1SSO A;  1B9N A;  3VR6 A;  4U67 3;  1FVI A; 
#chains in the Genus database with same CATH homology
 2PW7 A;  1WD1 A;  4QUC A;  4XYO A;  4BS9 A;  2XRS D;  4A3J B;  5I4D A;  1S5C D;  3U9O A;  1GUG A;  1PTO D;  5C3E B;  3V2T A;  1SE4 A;  4X3K A;  3S2D B;  5C44 B;  2EYL A;  1KDA A;  2IX3 A;  1OXT A;  1UNS A;  1I3Q B;  2MUY A;  1TY2 A;  3G4N A;  2A6H C;  5EBC A;  4FXD A;  5G3L D;  4BA2 I;  2F0P A;  4KD3 A;  1D6E C;  1QWY A;  3A8K E;  5FLX L;  3KF8 A;  3I91 A;  1S5E D;  3OW7 A;  1C4Q A;  2AQ3 B;  1IW7 D;  5CBE E;  3VA7 A;  2BCO A;  4CBV A;  2RA4 A;  1HTL D;  5F2D A;  2JSO A;  3HS0 C;  5I6Y A;  5IGG A;  2HDM A;  4KD4 A;  3M4O B;  2FJ2 A;  2E74 C;  3P7J A;  3FPP A;  5IIF A;  4IUQ A;  5C0X I;  1E2Z A;  4QUF A;  3T13 A;  3AU7 A;  2KEE A;  1BOS A;  2K01 A;  3NQT A;  2NUC A;  1SYE A;  3C0O A;  5DM6 3;  3SHL A;  4DF7 A;  4KJN A;  1EYA A;  1SMY D;  5IT9 E;  4NMZ A;  4FNF A;  2ENB A;  2F0I A;  2F3V A;  5IGF A;  3T51 B;  3H94 A;  3GTJ B;  4KV6 A;  1B50 A;  5ISR A;  4I65 A;  4M1U B;  1GUW A;  1X3Q A;  5DAU A;  4IN3 A;  4IAL A;  2JA5 B;  1O80 A;  2XVS A;  4LJZ C;  3Q6S A;  1LTA D;  3IL8 A;  2L9H A;  1QG7 A;  2F0M A;  1VF5 C;  2XN9 C;  2DNE A;  1EL0 A;  5JEA H;  3A7A B;  3GD7 A;  4ZAI A;  1YNJ D;  1I6H B;  2K05 A;  1X3P A;  3FRP B;  3A8J E;  4G4K A;  2IX0 A;  1F2Z A;  4OIK A;  2F0H A;  1JOO A;  1WTP A;  1LTR D;  2H1E A;  3M7G A;  5C6A A;  1U4L A;  4ODG A;  5KNC A;  1EQT A;  1F77 A;  3K7A B;  1GUT A;  3I8Z A;  4C3I G;  5C4H A;  2KUM A;  3TME A;  1LTB D;  1PFN A;  3T4A C;  1AP0 A;  3X3M A;  4K8I A;  1RTO A;  1Q8I A;  1WCM B;  2JA8 B;  3MC0 B;  4PQX A;  1F9P A;  1B9M A;  3NK9 A;  1QOH A;  3UI2 A;  3CKI B;  4XYQ A;  5CV8 A;  3DEO A;  3HZX A;  2Q8I B;  2J7Z A;  1ROD A;  2BDN A;  4HN7 A;  2HUG A;  1SYB A;  1M4V A;  1ZYR C;  5JAV A;  3ND9 A;  4NKL A;  3MWY W;  3NXW A;  4ULL A;  3FMC A;  5I2Y A;  4A3K B;  4C3H B;  4KK7 A;  3DXJ C;  3K5L A;  2WAQ B;  4XQN A;  2RSN A;  3H09 A;  1WTW A;  1JIC A;  4TSS A;  1E2W A;  4C1N K;  5FLX E;  3G6J B;  2TMP A;  2XRQ D;  4PMC A;  1VMP A;  1JWU D;  1BXT A;  1I4X A;  1IYU A;  1LT6 D;  1TWF B;  3E5S A;  2L1B A;  4XQQ A;  5C5L A;  2HCC A;  4HSP A;  1QNK A;  1I4G A;  1SND A;  4PMB A;  2MP1 A;  4ABN A;  4QB4 A;  1I4Q A;  2F0J A;  4RHS A;  1L0X B;  2I07 B;  1TY0 A;  3GO5 A;  2JYO A;  2WV6 D;  2RDH A;  5LL6 S;  2F0V A;  3VYS A;  1CTM A;  4OHJ A;  1O78 A;  2NYZ D;  5IGD A;  4BWG B;  3MA2 B;  1MI2 A;  5I6W A;  4ID6 A;  5K5P A;  2IT1 A;  3HGB A;  2EYP A;  4N9P A;  2A69 D;  2R93 B;  2NTS A;  3N6R A;  3BZD B;  1KDB A;  1Q1E A;  3M85 A;  3OWE B;  2RKS A;  4KKT A;  3C2P A;  3ZYY X;  2G9H D;  1JR0 D;  1EY5 A;  1WD0 A;  4K2K A;  1BCP D;  1YNN D;  3RZD B;  4DAP A;  3K5O A;  3H3V C;  4DU9 A;  2A68 D;  2DY7 A;  5IOC A;  3D8G A;  2MHV A;  2BA0 A;  1I6V C;  3W2D A;  4ZK9 B;  5ELE A;  3BS1 A;  1DOM A;  1II3 A;  2RDF A;  3K59 A;  2EYH A;  1TR5 A;  1AN8 A;  4NDX A;  1VDZ A;  1UEA B;  5C0X H;  4FF1 A;  3VYT A;  1J9O A;  4U68 A;  2XSC A;  3DHQ A;  4RCO A;  3VR5 A;  3E6Z X;  3BVZ A;  4L63 B;  4H13 C;  4KY6 A;  3LNN A;  4K2L A;  1GXD C;  4FVM A;  1A2T A;  5M3F B;  3OHX C;  3WOF A;  2WKC A;  1NR4 A;  4BY7 B;  5JOB A;  3V05 A;  2ZT9 C;  2EY5 A;  4NP5 A;  1RCV D;  2PZU A;  4PNY A;  1I4H A;  4CJ1 B;  5FO9 B;  3K0Y A;  1D2B A;  2Z1C A;  1FD7 D;  2L12 A;  1U4M A;  4GZY C;  4A93 B;  3OIQ A;  4KY7 A;  1CA6 A;  1G2S A;  2L5T A;  1KLU D;  4O1N A;  2O2L D;  3S14 B;  1MD2 D;  4X3T A;  1LV9 A;  1PFM A;  4IUT A;  1A6X A;  5M5Y B;  1IL8 A;  2O5J C;  3S1R B;  1LAC A;  5M3M B;  1HRJ A;  3LWE A;  1JC7 A;  4K5X A;  3S2H B;  5LL6 X;  1QIL A;  2EY1 A;  5EKI A;  5TSS A;  1H9R A;  5CV9 A;  3T16 A;  1MSG A;  1PTO F;  3M3Y B;  3EJI A;  2F0D A;  4FO2 A;  1S4Z A;  3SDZ A;  1S5B D;  1EYC A;  2JA7 B;  3G7L A;  3FEW X;  4PV1 C;  4DK1 A;  5G3L F;  3Q22 A;  1H9M A;  4H7B A;  1EZ8 A;  4HCS A;  2WIN B;  2F03 A;  4C3H G;  3GTO B;  2WII B;  2M00 A;  1JOK A;  2SDF A;  4IUR A;  1BNZ A;  2B2W A;  2F1M A;  2RQX A;  2E2J B;  1HXY D;  1EYD A;  2GA4 B;  1CI3 M;  3GV3 A;  3LX0 A;  5EBD A;  2CW0 D;  4S3S A;  2QDB A;  4C3I B;  4ZKB B;  4KI0 A;  4G7H C;  4A3D B;  2C5C A;  1V1O A;  5ELF A;  4RA8 A;  1V43 A;  5EPK A;  1U9R A;  3NPP A;  3TP6 A;  2VB3 X;  1O7Z A;  1Z47 A;  3BYT B;  2KCC A;  1J8I A;  1RTN A;  3NTI A;  2PCF B;  5C5M A;  4C56 C;  1BDO A;  4K8J A;  5KRU A;  3S15 B;  2K28 A;  3S1M B;  1AW7 A;  2TSS A;  1IKM A;  2SNM A;  4E6I A;  5C3X A;  4IFD I;  1CQV A;  3OIP A;  4EQO A;  2MJ8 A;  5AFW A;  1OXV A;  1LT5 D;  1PTO H;  2R6G A;  4RGT A;  1C8C A;  5DNF A;  2VB2 X;  3W3A A;  1BF4 A;  2YU9 B;  1B1Z A;  2R61 A;  4MIU A;  3ERQ A;  2QEJ C;  1YNN C;  2AQ2 B;  1BBX C;  5DEH A;  4RFB A;  1Z7T A;  4ZRZ A;  3FDT A;  2Z4I A;  4R8N A;  1MBY A;  1BR9 A;  2D9U A;  1STY A;  2IW3 A;  5NUC A;  2LMC B;  4FYD A;  3TSS A;  2OT2 A;  4DNT B;  5CBA E;  2J0T D;  3HP3 A;  1A3V A;  1SYF A;  2B8F A;  2R7Z B;  1EFI D;  3L7Z C;  2KEC A;  4IFD G;  4CHT B;  2X6G A;  3GTG B;  1FNV A;  3F2U A;  3PIP 3;  3ERO A;  3QJY A;  3AB9 A;  1G2T A;  1WTO A;  3S1N B;  1XTC D;  4B9X A;  2QCP X;  4EQN A;  1HA5 A;  1CHQ D;  5JPM C;  1EQV A;  1PRT D;  5CMD A;  1R9T B;  1SNQ A;  4DK0 A;  1SJH D;  4LAA A;  3K57 A;  5CV7 A;  2F0O A;  3HOZ B;  3BVG A;  3RMH A;  3PUZ A;  4G7Z C;  4FF4 A;  5E1F A;  4XT3 B;  2F0G A;  3FPU B;  1ZXT A;  5C4J B;  1EY0 A;  2B39 A;  5E3F A;  2F0F A;  3L9A X;  4OGQ C;  1DYQ A;  3NUC A;  3ONA B;  5EKL A;  3VYR A;  1HHV A;  1BQQ T;  4N9T A;  2RSO A;  3FKI B;  4A3I B;  4JBW A;  3VYU A;  1A3T A;  2B2U C;  2NN6 I;  4OL7 A;  2EE1 A;  4QMG A;  3SK8 A;  4DXG A;  1PTO B;  2ZXR A;  1JOR A;  2HCI A;  2B2T C;  1HQM C;  4LMQ D;  5BN3 A;  5EGT A;  3Q0A A;  3IAY A;  4BY1 B;  2HDL A;  5CV6 A;  5FK9 C;  2DY8 A;  4X3S A;  2F0S A;  1JWM D;  4IUP A;  4Q0F A;  2H4O A;  3S1Q B;  3O13 A;  1QNU A;  1IKL A;  4XTC S;  3D3R A;  5CV4 A;  1PMR A;  2AUJ D;  2WAC A;  5C0X G;  1A3U A;  1LO5 D;  2F4I A;  2QIL A;  3SEB A;  1BCP F;  3D4R A;  4TQU S;  2NN6 G;  2L11 A;  4M8A A;  1IHZ A;  2F0Q A;  2IWH A;  1CHP D;  2F0K A;  4KY5 A;  4RAU C;  1SXT A;  2ZXO A;  1EOT A;  4IUU A;  1DOK A;  5A2Q L;  3J80 L;  1V8Q A;  5D3D A;  2F0W A;  1NCV A;  1HQR D;  1Y1V B;  3T56 B;  5D65 A;  4L8J A;  3E0J A;  3D4W A;  5ELC A;  2CW0 C;  1LT3 D;  1Y1W B;  4BBR B;  5BN5 A;  5K36 H;  3N52 A;  2Z4H A;  2PZT A;  3DEP A;  2B2T A;  3KLR A;  1F2M A;  4J6H A;  1U4R A;  2NVT B;  1R4Q B;  2QKI C;  4C3J B;  3C1E A;  3C0N A;  2ICI A;  1M8A A;  1B53 A;  4Z9C B;  1T5X D;  5CGK A;  1W6J A;  3C0M A;  1D5M C;  1O7Y A;  2L55 A;  1B44 D;  3MXU A;  1HPC A;  1FNU A;  2NVX B;  2EYJ A;  5FOB B;  2IL8 A;  2E75 C;  3SK4 A;  2JEB I;  3MZ5 A;  3TP8 A;  1G91 A;  4IFD H;  1DM0 B;  4WFN 3;  1Q1B A;  2B2V C;  1H9S B;  1KAA A;  2AQ1 B;  4EQP A;  3HOX B;  2JXM B;  1TS3 A;  2JP1 A;  3EQL C;  1FNW A;  2EXZ A;  1IYV A;  5EQ0 A;  1EIG A;  2D5D A;  4V0B A;  3PUY A;  2E2D C;  2FMC A;  1QE6 A;  4DN4 M;  3BDO A;  1K83 B;  2K5W A;  3I73 A;  3MEH A;  2K04 A;  4KN4 C;  1MGS A;  4AYB B;  1D1K A;  2ZXP A;  2Q8T A;  2BE5 D;  3NHH A;  4YIJ A;  1PTO C;  1I50 B;  1SDF A;  2EY6 A;  1ESF A;  3I90 A;  2F0U A;  1H9K A;  3TN2 A;  1OXU A;  1DOL A;  3P75 A;  3DM1 A;  4ILW A;  4KMU C;  1XX8 A;  4H0L C;  5A35 A;  3HOY B;  2V4D A;  5C4Z A;  2B2V A;  3WOE A;  3CRL C;  3EA6 A;  2HQE A;  3BDL A;  3J7A V;  1IW7 C;  2A6E D;  1PLF A;  2F0N A;  1HFN A;  2PZW A;  4H44 C;  5A2Q E;  2R92 B;  4Y7N B;  1JCK B;  1ENA A;  4IUN A;  4KHZ A;  4K6L A;  3C3L A;  1XYI A;  1SBB B;  4G57 A;  4XDX A;  3DWQ A;  1ESR A;  2NN6 H;  2K32 A;  3VR2 A;  2K6A A;  5JEA J;  2A5H A;  1SMY C;  2PO4 A;  4KHV A;  4MHE A;  4A3F B;  3FVQ A;  1MSH A;  1VMC A;  4RCN A;  2NTT A;  2B2Y C;  3NP8 A;  4RKL A;  2K1B A;  3PUX A;  2EJG C;  2JE6 I;  3S16 B;  2WKD A;  2A74 C;  3U9S A;  2CQA A;  1A2U A;  1BCP B;  4TRD A;  2PQE A;  1F2L A;  3MXG A;  1E0B A;  1OO9 B;  1SEB D;  5CR3 A;  2A6H D;  1AZP A;  1STE A;  1JB3 A;  1STN A;  1YNJ C;  2KCN A;  3H91 A;  1TVX A;  2NZ1 D;  1RDP D;  1JWS D;  5KNB A;  2K03 A;  1ENF A;  2LS0 1;  5COY A;  3J81 L;  2N55 A;  2PW5 A;  1A15 A;  2F3W A;  1X32 A;  2XNA C;  5C3W A;  3SK6 A;  2F0L A;  2QF7 A;  3HKZ B;  2L4N A;  5EKK A;  2EYO A;  4IFD J;  3MVV A;  1TS4 A;  1Q12 A;  2AWN A;  3V96 A;  1QJO A;  1CA5 A;  1NSN S;  3EVQ A;  4K5V A;  1EZ6 A;  1EEI D;  1PXU A;  1SFO B;  3NWS A;  4C3J G;  4WJW A;  2B2Y A;  4EVO A;  1PRT F;  5BN4 A;  5E4W C;  3T53 B;  4F88 A;  1EWH A;  4HMJ A;  3MFG A;  1HUM A;  3PUW A;  3PV0 A;  1ILQ A;  4KKS A;  2IPK D;  1SNP A;  3L3O C;  4B08 A;  5KIX A;  3KK7 A;  1F9Q A;  3SE0 A;  5KYI A;  1EY4 A;  1S5D D;  3OOC A;  3PUV A;  4IUV A;  2RBM A;  1WTQ A;  4CGY B;  5J1Z A;  2XWB B;  3HOU B;  3VA5 A;  1F9S A;  3Q23 A;  1ONL A;  1H9S A;  1Y8N B;  5J39 A;  4HTH A;  3SVM A;  5KGU A;  1GUN A;  4F87 A;  1DD2 A;  4WOR A;  3GP7 A;  1BO0 A;  3EFX D;  1ILP A;  4I7Z C;  4L6T B;  1Y8P B;  2RVL A;  3C46 A;  2BE5 C;  1AZQ A;  1D5X C;  1PYW D;  3DUZ A;  5FO7 B;  2SNS A;  4XQJ A;  4X3U A;  2KED A;  3DWA A;  1KLG D;  1L0Y B;  4XT1 B;  3GTQ B;  4BA1 I;  3TDQ A;  5J22 A;  4R9W A;  3C1F A;  4IQZ A;  3MFY A;  2EYF A;  4ZQ3 A;  3K5N A;  3OWF A;  2A69 C;  4C2M B;  4K5W A;  5ELB A;  1UAP A;  2EPB A;  5C0X J;  5M9O A;  1F9R A;  1JOQ A;  2ID0 A;  5K36 G;  1ZYR D;  2MGS A;  3URY A;  2YYZ A;  2EDG A;  4J1M A;  1BCP C;  1TS5 A;  3BDC A;  5FKA C;  4OO1 I;  1EY9 A;  2VXW A;  2K5D A;  1RKN A;  4FXG C;  5M5W B;  2A68 C;  4KN7 C;  4RH6 A;  1SNC A;  3R8B A;  1F2Y A;  1AEX A;  1GOZ A;  5KYL A;  3OMC A;  3D6C A;  1JQY D;  3A7L A;  4J8Q A;  1Y8O B;  1ZKO A;  3SK5 A;  3CRK C;  1K8M A;  2IJ0 A;  4O42 A;  2RDG A;  2F0T A;  3NE5 B;  2EVB A;  3I4M B;  3QOJ A;  3NBI A;  4DAY A;  2K7V A;  4OO1 G;  2CHB D;  1HUN A;  4DAV A;  1TQO A;  4DGZ A;  1RF2 D;  4QF4 A;  3G4O A;  3HRZ C;  4ME5 A;  2MPM A;  1B4O A;  1G29 1;  1PZI D;  3D6W A;  4ZYS A;  1KNE A;  1BUV T;  2Z8L A;  3QO2 A;  4A3E B;  1PFB A;  1SE3 A;  3GQB A;  4QCL A;  3I3C A;  1CM9 A;  3P20 A;  4CJ0 B;  1QB5 D;  2FFK B;  1PRT B;  1Q90 A;  3BVM A;  3SR1 A;  3NWT A;  3CQZ B;  1KDC A;  5JPN C;  1TWH B;  2XIW A;  3KLS A;  2KOL A;  1B2T A;  2FHT A;  3IFT A;  2JEA I;  2B63 B;  1STB A;  1SYG A;  2O4X A;  3NBH A;  3MAQ A;  3RD4 A;  1NUC A;  4BBS B;  3JAM L;  2EJF C;  4DA2 A;  1R4P B;  5HUR A;  2IX1 A;  2BOS A;  1KNA A;  2E76 C;  5JVH 3;  2OF1 A;  5E4X A;  3I70 A;  2KHS A;  2NBF A;  5HGT A;  3R3O A;  3K5M A;  4DXF A;  5EPL A;  3SXH A;  2CVR A;  1U4P A;  1FGB D;  2G9D A;  2B2U A;  3WDN A;  4RWS C;  1SYC A;  1EY7 A;  1PDQ A;  2I46 A;  1O7L A;  4Q5V A;  2KVM A;  1DJR D;  5CV5 A;  2DN8 A;  4RGM A;  2EOT A;  3RZO B;  2NVQ B;  1G6Z A;  1EIH A;  3OPO A;  3D4D A;  4EGV A;  1EY6 A;  3M4Y A;  4KTA A;  1QCB D;  2O5I C;  4V19 0;  2OEO A;  4TKO B;  1XWE A;  1LTS D;  4CKE A;  1V1P B;  4NW2 A;  5T1G A;  2D62 A;  2XWJ B;  1CFM A;  4G7O C;  1FR3 A;  4DFA A;  5IOD A;  2AUK A;  4OO1 H;  1DON A;  3TP5 A;  4HCE A;  1GJX A;  3MXP A;  2J4X A;  1KTK A;  1T5E A;  2M2L A;  3GTL B;  1PZJ D;  5IGB A;  4FP5 D;  3Q24 A;  4XIG S;  4P2C B;  4ZKC B;  5IGC A;  1WVL A;  3GTP B;  1S5F D;  1RJT A;  4ZUJ A;  3IKJ A;  1ET6 A;  1ET9 A;  3I4N B;  2LY7 A;  1PZK D;  4K6D A;  3GTK B;  5I2X A;  5CC4 A;  1DCZ A;  3QIA A;  3HOW B;  1PRT C;  2K33 A;  1W6K A;  2KJX A;  2N88 A;  3K58 A;  2NWG A;  3BYY B;  3LWU A;  5KEE A;  1K8O A;  2SOB A;  1PRE A;  2VUM B;  1LAB A;  3CHB D;  2DNC A;  1LT4 D;  2LFN A;  1CQF A;  2PNR C;  4HED A;  4F8M A;  3JAM E;  1LTG D;  5I9O A;  3I4L A;  3PO2 B;  2K5Q A;  3GTM B;  2BA1 A;  5ELD A;  4PMW A;  4KKU A;  5EPJ A;  4C1N I;  3J80 E;  1D1I A;  3VR4 A;  4B9W A;  1ZEQ X;  1HA6 A;  1WTR A;  2R3Z A;  1OXS C;  4HSV A;  3DMU A;  3RLF A;  2C9O A;  1CZW A;  1SJE D;  4JK1 C;  3D31 A;  2Q8R E;  4R8I A;  1JE4 A;  3MTS A;  2E2H B;  2FMM A;  5CYU A;  1STG A;  3QB3 A;  3DWP A;  1SE2 A;  4A3B B;  2PYK A;  5LHY 1;  3ND8 A;  1C48 A;  2B8G A;  2NVY B;  2Y0S B;  5IGE A;  2PMZ B;  3PIO 3;  1KAB A;  4FF3 A;  1TKW B;  3QWN A;  1RHP A;  3X3N A;  1EU3 A;  1TII D;  1ENC A;  4CKC A;  1UUP A;  1VCI A;  1STH A;  1DXM A;  1I4R A;  4RGN A;  2OXP A;  4KJO A;  1TWA B;  3TP7 A;  1VF7 A;  5EJW A;  3HOV B;  4HR7 B;  4MN3 A;  2A73 B;  1GUS A;  5D14 A;  4HMI A;  1ML0 D;  2JA6 B;  1NR2 A;  1SAP A;  4LK1 C;  1LLR D;  4RGO S;  1WTX A;  2KA7 A;  1CK1 A;  2B2W C;  2EJM A;  4FF2 A;  4CKB A;  1WTV A;  4FXK C;  1TS2 A;  3M7N A;  1ICW A;  4ZUI A;  4K14 A;  2WP8 J;  3A55 A;  3H0G B;  3MHB A;  4QIW B;  3PMF A;  5M5X B;  1GHJ A;  3NSW A;  3OMG A;  3RUZ A;  3KUP A;  3TBI B;  3VR3 A;  1STA A;  5JJZ A;  3I72 A;  1G8Z D;  3TZU A;  3A8I E;  3HEJ A;  4XXE A;  4ZLT F;  5JVG 3;  5KND A;  3TZD A;  5C4X B;  3MXN A;  4UDU C;  1HTP A;  3GV6 A;  5D3I B;  3S9W A;  1RD9 D;  4UAI A;  1LTT D;  1HFG A;  3PO3 B;  4RHR A;  1CT1 D;  1EEF D;  1GUO A;  2FIN B;  3NQI A;  3HG9 A;  1DZ1 A;  1TU2 B;  3QG1 A;  2L0C A;  1V1P A;  1D5Z C;  2M9V A;  1TWG B;  1XXG A;  1SNO A;  1NAP A;  1H9J A;  2SEB D;  2VNU D;  1FYC A;  2X6L A;  3K6O A;  2WB1 B;  1B3A A;  3J7A F;  2EY2 A;  5COR A;  1LTI D;  1E2V A;  2AWO A;  1TT2 A;  3KLS X;  2D2C C;  2NB0 A;  1AFP A;  5T1I A;  2EYM A;  3AMU A;  3R2T A;  3OSO A;  2BDO A;  2ICE C;  4OIJ A;  3S17 B;  5IT9 L;  3A56 A;  4HAE A;  3A54 A;  1CZG A;  5I9P A;  3IFD A;  3H6M A;  5JEA G;  2E2I B;  1EU4 A;  1EY8 A;  1OXX K;  1Q3L A;  2LKV A;  1SYD A;  3P1H A;  1GHK A;  1SNM A;  3NTK A;  4IZ8 A;  2X69 A;  2EZV A;  4RKB A;  3CU7 A;  1Y69 U;  3J7Y W;  2PPB C;  3KBX A;  1Z6H A;  4A3M B;  4F7X A;  4CJ2 C;  3R93 A;  1HCZ A;  4A3G B;  3NTH A;  3KBG A;  1EWC A;  3R2I A;  5DM7 3;  2A6E C;  2KQ3 A;  5FO8 B;  1Z52 A;  3J81 E;  3BG3 A;  4WRD A;  3QOL A;  1I4P A;  4DNR B;  1TWC B;  3ITP A;  2F0E A;  1SSO A;  1B9N A;  3VR6 A;  4U67 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...