1BCPB

Binary complex of pertussis toxin and atp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
197
structure length
197
Chain Sequence
PGIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYLGGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVFVRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFETYALTGISICNPGSSLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN
publication title Crystal structure of the pertussis toxin-ATP complex: a molecular sensor.
pubmed doi rcsb
molecule tags Toxin
total genus 42
structure length 197
sequence length 197
chains with identical sequence H
ec nomenclature ec 2.4.2.-:
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02918 Pertussis_S2S3 Pertussis toxin, subunit 2 and 3, C-terminal domain
B PF03440 APT Aerolysin/Pertussis toxin (APT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bcpB02
3.10.40.10 Alpha Beta Roll Pertussis Toxin; Chain B, domain 1 Aerolysin/Pertussis toxin (APT), N-terminal domain 1bcpB01
1EFID 1S5CD 1CHQD 1M4VA 4RHSA 3R2IA 1EWCA 4DXGA 5I4DA 1PZID 1LO5D 1LT6D 1TS2A 3BVZA 1BCPF 1PTOB 2NTTA 2G9HD 3OWEB 5ELEA 1BCPC 1V1OA 2XRQD 3G4NA 2AQ3B 1ESFA 1XTCD 3V05A 1LT5D 4OHJA 1EEID 1S5BD 5D3DA 1JWMD 1LTID 1HQRD 3EFXD 1JWSD 1JQYD 3BZDB 1TS5A 5ELBA 3BVGA 1PYWD 1LLRD 4UDUC 1JR0D 4RGTA 1L0XB 4RH6A 2IPKD 2Z8LA 1LT3D 1TY2A 1SBBB 2WV6D 3MC0B 2CHBD 3KLSX 3DWQA 1I4HA 3GP7A 4RGNA 2SEBD 3C0MA 2RDGA 1PRTD 1T5XD 2RDHA 1BXTA 1PZKD 1I4XA 2XN9C 4RHRA 1LTBD 1SXTA 1FNUA 1SE4A 1F77A 5FK9C 1EU4A 3G4OA 1PTOH 1SE2A 3BYYB 4BWGB 3TSSA 1SE3A 1SJHD 3DWAA 1S5FD 1D5MC 4RGMA 1D5XC 5ELFA 1FGBD 1G8ZD 1TS3A 4ZYSA 3C0OA 3MFGA 1UUPA 1HTLD 5ELCA 4L6TB 2J4XA 3BYTB 4C56C 3C0NA 2AQ1B 1I4PA 1DJRD 1PRTF 1RD9D 1PZJD 1BCPB 2TSSA 1PRTC 3DWPA 1S5ED 1SEBD 1I4GA 5ELDA 4TSSA 1ENFA 1JCKB 1LTAD 3O13A 4K6LA 1STEA 1FNWA 1L0YB 1UNSA 1S5DD 2ICIA 4O1NA 1I4QA 1HA5A 1ET9A 1CT1D 1HXYD 2O2LD 1EEFD 1AW7A 1DYQA 1D6EC 2XRSD 1PTOD 1AN8A 4Z9CB 1V1PB 1FNVA 2XNAC 4RGOS 1XXGA 1Z52A 5D3IB 1D5ZC 4L63B 1B1ZA 3W2DA 3SEBA 1CHPD 1LT4D 1KLGD 2QEJC 4RFBA 1ET6A 2AQ2B 1LTRD 1QILA 5TSSA 5FKAC 1EU3A 1FD7D 1TS4A 2QILA 1B44D 1JWUD 1BCPD 1TY0A 1KTKA 1RF2D 1SJED 1CQVA 1RCVD 1KLUD 1PTOF 3BVMA 2NTSA 4DXFA 3R2TA 1PTOC 1RDPD 1LTTD 3R8BA 3URYA 1LTSD 3CHBD 1PREA 2IJ0A 1V1PA 2R61A 1MD2D 1PRTB 4RCOA 1GOZA 1I4RA 1LTGD 3EA6A 1CK1A
chains in the Genus database with same CATH superfamily
1EFID 5FJ8G 3R3OA 1EQVA 4GNXB 5COYA 1VQCA 4YCUA 1Q3LA 1LT6D 1NMFA 1HNZQ 4A3BB 3J7A5 1OO9B 1E0BA 2XRQD 2B2VC 1Q82C 4LNQA 1ESFA 4POGA 3RZOH 3DMUA 3VDYA 4ULLA 3NBIA 3SK8A 4H7BA 3M85A 1PH5A 2B63B 1BUVT 1K83B 4K14A 2A8VA 1RHPA 3GTKH 5JEAH 1D1KA 5HURA 2E2IB 5CV5A 2ZM6Q 2MPMA 3MC0B 1O7YA 4OONA 1I4HA 4G57A 2F4VQ 4A3KH 2QDLA 3GTPH 3AFPA 4WRDA 2IX1A 4DUZQ 3NXWA 2EYHA 4EQPA 4X3SA 4A3BG 4HSVA 1SJHD 1N9WA 1X55A 1IL8A 1UEBA 4LF6L 4NPSA 2LY7A 2IX0A 1N34L 3J81E 2AQ1B 1PRTF 3STBD 2F03A 3VA5A 1B7YB 4UHVA 5ELOA 4OX9L 3EIVA 4TSSA 3I73A 2ALYB 3OTOQ 1R9TB 1YI2A 1X3FA 1S5DD 1PH2A 1HXYD 2BA0A 2SDFA 4I65A 1AE2A 3FKIB 3KF6A 1BR9A 4A76A 4DR3L 1MHWC 2VUMG 1IKMA 4IOCA 4OWXB 3HZXA 1VQGA 2EYMA 3HOZB 3S16B 4OIKA 1XYIA 1Q46A 2VY3A 4KJOA 3HS0C 3A56A 3G71A 2CH4W 1SE8A 1S72A 1SYDA 1TWCH 2HCCA 3J7AF 4ZQ3A 3ULLA 2NBFA 1A2TA 1YHQA 5I6YA 1OXSC 3BVMA 3QIAA 2X6LA 1HFGA 3FKIG 1S4ZA 1SROA 4ZUIA 2C5CA 1I4RA 3CQZB 3EA6A 4A3IH 1IW7C 4ME3A 3HOWH 1PFNA 3DM3A 1I94Q 3C46A 4YCVA 1FJGL 5IGEA 1LT5D 1K0RA 2F0UA 1X3QA 3J80L 5IP7G 3S1MH 2UXBL 3D31A 4UDUC 2V1CC 3PF5A 1AEXA 4KN4C 1JJGA 3Q22A 1B70B 3OSOA 4KLKA 3UDGA 3KLSX 3F2CA 3Q6SA 2CQOA 1HZCA 3Q8DA 1ZYRC 4GKKL 3EQLC 4HIOA 1EYAA 2UXDL 1PZKD 2PZUA 2CH4A 4MNOA 2A74C 2VQFQ 1SE4A 4KD4A 2IT1A 5GAHC 1NE3A 3NQIA 5J3BA 4P75A 1SMYC 3I8ZA 3S14H 3ERSX 4ZRZA 2OTJA 3W1BA 1EYCA 5G3LF 4OGQC 1TS3A 1A0IA 5DM73 2N78A 1EY9A 5IGBA 4QIWE 2R93B 2B3GA 4JK1C 1RIPA 3CRLC 4A3LH 3HOUG 4NXNL 4DUYL 2Z6KA 4IQZA 1U4RA 1VQOA 4XIGS 1L0YB 5EAYA 1X9NA 4O1NA 4LF8L 3RN2A 3T1HL 4K0KQ 3W3AA 2DN8A 2PNHA 1DOMA 1D1IA 2XNAC 4GLXA 4KHPL 1PLFA 1M8AA 1YZ6A 5M5WH 3M3YH 1AP0A 2KEDA 3PO2B 4A3CH 3K5LA 4LF6Q 2OEOA 3J81j 1IKLA 2E2DC 4HJ9A 1WTWA 4DV2Q 1X32A 4AH6A 1VQPA 4OX9Q 1TU2B 3PO3H 2QILA 2R93G 4DK6C 5GAGC 3K5MA 1STAA 3D6CA 4C3HG 1Y1VH 5GQOA 2Z6KC 1AZQA 1K28A 4IUPA 2NN6I 1SYBA 2NTSA 3HFZB 4JC0A 2ASBA 3AQQA 3I70A 1CKNA 1H9SA 2IJ0A 2V4DA 5FO9B 5C4XH 5C3WA 4JI0L 2LXJA 3TEHB 4DNIA 1Y69U 1R4PB 3M4OB 1GVPA 1IBLL 3MEHA 4XQNA 4JOIA 3WDNA 1STNA 2F0DA 4FNFA 1GJXA 2L11A 1XNRL 5D14A 4OEMB 3GV3A 1W6KA 4OHJA 2RSNA 3VYRA 2MJ8A 5C3XA 3HOYH 4PMWA 2CW0C 1DXMA 5IYDH 4DAVA 1JWMD 2KCCA 2N88A 4CHTB 3VR4A 2D5DA 1B9MA 1JR0D 2EXDA 2NVYH 2JA8B 2KHJA 5E7NA 3PIO3 4B3SL 2JEAI 2Z8LA 4JBWA 5ELNA 2WV6D 4B3ML 2RKSA 3I91A 5CMDA 1NSNS 3SK6A 2F0LA 4JOIC 2WAQE 3MWYW 4LK1C 4LFBQ 4JI6Q 2FINB 5E3FA 5IT9E 1E1OA 1BQQT 1F2MA 1QVCA 3KF6B 1EYDA 2Y0SB 4K8IA 1VMPA 5FLXc 3GTJB 1S5FD 4AYBB 4H0LC 1QOHA 2UXBQ 3PUZA 4PMCA 3I4NB 1CM9A 1B4OA 1WYDA 4MZ9A 4POFA 1T5EA 4DF7A 4IOAA 5I6WA 3C0NA 1GHJA 1NR2A 2DNEA 3KBXA 2Q8RE 4V0BA 1PRTC 2JA8G 3DWPA 3GTOB 2A6ED 1PH8A 4L8JA 4GKKQ 4K2KA 2UXDQ 3D4RA 2Q8TA 3G48A 3A54A 1XMQL 1PXUA 2NVXH 3J7YW 3Q0AA 2A68C 3OMGA 4A4IA 1E3PA 4LFAQ 4C1NK 4B3RL 4Z9CB 3UDXA 2UUCL 2UUBL 3N6RA 4H44C 2VZAA 3QWNA 2Y0SG 1A2UA 1U9RA 3LWUA 1HH2P 3U58A 2RSOA 4AYBG 1KRSA 1I50B 2YYZA 3I4NG 3CAMA 1DOKA 3JC66 3FMCA 5C5LA 2ATWA 4DUYQ 3WOEA 3UE1A 1PH4A 2BE5C 2K75A 4K6DA 3TP6A 1CZGA 3CMAA 1SJED 4MHEA 1H9MA 3T1HQ 1RDPD 2GVBA 2JA9A 3PUVA 4P72A 4C3HH 4A3FG 3I4MB 2F0MA 4L5SA 3U4ZA 1V43A 3PIPA 4WJWA 3NUCA 1XPOA 2NVQH 4MTKA 3S9WA 5C0XI 3P1HA 4A3MB 2WINB 1KL9A 4K5WA 1QWYA 1II3A 3NEMA 1IYJB 1PTOB 2NTTA 3OWEB 4HMIA 5M3MH 1EY4A 1MSGA 1YNND 3J81i 2F0TA 2PCFB 4DV4Q 3RR5A 1ILPA 3A7LA 2ZJRA 2PYKA 2K50A 1ICWA 5EGTA 2DGYA 3GTMB 1LLRD 4C3JG 5K36G 2EY6A 1KIXA 1GD7A 2XWBB 3I4OA 1U4LA 2K5NA 1YEZA 1WCMG 2D9UA 4A3EB 4R4QA 1WVLA 4RGNA 4A3MG 1TKWB 2F0NA 5I2XA 1K8AC 2F52A 4WJ4A 1XNRQ 1WFQA 2QGQA 2ZXOA 4IURA 5FLXE 1WTPA 5GADC 3CC7A 1N36Q 4DV5L 1EZ8A 1S40A 2KHSA 1IBKL 1STHA 3HOXG 4ZYSA 4X65L 2KUMA 3X3NA 2MQHA 1YBYA 4B3SQ 3NENA 1STBA 2FXQA 4JI8L 1B3AA 1WTHA 4LF9L 3U50C 5KRUA 1JCKB 1NJIC 3SK4A 4UP9A 2ZXPA 2A6HD 2H5XA 4DFAA 4HCSA 2ZTEA 3F2DA 4HMJA 4UY8C 3VYTA 4Q5VA 1CKNB 3M9BA 1H9SB 3I3CA 3CPFA 3CXCA 1HJPA 2R7DA 4H13C 4G7ZC 1B1ZA 5IWAQ 1ESRA 1CHPD 1VQ5A 1EIYB 4BXXG 1TR5A 2B2TA 1DGSA 4PMBA 1LTRD 3WOFA 5C44B 5CBAE 1Q12A 2L9HA 4JI3L 4G4KA 4ID6A 4CDEC 4A93G 2PQAA 3H15A 1H95A 1BCPD 1FYCA 1TY0A 4A3DB 2HDLA 5IGFA 3GTLH 1Q8KA 3ONAB 1XMQQ 1W2BA 2G5DA 1LTTD 2B29A 1D7QA 2H1EA 2JEBI 4B3RQ 2R61A 2KQ3A 2UUBQ 2UUCQ 1PRTB 3BDOA 5DLQE 4DAYB 4JV5L 1TWAH 1CK1A 1UE5A 3VR5A 2R7ZB 4DV1L 4C3IH 4U68A 2GA4B 4GN3B 4KY6A 4EQ5A 3D6WA 1QCBD 3CU7A 5I4DA 2B2TC 1EQTA 4J15A 1HNZL 4GLAC 1H9RA 5ELEA 5M3FG 3RZDB 1V1OA 4OO1G 1RJTA 2EZVA 3SXHA 5IIFA 3TMEA 1PHJA 1S5BD 3OPOA 3ITPA 3H94A 4LMQD 1CKOA 4A3DG 3OIQA 4TKOB 3BVGA 1DCZA 1KRTA 5KGUA 4QUCA 5KNCA 2ZM6L 1W3SA 2A1AA 3OHXC 4LUVA 3MVVA 3PV0A 4X3UA 1G6PA 2WP8J 3GP7A 3GTKB 2F4VL 1YNJD 2ZJQA 4FVMA 1Q90A 3NE5B 5FO8B 4R8NA 1E7ZA 4DR4L 4QF4A 3NELA 3TS0A 1E1TA 2D62A 4DUZL 3P20A 1KC8C 4F7XA 1UWVA 3MXGA 4PG3A 3GTPB 1SE3A 1QZGA 1JORA 1I3QB 3H09A 4LFCL 1O80A 4HIDA 2F0OA 1MBYA 4Y7NH 4JI5L 1Z6HA 5J39A 3MFGA 2AUKA 4DV7L 2BH2A 2E74C 5C0XJ 2MO1A 3TP5A 1RD9D 3G7LA 4IPHA 1XPRA 5I9OA 1CA6A 4A3JH 4RKLA 5DEHA 2JJQA 2WB1B 2OTLA 1NNXA 2HT1A 2FJ2A 2RHSB 4X3KA 2N49A 1RKNA 2NB0A 4IFDH 4HJ8A 1FNVA 3HGBA 3MFYA 4ZUJA 1IBKQ 2SOBA 4X65Q 4HJAA 3J81c 1YJWA 2E2JB 1DM0B 1F2YA 4JI8Q 2KENA 4BXXH 2E75C 1SRUA 1HHVA 2JA5H 1JWUD 2LKVA 3DHQA 3H91A 4BA1I 5CV9A 5JOBA 4BY1G 1IYVA 2ZT9C 1PTOF 4YWKA 1H9JA 5C3EG 2QEXA 1QVFA 4DGZA 1Z9FA 4GLVB 4P73A 1ASYA 5JPNC 1MD2D 2HIVA 4HEDA 1XNQQ 1TVXA 4RAUC 4IJLA 3BZCA 3L0OA 5T1IA 1EQRA 2H4OA 4O0AA 4JI3Q 5JJKA 1TWHB 1OXVA 4A3IB 2JYOA 3T51B 1GUOA 1JB7A 4N8FA 2A69C 3K7UC 1JJCB 1Y1WB 4XT1B 4RA8A 2Y0SE 2G9DA 2RBMA 4AYBE 3K5OA 2F0VA 3K59A 2MGSA 2PW7A 3S1MB 3IKJA 4JV5Q 2N3SA 3TP7A 4DV1Q 3LWEA 3C0MA 2MFIA 4J1MA 1I4XA 5FLXL 2K04A 5IODA 2VQFL 1LTBD 4L5TA 2O5JC 3G4SA 3E9IA 2JP1A 2E2HH 3FPPA 1PFMA 1D5XC 1F9PA 3U9SA 5IY0A 2JA7B 1TWFB 1VQ8A 3C0OA 3NP8A 5EPLA 3S14B 1A62A 3KLWA 1BOSA 4BBRH 2TSSA 2BOSA 3L9AX 1DD2A 1I4GA 3CCLA 1SNPA 2PQAB 5IP9G 4HN7A 4K6LA 4KN7C 1OXUA 3OW7A 4DR4Q 1UNSA 4WFN3 4CBVA 2QKIC 5EPJA 4K0KL 4JPBW 1C9OA 1GKHA 5AFWA 4BBSH 5LHY1 4BY7H 1TWGH 3MEFA 2K52A 1XXGA 2WKCA 5H1SE 4LFCQ 1NBWA 4E6IA 1U4MA 1VQIA 3U4VA 4JI5Q 2ZXRA 2B63G 2IY5B 4DV7Q 1ET6A 4DV2L 1WJJA 2JA7G 1SNOA 4I7ZC 3GQBA 5IGDA 5M5WB 3UE0A 4B3TL 5IYBH 4IZ8A 1KLUD 1KDAA 1DONA 2Q8IB 3PO3B 1SSOA 2QW7A 1VDZA 2WIIB 3E5SA 2K4KA 2L1BA 3KJPA 2AKWB 3FDTA 4DU9A 4GOPA 3DM1A 3H3VH 1HUMA 3C1EA 1SNDA 3A7AB 2KA7A 1YHBA 1BBXC 1FL0A 2JA6H 4RMFA 3CF5A 5JAVA 5C4XB 3M4YA 4YWLA 1JC7A 2NZOA 4BS9A 5FLMH 3BVZA 1HR0L 4FP5D 2X6GA 1EY0A 2ID0A 4FO2A 1RTNA 2NN6G 2SNSA 1SR3A 5FO7B 1WD1A 1YJ9A 2I07B 4DA2A 3HOYB 1VQ6A 3HOVH 1G2TA 3HP3A 1VQAA 4GOPC 1D8LA 1HZAA 2NVYB 3HOZG 3S1QH 1K8GA 2L12A 4B9WA 4YCWA 4LFBL 1QNKA 4JI6L 1F2LA 5FJ8H 3CCSA 3S1RB 2NUCA 4JW0A 3NSWA 4X66L 2EYFA 2HQLA 1B53A 4DK0A 4L5RC 3QR8A 5KNDA 2CVRA 2AWOA 1B2TA 1NCVA 4DV3L 3F2UA 4C56C 3T1YQ 1ZEQX 5DAUA 1S5ED 1JOQA 2L5TA 3NK9A 4JBJA 4KKTA 4KKSA 2EXZA 5DNFA 3GTQH 3P7JA 5I2YA 2ICIA 1HA5A 1ET9A 3NPPA 5IT9c 2DNCA 2ES2A 4APVA 5J22A 2YTVA 3ERQA 4M8AA 4LFAL 3S2HH 3TP8A 3A8IE 1YIJA 2L55A 3W2DA 2NVXB 1EOVA 5LMNQ 4A3BH 1BO0A 5JVG3 3H6MA 4U673 4J8QA 1QG7A 5FKAC 1FD7D 1TS4A 1K83H 2B8GA 3E0EA 5E1FA 4IUQA 1ENCA 2IHFA 3CCJA 3EN2A 1ONLA 1VS0A 2E2IH 1YHAA 3IFTA 1PDQA 1PTOC 2K32A 4NXML 1EY5A 1HNXL 1CZWA 3CHBD 4R4IA 4FF2A 4C1NI 2PW5A 2VNUD 1EEID 1QUQA 2NWGA 2JXMB 3WWVA 2VUMH 3PQIA 3PCOB 2J7ZA 4QQBX 4B3TQ 2EOTA 4QY7A 2B39A 4DV4L 1GO3E 3E0JA 3G6JB 3K81C 4DK3C 2JN4A 5M3MB 3BZDB 5NUCA 1TS5A 1ASZA 3CCUA 2PZTA 4RH6A 1R9TH 5C0XG 1ILQA 3E3XA 3OYYA 5C4ZA 5EKLA 3PUYA 1VQEA 3FKIH 1EWHA 2J0TD 3ULPA 3PO2G 1XWEA 2EIFA 4FXDA 1KNEA 2RDHA 4NW2A 1HR0Q 1KXLA 4JBMA 3X3MA 2K5DA 3FP9A 2K03A 3F8TA 1JJ2A 2EY5A 1N36L 1NR4A 1B9NA 1D5MC 4RGMA 2MO0A 2F0KA 2PMZE 2GVAA 3S17B 2B2YA 3S1NB 5IP7H 4IJHA 2EJGC 2AMCB 2VQEQ 2D2CC 2YTXA 5ELDA 1JICA 3PSIA 4JBKA 3P75A 4FXGC 3I4LA 1QJOA 4FDBA 2ZTDA 4X66Q 3KYHC 2X69A 5CV4A 3J81L 4KY7A 3PIOA 2DY7A 4GOPB 3CMEA 5IWAL 2FMMA 1G6ZA 4HCEA 1EIFA 3RMHA 2F0WA 4R4CA 4DV3Q 1IW7D 1EFWA 2B2YC 3EVQA 3CRKC 3D4DA 1OTCA 2EYJA 5CBEE 3TDQA 2CCZA 4A3GB 3GDEA 1VF5C 3RD4A 3HOUH 2NYZD 4L5QA 2K28A 3S15B 3FVQA 1SMXA 4B9XA 2FFKB 2R3ZA 3FHWA 5IYCG 4V190 4KV6A 3MA2B 3GTLB 1UE7A 2Q2UA 1IXRA 3PUXA 1E22A 4FF4A 4A75A 1PZID 3SR1A 1B3QA 1ZYRD 1TS2A 2VB2X 2XTIA 5KNBA 1TWAB 5M5XH 1P16A 2F1MA 1NUCA 4XDXA 4C3IB 3MTSA 1XTCD 2JSOA 3K80C 1PH9A 3BZKA 3FPUB 5BR8Q 1SYEA 2AUJD 4A3GG 1SMYD 5EKKA 2R93H 4NXMQ 1HNXQ 4WORA 4K2LA 4LF4L 1MKHA 1G291 1PH6A 1MJEA 1SFOH 3CKIB 3S2DB 2Q2IA 2RA4A 3QOJA 2HUGA 3A55A 5EBCA 1BXTA 3HG9A 1VF7A 1VMCA 1A15A 2ENBA 5L37A 2KBNA 5GROA 5BN4A 3LGJA 3KFUA 1ZXTA 3F1ZA 2RDFA 5J1ZA 3N52A 4I7AA 2R92B 3DWAA 2KOLA 2K5QA 1G8ZD 1SNMA 2JK8A 2EDGA 4HIMA 1Q7YC 1PH7A 1IBMQ 4LF5L 4YHHQ 3I4MG 4CKEA 3V96A 1SYCA 4G7HC 4NMZA 4Y7NB 3B6YA 4CDDC 1STEA 4IUNA 1CUKA 1PYBA 4OWWB 3QO2A 1JOOA 1EY7A 1OXTA 2QCPX 3H3VC 1CT1D 4G7OC 3M4OH 2C35B 4A3JB 2OQKA 3D8GA 2CWPA 1DYQA 3CD6A 4RGOS 1QUQB 2R92G 2K05A 2DJGC 1XTDA 4JI1Q 4JI2L 3BG3A 1MIUA 4IO9A 2CWAA 4A3EG 4X62L 4PV1C 3I90A 3H0GB 2F0JA 2JA8H 4PZ7A 4UAIA 2DJFC 4HJ5A 3K7AH 2UU9Q 2CW0D 5C4JH 3L2PA 1PREA 4M1UB 3CCEA 1XNQL 2F0GA 3KDFA 1S5CD 1PH1A 2Z4HA 1AH9A 1G2SA 2R6GA 3NBHA 2K33A 3SE0A 1EOTA 3J7AV 5M5YH 1LO5D 3GTJH 2B2UA 2E5LL 2G9HD 4R4TA 3ND8A 3C3LA 4X6AH 2R7FA 2AQ3B 3I4NH 1VQHA 5JJIA 3H0GG 3CCVA 1JWSD 3KBGA 3NTHA 2CQAA 2HD3A 4IUVA 2PI2E 4ALPA 4MN3A 3DWQA 4A3FH 2QF7A 3RUZA 3K6OA 4LF7L 1PRTD 1KD1C 4RHRA 2N55A 1Q1EA 5C44G 5IGGA 5I9PA 4WJ3M 4DNRB 2I46A 4RG1A 3G4OA 1UE6A 1SAPA 1I50H 2PZWA 3BYYB 2A73B 3DLLA 1FGUA 2A68D 1VQNA 4GN4B 4XQQA 4QIWB 3TZUA 3RZOB 2IX3A 1BBUA 3E9HA 4LF4Q 2E2HB 5KYLA 3BYTB 3A0JA 4IN3A 4ODGA 5IT9L 4C3JH 4QJFA 5K36H 1JMCA 3GO5A 4PZ6A 1A63A 5CYUA 1XJVA 2R7ZG 1EY6A 1WCMH 3SDZA 2BE5D 1W6JA 4IUUA 4O2DA 2P5ZX 4F87A 3NHHA 1T9HA 4A3MH 2E8GA 2XRSD 2IW3A 4A3KB 1Z52A 2EYOA 1HZ9A 2F0QA 4HR7B 2I5MX 3K0XA 4BBSB 3STBC 4UPAA 5C5MA 1EYGA 3U9OA 4AQYQ 1TWGB 4BY7B 2VXWA 3OW2A 4LF5Q 2XSCA 3HOXH 4DNTB 3NWTA 3JAMc 3KLSA 1STGA 4P2CB 1KDBA 3CP0A 3I56A 4X64L 1EY8A 3QOLA 2F4IA 5JEAG 1MSHA 2L15A 3R2TA 1ML0D 2K5HA 1B50A 2HQEA 4N8X1 3I72A 1Q86C 1YJNA 4R8IA 1EQQA 2B8FA 5LMUL 2Q2TA 4A3KG 1TY2A 5BN5A 4OWTB 1M4VA 3MHBA 1WOCA 1KNAA 2I5HA 3TZDA 1D2BA 2KHIA 3QB3A 2FHTA 4JI2Q 3IFDA 4IFDI 1C0AA 1VQDA 1XX8A 4X62Q 5DM63 4DK1A 3RNUA 3OWFA 2KJXA 4MIUA 3IAYA 4A93H 3HEJA 1F9QA 2WB1G 2YTYA 2RCNA 1PYWD 1TWCB 5CORA 1EL0A 4LUZA 1EUJA 4UP7A 1LACA 1J6QA 1WD0A 4ZCKA 3EJIA 1CKMA 1S3OA 1NY4A 2SEBD 5GAEC 3GD7A 3IRBA 3M4PA 1O78A 1H9KA 2Z4IA 3HOVB 1N32L 4K5XA 1PFSA 5JJZA 1KQSA 2E5LQ 4PZ8A 4R9WA 3HOWB 1F77A 1YITA 2EY2A 1CQFA 4NDXA 1F9RA 1MI2A 1SYFA 1BKBA 5HY6A 5M3FH 1JE5A 4NP5A 4GKJQ 4OO1H 1LM0A 1F2ZA 1QE6A 2UUAL 1I6HH 2KEEA 2KVMA 5ELCA 2Z6BA 1RL2A 1DOLA 3MZ5A 1PH3A 4A3DH 3MXNA 1M1KC 1GUSA 1PZJD 3T1YL 1SEBD 3KK7A 1C48A 4DAPA 4LF7Q 4JYAL 1QZHA 2I5LX 3T53B 1LUZA 4EVOA 1UAPA 3Q24A 2NVTH 2EYLA 4A3IG 4GZYC 1EWIA 2F0FA 3HOWG 3HKSA 3J7ZC 3GTQB 4OELB 4OL7A 5T1GA 2NZ1D 3NTKA 5LMNL 4DV6Q 4DR7Q 3KDFB 1Y1WG 2QEJC 4TQUS 3RZDH 1CI3M 3S2HB 3NBHB 1Y14B 2M2LA 1GUNA 3ER0A 1L2FA 3JAME 4DV0Q 3OMCA 3GV6A 4YIJA 3NWSA 3QG1A 1MJCA 2ICEC 1TXYA 2K7VA 1G51A 1GUGA 3TQYA 3VYSA 1A3UA 1Z7TA 1PYSB 4QB4A 5C4HA 1QNUA 2UXCL 4OIJA 1GUWA 1LTSD 3PF4A 4JI7L 4CKBA 2FMCA 1BDOA 4RHSA 3KF8A 1EWCA 2MP1A 2N8NA 3M3YB 2MNAA 1O7IA 1BCPF 1I3QH 2VUMB 1K8OA 2BDNA 1VQ4A 3V05A 4X64Q 1EIHA 2MHVA 3T56B 1CA5A 4A3LG 1Y1VB 4BY1H 5HGQA 1AE3A 5C3EH 3C2PA 4C2MH 1HNWL 1VQBA 5LMUQ 1A3VA 3KJOA 2XN9C 1E24A 2KCMA 2AWNA 3AB9A 4O42A 4KI0A 1HPCA 1I5FA 2XIWA 4A3CG 3H3VI 4BWGB 1K73C 3A5ZB 1PV4A 2Z0SA 4QGUA 2E2JH 5ELFA 5IE8A 2QA4A 1HCZA 4DR1L 4N9PA 4N9TA 4EQOA 3PO3G 1HTLD 2L0CA 5FOBB 3I55A 1Y1VG 5CV8A 2F0PA 1U4PA 3GTGH 2VQEL 5KIXA 2K01A 1STYA 2EPBA 2EJFC 1LV9A 2QDBA 1FNWA 3KUPA 3CCQA 4IFDJ 5JVH3 1N32Q 1CFMA 2O2LD 4MTNA 5C4XG 3AU7A 5CC4A 1D6EC 3EBEA 2F0EA 2SNMA 2M9VA 2D0PA 4DPGA 3AEVA 3SEBA 2KCNA 4B08A 1Y8PB 1TWHH 3C1FA 1KLGD 2UUAQ 2YU9H 3D4WA 1F9SA 4ZLTF 2AQ2B 2Z9HA 2A6EC 3CCRA 1EU3A 3HOYG 4QUFA 1Y1WH 5IYDG 4IPDA 4JYAQ 1UEAB 4KHVA 3A8JE 5IP9H 4DXFA 2LFNA 2ZJPA 2A69D 3VYUA 2HDMA 3URYA 3KLRA 3HOUB 4LWCA 3AYHB 1LTGD 4JG2A 1VQLA 3R2IA 2EVBA 3LX0A 4OXPA 4DR5L 4EGVA 5CV7A 2B63H 2PPBC 2XVSA 3VR3A 2JA7H 2F0HA 1TWFH 5BR8L 4Q0FA 4Y52H 3T16A 1I6VC 1LTID 2HCIA 3MAQA 5M5XB 2UXCQ 1E2ZA 4FYDA 2IWHA 2K5WA 4DR6L 4JI7Q 1LT3D 3TBIB 3MXNB 4C3HB 3HKZB 3F2BA 1X65A 2NVQB 1YNNC 3BJUA 4AIMA 1SFOB 4LJZC 5M9OA 1HRJA 1K9MC 1OXXK 2K6AA 1J5EL 1O7LA 3DXJC 4FXKC 1SE2A 1U0LA 5JEAJ 2IL8A 4HIKA 2ZTCA 1VCIA 1FGBD 2NN6H 2CKZB 1UUPA 1C7YA 1IBML 4YHHL 1N34Q 1DJRD 4X3TA 3T13A 5A35A 1HNWQ 1RTOA 5E4WC 3HRZC 3O13A 1QVGA 3HKZG 1CSQA 3FEWX 3J80i 3M7NA 4PNYA 1MGSA 2EQSA 3ND9A 1FR3A 1X3EA 4DKAC 3HOZH 3S16H 1K3BC 2WB1E 4DR3Q 2F3WA 3UI2A 1X6OA 1KAWA 3OIPA 3DEOA 1AZPA 3JAML 2DUDA 1HUNA 4DR1Q 4XTCS 5M3MG 3KF8B 4JI1L 4DAMA 3PUWA 1X3GA 1BBWA 1TIID 1IHZA 5CR3A 1Y8NB 1C4QA 2A6HC 3BU2A 1N33L 1A6XA 1SDFA 2EY1A 1CQVA 3D3RA 3TS2A 1L1OA 4ME5A 3CQZH 5A2QE 2UU9L 2VB3X 4GN5A 1IYUA 2JQOA 1V1PA 3LNNA 4RCOA 4DAYA 1GOZA 1NMGA 4JCVE 3S1RH 5BN3A 2K14A 3K7AB 4XYQA 4ABNA 4K5VA 3MXUA 5C4JB 5CV6A 4IPCA 5AJ3L 3TRZA 2RF4A 1XMOL 1EIGA 4JI4L 1BCPC 1K3RA 2M00A 2PO4A 4HTHA 5JPMC 1FJGQ 1G91A 3G4NA 5M5YB 1M90C 5D3DA 4ZKCB 3FRPB 3RLNA 1GUTA 1V1QA 2WKDA 3EFXD 1Z47A 2IHEA 1JE4A 5ELBA 4EX5A 1L1OC 1HQMC 4RGTA 1L0XB 1GHKA 3V2TA 1IZ6A 1SBBB 3TREA 1SNQA 3K58A 3BDCA 4BA2I 4DR5Q 2OF1A 5LL6S 4UP8A 4XT3B 3ZYYX 1WI5A 2O5IC 2XWJB 3L7ZC 4A3FB 3AMUA 3PGZA 5FK9C 4P74A 4IUTA 3JAMi 1HFNA 4LAAA 1SNCA 1JB3A 2LXKA 1JT8A 1LTLA 5EKIA 2HHHL 4L6TB 4ZKBB 4KKUA 3K5NA 1QB5D 4DR6Q 1I4PA 3PIP3 2I0QA 3VR2A 1YNJC 4ZK9B 4NXNQ 5C0XH 1WTVA 1Q81C 1BVSA 2DY8A 3VA7A 1PVOA 3MXPA 4IPGA 4FF3A 4LF8Q 4C3JB 3PO2H 3AFQA 1EEFD 1PA6A 1IL2A 1AW7A 4DR2L 1J5EQ 2JE6I 2F3VA 1PTOD 4C3IG 2L4NA 1WCMB 4KHPQ 1B8AA 2EYPA 3UDFA 4ILWA 2RQXA 1LT4D 5JJLA 4RFBA 4AQYL 4KHZA 1WTOA 1C8CA 4KD3A 5TSSA 1ZKOA 4YWMA 4H02A 2RVLA 3IL8A 5IOCA 3HOXB 1RCVD 1L0WA 3RLOA 1E2VA 2D0OA 4XYOA 1HA6A 2BH8A 1Y8OB 4CGYB 4NKLA 2EE1A 2LSSA 1KABA 1Q1BA 4J6HA 4JI0Q 3BDLA 2OCEA 1R4QB 4KJNA 1IBLQ 1X56A 1AFPA 1PMRA 2KECA 3K8AA 5IGCA 1K8MA 3SGIA 2OXPA 3EROA 3VR6A 4XXEA 1WTQA 1SLJA 1K0SA 3S17H 1N33Q 3S1NH 5HGTA 2K5VA 1JQYD 2JA5B 2GN5A 3NQTA 3OOCA 1VQFA 2IPKD 4A3JG 3CC2A 1VQKA 4A93B 4CDFC 1BNZA 3J80c 2CHBD 4B3MQ 2A5HA 5IYCH 4GNXA 2RDGA 1T5XD 1CSPA 5AJ3Q 1WTXA 3K0YA 1XMOQ 4IFDG 2HIXA 4JI4Q 3CC4A 1SXTA 1FNUA 2VW9A 4LUOA 1VQ7A 3NTIA 4KTAA 1XPUA 5F2DA 1TT2A 3DEPA 4GKJL 2VL6A 5EQ0A 2MUYA 2TMPA 3SVMA 3Q23A 3GTOH 3TN2A 5EPKA 4A3GH 2B2WA 5LMNW 2A19A 2J4XA 4CDCC 2JA5G 5M3FB 1BCPB 1ICFB 3PMFA 1ENAA 3M4QA 3S15H 4RCNA 4CJ0B 4F8MA 1I6HB 4YY3L 3L3OC 1NTGA 1RODA 2Q2HA 4R4OA 1BF4A 4IALA 4GNXC 2LS01 1I4QA 1L1OB 1FVIA 2RHQB 2B2UC 4QCLA 5C6AA 1JOKA 3BS1A 1A8VA 4S3SA 1V1PB 2XGTA 5D3IB 1D5ZC 4L63B 3W1GA 4DV6L 4DR7L 4K8JA 2NVTB 3ICEA 4DN4M 1QILA 4KMUC 1PFBA 1KHIA 3A5UA 1TQOA 2CFMA 2HHHQ 2F0IA 4KK7A 2B2WC 4DV0L 4TRDA 4PQXA 3W5OA 5LL6X 2Z1CA 1B44D 5A2QL 2C9OA 3E6ZX 2KCTA 3I4MH 2EJMA 1RF2D 3DUZA 4BBRB 3S2DH 4F88A 1HZBA 1V9PA 4DR2Q 2BDOA 4KY5A 1U5KA 3CW2C 2O4XA 1N8RC 2OWOA 1PTOH 1GM5A 2WACA 1CHQD 4DXGA 4JVZA 1YVCA 1DZ1A 3HKZE 4CJ2C 2R92H 1O7ZA 1SYGA 1UE1A 1HR0W 2PNRC 1SN8A 3GTMH 1V8QA 2E76C 3S24A 3D0FA 5D65A 1HQRD 4GS3A 3ULJA 1EZ6A 4TVAB 4BBRG 3I7FA 4A3EH 5E4XA 2PQEA 3M7GA 1WTRA 1CTMA 1GXDC 3UDIA 3A74A 3J80E 3ZJYC 1VQMA 4CJ1B 4HSPA 4RWSC 1J8IA 2VS1A 3R93A 3OTOL 4RKBA 3T4AC 4BY1B 4BBSG 3I2ZA 5C3EB 3KOJA 2NZHA 4C2MB 4BY7G 3K57A 2AHOB 1P8LA 4ZAIA 2BA1A 1KAAA 2JA6B 3G6EA 1EU4A 3TSSA 2PMZB 4FF1A 1X3PA 4HJ7A 4DV5Q 2PI2A 2RCFA 5IYBG 2F3IA 3H0GH 5G3LD 1VQ9A 1X54A 1YNXA 1LABA 2WAQB 1E2WA 1ENFA 1LTAD 4LF9Q 3CPWA 3RLFA 1NAPA 2F0SA 2OQ0A 3QJYA 1VQJA 4QMGA 3GTGB 5K5PA 1LYLA 2BCOA 1Q8IA 4NB3A 2LMCB 3S1QB 3RN5A 2WFWA 1AN8A 5C44H 2JA6G 3A8KE 5KEEA 4R1JA 5FLMG 1I94L 1HTPA 3SHLA 4LW1A 2B2VA 1J9OA 5EBDA 2YU9B 1KDCA 5CGKA 2OT2A 4YY3Q 2WAQG 1KTKA 4CKCA 4OO1I 5KYIA 4XQJA 3HOVG 2YV5A 2K1BA 1A3TA 4P71A 3R8BA 2R7ZH 5EJWA 4EQNA 4HAEA 3SK5A 4QL5A 5ISRA 3CCMA
chains in the Genus database with same CATH topology
1EFID 3R3OA 1EQVA 5COYA 1Q3LA 1LT6D 4A3BB 1OO9B 1E0BA 2XRQD 2B2VC 1ESFA 3DMUA 4ULLA 3NBIA 3SK8A 4H7BA 3M85A 2B63B 1BUVT 1K83B 4K14A 1RHPA 5JEAH 1D1KA 5HURA 2E2IB 5CV5A 2MPMA 3MC0B 1O7YA 1I4HA 4G57A 4WRDA 2IX1A 3NXWA 2EYHA 4EQPA 4X3SA 4HSVA 1SJHD 1IL8A 2LY7A 2IX0A 3J81E 2AQ1B 1PRTF 2F03A 3VA5A 4TSSA 3I73A 1R9TB 1S5DD 1HXYD 2BA0A 2SDFA 4I65A 3FKIB 1BR9A 1IKMA 3HZXA 2EYMA 3HOZB 3S16B 4OIKA 1XYIA 4KJOA 3HS0C 3A56A 1SYDA 2HCCA 3J7AF 4ZQ3A 2NBFA 1A2TA 5I6YA 1OXSC 3BVMA 3QIAA 2X6LA 1HFGA 1S4ZA 4ZUIA 2C5CA 1I4RA 3CQZB 3EA6A 1IW7C 1PFNA 3C46A 5IGEA 1LT5D 2F0UA 1X3QA 3J80L 3D31A 4UDUC 1AEXA 4KN4C 3Q22A 3OSOA 3KLSX 3Q6SA 1ZYRC 3EQLC 1EYAA 1PZKD 2PZUA 2A74C 1SE4A 4KD4A 2IT1A 3NQIA 1SMYC 3I8ZA 4ZRZA 1EYCA 5G3LF 4OGQC 1TS3A 5DM73 1EY9A 5IGBA 2R93B 4JK1C 3CRLC 4IQZA 1U4RA 4XIGS 1L0YB 4O1NA 3W3AA 2DN8A 1DOMA 1D1IA 2XNAC 1PLFA 1M8AA 1AP0A 2KEDA 3PO2B 3K5LA 2OEOA 1IKLA 2E2DC 1WTWA 1X32A 1TU2B 2QILA 3K5MA 1STAA 3D6CA 4C3HG 1AZQA 4IUPA 2NN6I 1SYBA 2NTSA 3I70A 1H9SA 2IJ0A 2V4DA 5FO9B 5C3WA 1Y69U 1R4PB 3M4OB 3MEHA 4XQNA 3WDNA 1STNA 2F0DA 4FNFA 1GJXA 2L11A 5D14A 3GV3A 1W6KA 4OHJA 2RSNA 3VYRA 2MJ8A 5C3XA 4PMWA 2CW0C 1DXMA 4DAVA 1JWMD 2KCCA 2N88A 4CHTB 3VR4A 2D5DA 1B9MA 1JR0D 2JA8B 2JEAI 3PIO3 2Z8LA 4JBWA 2WV6D 2RKSA 3I91A 5CMDA 1NSNS 3SK6A 2F0LA 3MWYW 4LK1C 2FINB 5E3FA 5IT9E 1BQQT 1F2MA 1EYDA 2Y0SB 4K8IA 1VMPA 3GTJB 1S5FD 4AYBB 4H0LC 1QOHA 3PUZA 4PMCA 3I4NB 1CM9A 1B4OA 1T5EA 4DF7A 5I6WA 3C0NA 1GHJA 1NR2A 2DNEA 3KBXA 2Q8RE 4V0BA 1PRTC 3DWPA 3GTOB 2A6ED 4L8JA 4K2KA 3D4RA 2Q8TA 3A54A 1PXUA 3J7YW 3Q0AA 2A68C 3OMGA 4C1NK 4Z9CB 3N6RA 4H44C 3QWNA 1A2UA 1U9RA 3LWUA 2RSOA 1I50B 2YYZA 1DOKA 3FMCA 5C5LA 3WOEA 2BE5C 4K6DA 3TP6A 1CZGA 1SJED 4MHEA 1H9MA 1RDPD 3PUVA 3I4MB 2F0MA 1V43A 4WJWA 3NUCA 3S9WA 5C0XI 3P1HA 4A3MB 2WINB 4K5WA 1QWYA 1II3A 4HMIA 1PTOB 2NTTA 3OWEB 1EY4A 1MSGA 1YNND 2F0TA 2PCFB 1ILPA 3A7LA 2PYKA 1ICWA 5EGTA 3GTMB 1LLRD 4C3JG 5K36G 2EY6A 2XWBB 1U4LA 2D9UA 4A3EB 1WVLA 4RGNA 1TKWB 2F0NA 5I2XA 2ZXOA 4IURA 5FLXE 1WTPA 1EZ8A 2KHSA 1STHA 4ZYSA 2KUMA 3X3NA 1STBA 1B3AA 5KRUA 1JCKB 3SK4A 2ZXPA 2A6HD 4DFAA 4HCSA 4HMJA 3VYTA 4Q5VA 1H9SB 3I3CA 4H13C 4G7ZC 1B1ZA 1ESRA 1CHPD 1TR5A 2B2TA 4PMBA 1LTRD 3WOFA 5C44B 5CBAE 1Q12A 2L9HA 4G4KA 4ID6A 1BCPD 1FYCA 1TY0A 4A3DB 2HDLA 5IGFA 3ONAB 1LTTD 2H1EA 2JEBI 2R61A 2KQ3A 1PRTB 3BDOA 1CK1A 3VR5A 2R7ZB 4U68A 2GA4B 4KY6A 3D6WA 1QCBD 3CU7A 5I4DA 2B2TC 1EQTA 1H9RA 5ELEA 3RZDB 1V1OA 4OO1G 1RJTA 2EZVA 3SXHA 5IIFA 3TMEA 1S5BD 3OPOA 3ITPA 3H94A 4LMQD 3OIQA 4TKOB 3BVGA 1DCZA 5KGUA 4QUCA 5KNCA 3OHXC 3MVVA 3PV0A 4X3UA 2WP8J 3GP7A 3GTKB 1YNJD 4FVMA 1Q90A 3NE5B 5FO8B 4R8NA 4QF4A 2D62A 3P20A 4F7XA 3MXGA 3GTPB 1SE3A 1JORA 1I3QB 3H09A 1O80A 2F0OA 1MBYA 1Z6HA 5J39A 3MFGA 2AUKA 2E74C 5C0XJ 3TP5A 1RD9D 3G7LA 5I9OA 1CA6A 4RKLA 5DEHA 2WB1B 2FJ2A 4X3KA 1RKNA 2NB0A 4IFDH 1FNVA 3HGBA 3MFYA 4ZUJA 2SOBA 2E2JB 1DM0B 1F2YA 2E75C 1HHVA 1JWUD 2LKVA 3DHQA 3H91A 4BA1I 5CV9A 5JOBA 1IYVA 2ZT9C 1PTOF 1H9JA 4DGZA 5JPNC 1MD2D 4HEDA 1TVXA 4RAUC 5T1IA 2H4OA 1TWHB 1OXVA 4A3IB 2JYOA 3T51B 1GUOA 2A69C 1Y1WB 4XT1B 4RA8A 2G9DA 2RBMA 3K5OA 2F0VA 3K59A 2MGSA 2PW7A 3S1MB 3IKJA 3TP7A 3C0MA 3LWEA 4J1MA 1I4XA 5FLXL 2K04A 5IODA 1LTBD 2O5JC 2JP1A 3FPPA 1PFMA 1D5XC 1F9PA 3U9SA 2JA7B 1TWFB 3C0OA 3NP8A 5EPLA 3S14B 1BOSA 2TSSA 2BOSA 3L9AX 1DD2A 1I4GA 1SNPA 4HN7A 4K6LA 4KN7C 1OXUA 3OW7A 1UNSA 4WFN3 4CBVA 2QKIC 5EPJA 5AFWA 5LHY1 1XXGA 2WKCA 4E6IA 1U4MA 2ZXRA 1ET6A 1SNOA 4I7ZC 3GQBA 5IGDA 5M5WB 4IZ8A 1KLUD 1KDAA 1DONA 2Q8IB 3PO3B 1SSOA 1VDZA 2WIIB 3E5SA 2L1BA 3FDTA 4DU9A 3DM1A 1HUMA 3C1EA 1SNDA 3A7AB 2KA7A 1BBXC 5JAVA 5C4XB 3M4YA 4BS9A 1JC7A 3BVZA 4FP5D 2X6GA 1EY0A 2ID0A 4FO2A 1RTNA 2NN6G 2SNSA 5FO7B 1WD1A 2I07B 4DA2A 3HOYB 1G2TA 3HP3A 2NVYB 2L12A 4B9WA 1QNKA 1F2LA 3S1RB 2NUCA 3NSWA 2EYFA 4DK0A 1B53A 5KNDA 2CVRA 2AWOA 1B2TA 1NCVA 3F2UA 4C56C 1ZEQX 5DAUA 1S5ED 1JOQA 2L5TA 3NK9A 4KKTA 4KKSA 2EXZA 5DNFA 3P7JA 5I2YA 2ICIA 1HA5A 1ET9A 3NPPA 2DNCA 5J22A 3ERQA 4M8AA 3TP8A 3A8IE 2L55A 3W2DA 2NVXB 1BO0A 5JVG3 3H6MA 4U673 4J8QA 1QG7A 5FKAC 1FD7D 1TS4A 2B8GA 5E1FA 4IUQA 1ENCA 1ONLA 3IFTA 1PDQA 1PTOC 2K32A 1EY5A 1CZWA 3CHBD 4FF2A 4C1NI 2PW5A 2VNUD 1EEID 2NWGA 2JXMB 2J7ZA 2EOTA 2B39A 3G6JB 3E0JA 5M3MB 3BZDB 5NUCA 1TS5A 2PZTA 4RH6A 5C0XG 1ILQA 5C4ZA 5EKLA 3PUYA 1EWHA 2J0TD 1XWEA 4FXDA 1KNEA 2RDHA 4NW2A 3X3MA 2K5DA 2K03A 2EY5A 1NR4A 1B9NA 1D5MC 4RGMA 2F0KA 3S17B 2B2YA 3S1NB 2EJGC 2D2CC 5ELDA 1JICA 3P75A 4FXGC 3I4LA 1QJOA 2X69A 5CV4A 3J81L 4KY7A 2DY7A 1G6ZA 2FMMA 4HCEA 3RMHA 2F0WA 1IW7D 2B2YC 3EVQA 3CRKC 3D4DA 2EYJA 5CBEE 3TDQA 4A3GB 1VF5C 3RD4A 2NYZD 2K28A 3S15B 3FVQA 4B9XA 2FFKB 2R3ZA 4V190 4KV6A 3MA2B 3GTLB 3PUXA 4FF4A 1PZID 3SR1A 1ZYRD 1TS2A 2VB2X 5KNBA 1TWAB 2F1MA 1NUCA 4XDXA 4C3IB 3MTSA 1XTCD 2JSOA 3FPUB 1SYEA 2AUJD 1SMYD 5EKKA 4WORA 4K2LA 1G291 3CKIB 3S2DB 2RA4A 3QOJA 2HUGA 3A55A 5EBCA 1BXTA 3HG9A 1VF7A 1VMCA 1A15A 2ENBA 5BN4A 1ZXTA 2RDFA 5J1ZA 3N52A 2R92B 3DWAA 2KOLA 2K5QA 1G8ZD 1SNMA 2EDGA 4CKEA 3V96A 1SYCA 4G7HC 4NMZA 4Y7NB 1STEA 4IUNA 3QO2A 1JOOA 1EY7A 1OXTA 2QCPX 3H3VC 1CT1D 4G7OC 4A3JB 3D8GA 1DYQA 4RGOS 2K05A 3BG3A 4PV1C 3I90A 3H0GB 2F0JA 4UAIA 2CW0D 1PREA 4M1UB 2F0GA 1S5CD 2Z4HA 1G2SA 2R6GA 3NBHA 2K33A 3SE0A 1EOTA 3J7AV 1LO5D 2B2UA 2G9HD 3ND8A 3C3LA 2AQ3B 1JWSD 3KBGA 3NTHA 2CQAA 4IUVA 4MN3A 3DWQA 2QF7A 3RUZA 3K6OA 1PRTD 4RHRA 2N55A 1Q1EA 5IGGA 5I9PA 4DNRB 2I46A 3G4OA 1SAPA 2PZWA 3BYYB 2A73B 2A68D 4XQQA 4QIWB 3TZUA 3RZOB 2IX3A 2E2HB 5KYLA 3BYTB 4IN3A 4ODGA 5IT9L 5K36H 3GO5A 5CYUA 1EY6A 3SDZA 2BE5D 1W6JA 4IUUA 4F87A 3NHHA 2XRSD 2IW3A 4A3KB 1Z52A 2EYOA 2F0QA 4HR7B 4BBSB 5C5MA 3U9OA 4BY7B 1TWGB 2VXWA 2XSCA 4DNTB 3NWTA 3KLSA 1STGA 4P2CB 1KDBA 1EY8A 3QOLA 2F4IA 5JEAG 1MSHA 3R2TA 1ML0D 1B50A 2HQEA 3I72A 4R8IA 2B8FA 1TY2A 5BN5A 1M4VA 3MHBA 1KNAA 3TZDA 1D2BA 3QB3A 2FHTA 3IFDA 4IFDI 1XX8A 5DM63 4DK1A 3OWFA 2KJXA 4MIUA 3IAYA 3HEJA 1F9QA 1PYWD 1TWCB 5CORA 1EL0A 1LACA 1WD0A 3EJIA 2SEBD 3GD7A 1O78A 1H9KA 2Z4IA 3HOVB 4K5XA 5JJZA 4R9WA 3HOWB 1F77A 2EY2A 1CQFA 4NDXA 1F9RA 1MI2A 1SYFA 4NP5A 4OO1H 1F2ZA 1QE6A 2KEEA 2KVMA 5ELCA 1DOLA 3MZ5A 3MXNA 1GUSA 1PZJD 1SEBD 3KK7A 1C48A 4DAPA 3T53B 4EVOA 1UAPA 3Q24A 2EYLA 4GZYC 2F0FA 3GTQB 4OL7A 5T1GA 2NZ1D 3NTKA 2QEJC 4TQUS 1CI3M 3S2HB 2M2LA 1GUNA 3JAME 3OMCA 3GV6A 4YIJA 3NWSA 3QG1A 2ICEC 2K7VA 1GUGA 3VYSA 1A3UA 1Z7TA 4QB4A 5C4HA 1QNUA 4OIJA 1GUWA 1LTSD 4CKBA 2FMCA 1BDOA 4RHSA 3KF8A 1EWCA 2MP1A 3M3YB 1BCPF 2VUMB 1K8OA 2BDNA 3V05A 1EIHA 2MHVA 3T56B 1CA5A 1Y1VB 3C2PA 1A3VA 2XN9C 2AWNA 3AB9A 4O42A 4KI0A 1HPCA 2XIWA 4BWGB 5ELFA 1HCZA 4N9PA 4N9TA 4EQOA 1HTLD 2L0CA 5FOBB 5CV8A 2F0PA 1U4PA 5KIXA 2K01A 1STYA 2EPBA 2EJFC 1LV9A 2QDBA 1FNWA 3KUPA 4IFDJ 5JVH3 1CFMA 2O2LD 3AU7A 5CC4A 1D6EC 2F0EA 2SNMA 2M9VA 3SEBA 2KCNA 4B08A 1Y8PB 3C1FA 1KLGD 3D4WA 1F9SA 4ZLTF 2AQ2B 2A6EC 1EU3A 4QUFA 1UEAB 4KHVA 3A8JE 4DXFA 2LFNA 2A69D 3VYUA 2HDMA 3URYA 3KLRA 3HOUB 1LTGD 3R2IA 2EVBA 3LX0A 4EGVA 5CV7A 2PPBC 2XVSA 3VR3A 2F0HA 4Q0FA 3T16A 1I6VC 1LTID 2HCIA 3MAQA 5M5XB 1E2ZA 4FYDA 2IWHA 2K5WA 1LT3D 3TBIB 4C3HB 3HKZB 2NVQB 1YNNC 1SFOB 4LJZC 5M9OA 1HRJA 1OXXK 2K6AA 1O7LA 3DXJC 4FXKC 1SE2A 5JEAJ 2IL8A 1VCIA 1FGBD 2NN6H 1UUPA 1DJRD 4X3TA 3T13A 5A35A 1RTOA 5E4WC 3HRZC 3O13A 3FEWX 3M7NA 4PNYA 1MGSA 3ND9A 1FR3A 2F3WA 3UI2A 3OIPA 3DEOA 1AZPA 3JAML 1HUNA 4XTCS 3PUWA 1TIID 1IHZA 5CR3A 1Y8NB 1C4QA 2A6HC 1A6XA 1SDFA 2EY1A 1CQVA 3D3RA 4ME5A 5A2QE 2VB3X 1IYUA 1V1PA 3LNNA 4RCOA 4DAYA 1GOZA 5BN3A 3K7AB 4XYQA 4ABNA 4K5VA 3MXUA 5C4JB 5CV6A 1EIGA 1BCPC 4HTHA 2M00A 2PO4A 5JPMC 1G91A 3G4NA 5M5YB 5D3DA 4ZKCB 3FRPB 1GUTA 2WKDA 3EFXD 1Z47A 1JE4A 5ELBA 1HQMC 4RGTA 1L0XB 1GHKA 3V2TA 1SBBB 1SNQA 3K58A 3BDCA 4BA2I 2OF1A 5LL6S 4XT3B 3ZYYX 2O5IC 2XWJB 3L7ZC 4A3FB 3AMUA 5FK9C 4IUTA 1HFNA 4LAAA 1SNCA 1JB3A 5EKIA 4L6TB 4ZKBB 4KKUA 3K5NA 1QB5D 1I4PA 3PIP3 3VR2A 1YNJC 4ZK9B 5C0XH 1WTVA 2DY8A 3VA7A 3MXPA 4FF3A 4C3JB 1EEFD 1AW7A 2JE6I 2F3VA 1PTOD 4C3IG 2L4NA 1WCMB 2EYPA 4ILWA 2RQXA 1LT4D 4RFBA 4KHZA 1WTOA 1C8CA 4KD3A 5TSSA 1ZKOA 2RVLA 3IL8A 5IOCA 3HOXB 1RCVD 1E2VA 4XYOA 1HA6A 1Y8OB 4CGYB 4NKLA 2EE1A 1KABA 1Q1BA 4J6HA 3BDLA 1R4QB 4KJNA 1AFPA 1PMRA 2KECA 5IGCA 1K8MA 2OXPA 3EROA 3VR6A 4XXEA 1WTQA 5HGTA 1JQYD 2JA5B 3NQTA 3OOCA 2IPKD 4A93B 1BNZA 2CHBD 2A5HA 2RDGA 1T5XD 4IFDG 1WTXA 3K0YA 1SXTA 1FNUA 3NTIA 4KTAA 5F2DA 1TT2A 3DEPA 5EQ0A 2MUYA 2TMPA 3SVMA 3Q23A 3TN2A 5EPKA 2B2WA 2J4XA 5M3FB 1BCPB 3PMFA 1ENAA 4RCNA 4CJ0B 4F8MA 1I6HB 3L3OC 1BF4A 1RODA 4IALA 2LS01 1I4QA 2B2UC 4QCLA 5C6AA 1JOKA 3BS1A 4S3SA 1V1PB 5D3IB 1D5ZC 4L63B 4K8JA 2NVTB 4DN4M 1QILA 4KMUC 1PFBA 1TQOA 2F0IA 4KK7A 2B2WC 4TRDA 4PQXA 5LL6X 2Z1CA 1B44D 5A2QL 2C9OA 3E6ZX 2EJMA 1RF2D 3DUZA 4BBRB 4F88A 2BDOA 4KY5A 2O4XA 1PTOH 2WACA 1CHQD 4DXGA 1DZ1A 4CJ2C 1O7ZA 1SYGA 2PNRC 1V8QA 2E76C 5D65A 1HQRD 1EZ6A 5E4XA 2PQEA 3M7GA 1WTRA 1CTMA 1GXDC 3J80E 4CJ1B 4HSPA 4RWSC 1J8IA 3R93A 4RKBA 3T4AC 4BY1B 5C3EB 4C2MB 3K57A 4ZAIA 2BA1A 1KAAA 2JA6B 1EU4A 3TSSA 2PMZB 4FF1A 1X3PA 5G3LD 1LABA 2WAQB 1E2WA 1ENFA 1LTAD 3RLFA 1NAPA 2F0SA 3QJYA 4QMGA 3GTGB 5K5PA 2BCOA 1Q8IA 2LMCB 3S1QB 1AN8A 3A8KE 5KEEA 1HTPA 3SHLA 2B2VA 1J9OA 5EBDA 2YU9B 1KDCA 5CGKA 2OT2A 1KTKA 4CKCA 4OO1I 5KYIA 4XQJA 2K1BA 1A3TA 3R8BA 5EJWA 4EQNA 4HAEA 3SK5A 5ISRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFI D;  1S5C D;  1CHQ D;  1M4V A;  4RHS A;  3R2I A;  1EWC A;  4DXG A;  5I4D A;  1PZI D;  1LO5 D;  1LT6 D;  1TS2 A;  3BVZ A;  1BCP F;  1PTO B;  2NTT A;  2G9H D;  3OWE B;  5ELE A;  1BCP C;  1V1O A;  2XRQ D;  3G4N A;  2AQ3 B;  1ESF A;  1XTC D;  3V05 A;  1LT5 D;  4OHJ A;  1EEI D;  1S5B D;  5D3D A;  1JWM D;  1LTI D;  1HQR D;  3EFX D;  1JWS D;  1JQY D;  3BZD B;  1TS5 A;  5ELB A;  3BVG A;  1PYW D;  1LLR D;  4UDU C;  1JR0 D;  4RGT A;  1L0X B;  4RH6 A;  2IPK D;  2Z8L A;  1LT3 D;  1TY2 A;  1SBB B;  2WV6 D;  3MC0 B;  2CHB D;  3KLS X;  3DWQ A;  1I4H A;  3GP7 A;  4RGN A;  2SEB D;  3C0M A;  2RDG A;  1PRT D;  1T5X D;  2RDH A;  1BXT A;  1PZK D;  1I4X A;  2XN9 C;  4RHR A;  1LTB D;  1SXT A;  1FNU A;  1SE4 A;  1F77 A;  5FK9 C;  1EU4 A;  3G4O A;  1PTO H;  1SE2 A;  3BYY B;  4BWG B;  3TSS A;  1SE3 A;  1SJH D;  3DWA A;  1S5F D;  1D5M C;  4RGM A;  1D5X C;  5ELF A;  1FGB D;  1G8Z D;  1TS3 A;  4ZYS A;  3C0O A;  3MFG A;  1UUP A;  1HTL D;  5ELC A;  4L6T B;  2J4X A;  3BYT B;  4C56 C;  3C0N A;  2AQ1 B;  1I4P A;  1DJR D;  1PRT F;  1RD9 D;  1PZJ D;  1BCP B;  2TSS A;  1PRT C;  3DWP A;  1S5E D;  1SEB D;  1I4G A;  5ELD A;  4TSS A;  1ENF A;  1JCK B;  1LTA D;  3O13 A;  4K6L A;  1STE A;  1FNW A;  1L0Y B;  1UNS A;  1S5D D;  2ICI A;  4O1N A;  1I4Q A;  1HA5 A;  1ET9 A;  1CT1 D;  1HXY D;  2O2L D;  1EEF D;  1AW7 A;  1DYQ A;  1D6E C;  2XRS D;  1PTO D;  1AN8 A;  4Z9C B;  1V1P B;  1FNV A;  2XNA C;  4RGO S;  1XXG A;  1Z52 A;  5D3I B;  1D5Z C;  4L63 B;  1B1Z A;  3W2D A;  3SEB A;  1CHP D;  1LT4 D;  1KLG D;  2QEJ C;  4RFB A;  1ET6 A;  2AQ2 B;  1LTR D;  1QIL A;  5TSS A;  5FKA C;  1EU3 A;  1FD7 D;  1TS4 A;  2QIL A;  1B44 D;  1JWU D;  1BCP D;  1TY0 A;  1KTK A;  1RF2 D;  1SJE D;  1CQV A;  1RCV D;  1KLU D;  1PTO F;  3BVM A;  2NTS A;  4DXF A;  3R2T A;  1PTO C;  1RDP D;  1LTT D;  3R8B A;  3URY A;  1LTS D;  3CHB D;  1PRE A;  2IJ0 A;  1V1P A;  2R61 A;  1MD2 D;  1PRT B;  4RCO A;  1GOZ A;  1I4R A;  1LTG D;  3EA6 A;  1CK1 A; 
#chains in the Genus database with same CATH topology
 1EFI D;  5FJ8 G;  3R3O A;  1EQV A;  4GNX B;  5COY A;  1VQC A;  4YCU A;  1Q3L A;  1LT6 D;  1NMF A;  1HNZ Q;  4A3B B;  3J7A 5;  1OO9 B;  1E0B A;  2XRQ D;  2B2V C;  1Q82 C;  4LNQ A;  1ESF A;  4POG A;  3RZO H;  3DMU A;  3VDY A;  4ULL A;  3NBI A;  3SK8 A;  4H7B A;  3M85 A;  1PH5 A;  2B63 B;  1BUV T;  1K83 B;  4K14 A;  2A8V A;  1RHP A;  3GTK H;  5JEA H;  1D1K A;  5HUR A;  2E2I B;  5CV5 A;  2ZM6 Q;  2MPM A;  3MC0 B;  1O7Y A;  4OON A;  1I4H A;  4G57 A;  2F4V Q;  4A3K H;  2QDL A;  3GTP H;  3AFP A;  4WRD A;  2IX1 A;  4DUZ Q;  3NXW A;  2EYH A;  4EQP A;  4X3S A;  4A3B G;  4HSV A;  1SJH D;  1N9W A;  1X55 A;  1IL8 A;  1UEB A;  4LF6 L;  4NPS A;  2LY7 A;  2IX0 A;  1N34 L;  3J81 E;  2AQ1 B;  1PRT F;  3STB D;  2F03 A;  3VA5 A;  1B7Y B;  4UHV A;  5ELO A;  4OX9 L;  3EIV A;  4TSS A;  3I73 A;  2ALY B;  3OTO Q;  1R9T B;  1YI2 A;  1X3F A;  1S5D D;  1PH2 A;  1HXY D;  2BA0 A;  2SDF A;  4I65 A;  1AE2 A;  3FKI B;  3KF6 A;  1BR9 A;  4A76 A;  4DR3 L;  1MHW C;  2VUM G;  1IKM A;  4IOC A;  4OWX B;  3HZX A;  1VQG A;  2EYM A;  3HOZ B;  3S16 B;  4OIK A;  1XYI A;  1Q46 A;  2VY3 A;  4KJO A;  3HS0 C;  3A56 A;  3G71 A;  2CH4 W;  1SE8 A;  1S72 A;  1SYD A;  1TWC H;  2HCC A;  3J7A F;  4ZQ3 A;  3ULL A;  2NBF A;  1A2T A;  1YHQ A;  5I6Y A;  1OXS C;  3BVM A;  3QIA A;  2X6L A;  1HFG A;  3FKI G;  1S4Z A;  1SRO A;  4ZUI A;  2C5C A;  1I4R A;  3CQZ B;  3EA6 A;  4A3I H;  1IW7 C;  4ME3 A;  3HOW H;  1PFN A;  3DM3 A;  1I94 Q;  3C46 A;  4YCV A;  1FJG L;  5IGE A;  1LT5 D;  1K0R A;  2F0U A;  1X3Q A;  3J80 L;  5IP7 G;  3S1M H;  2UXB L;  3D31 A;  4UDU C;  2V1C C;  3PF5 A;  1AEX A;  4KN4 C;  1JJG A;  3Q22 A;  1B70 B;  3OSO A;  4KLK A;  3UDG A;  3KLS X;  3F2C A;  3Q6S A;  2CQO A;  1HZC A;  3Q8D A;  1ZYR C;  4GKK L;  3EQL C;  4HIO A;  1EYA A;  2UXD L;  1PZK D;  2PZU A;  2CH4 A;  4MNO A;  2A74 C;  2VQF Q;  1SE4 A;  4KD4 A;  2IT1 A;  5GAH C;  1NE3 A;  3NQI A;  5J3B A;  4P75 A;  1SMY C;  3I8Z A;  3S14 H;  3ERS X;  4ZRZ A;  2OTJ A;  3W1B A;  1EYC A;  5G3L F;  4OGQ C;  1TS3 A;  1A0I A;  5DM7 3;  2N78 A;  1EY9 A;  5IGB A;  4QIW E;  2R93 B;  2B3G A;  4JK1 C;  1RIP A;  3CRL C;  4A3L H;  3HOU G;  4NXN L;  4DUY L;  2Z6K A;  4IQZ A;  1U4R A;  1VQO A;  4XIG S;  1L0Y B;  5EAY A;  1X9N A;  4O1N A;  4LF8 L;  3RN2 A;  3T1H L;  4K0K Q;  3W3A A;  2DN8 A;  2PNH A;  1DOM A;  1D1I A;  2XNA C;  4GLX A;  4KHP L;  1PLF A;  1M8A A;  1YZ6 A;  5M5W H;  3M3Y H;  1AP0 A;  2KED A;  3PO2 B;  4A3C H;  3K5L A;  4LF6 Q;  2OEO A;  3J81 j;  1IKL A;  2E2D C;  4HJ9 A;  1WTW A;  4DV2 Q;  1X32 A;  4AH6 A;  1VQP A;  4OX9 Q;  1TU2 B;  3PO3 H;  2QIL A;  2R93 G;  4DK6 C;  5GAG C;  3K5M A;  1STA A;  3D6C A;  4C3H G;  1Y1V H;  5GQO A;  2Z6K C;  1AZQ A;  1K28 A;  4IUP A;  2NN6 I;  1SYB A;  2NTS A;  3HFZ B;  4JC0 A;  2ASB A;  3AQQ A;  3I70 A;  1CKN A;  1H9S A;  2IJ0 A;  2V4D A;  5FO9 B;  5C4X H;  5C3W A;  4JI0 L;  2LXJ A;  3TEH B;  4DNI A;  1Y69 U;  1R4P B;  3M4O B;  1GVP A;  1IBL L;  3MEH A;  4XQN A;  4JOI A;  3WDN A;  1STN A;  2F0D A;  4FNF A;  1GJX A;  2L11 A;  1XNR L;  5D14 A;  4OEM B;  3GV3 A;  1W6K A;  4OHJ A;  2RSN A;  3VYR A;  2MJ8 A;  5C3X A;  3HOY H;  4PMW A;  2CW0 C;  1DXM A;  5IYD H;  4DAV A;  1JWM D;  2KCC A;  2N88 A;  4CHT B;  3VR4 A;  2D5D A;  1B9M A;  1JR0 D;  2EXD A;  2NVY H;  2JA8 B;  2KHJ A;  5E7N A;  3PIO 3;  4B3S L;  2JEA I;  2Z8L A;  4JBW A;  5ELN A;  2WV6 D;  4B3M L;  2RKS A;  3I91 A;  5CMD A;  1NSN S;  3SK6 A;  2F0L A;  4JOI C;  2WAQ E;  3MWY W;  4LK1 C;  4LFB Q;  4JI6 Q;  2FIN B;  5E3F A;  5IT9 E;  1E1O A;  1BQQ T;  1F2M A;  1QVC A;  3KF6 B;  1EYD A;  2Y0S B;  4K8I A;  1VMP A;  5FLX c;  3GTJ B;  1S5F D;  4AYB B;  4H0L C;  1QOH A;  2UXB Q;  3PUZ A;  4PMC A;  3I4N B;  1CM9 A;  1B4O A;  1WYD A;  4MZ9 A;  4POF A;  1T5E A;  4DF7 A;  4IOA A;  5I6W A;  3C0N A;  1GHJ A;  1NR2 A;  2DNE A;  3KBX A;  2Q8R E;  4V0B A;  1PRT C;  2JA8 G;  3DWP A;  3GTO B;  2A6E D;  1PH8 A;  4L8J A;  4GKK Q;  4K2K A;  2UXD Q;  3D4R A;  2Q8T A;  3G48 A;  3A54 A;  1XMQ L;  1PXU A;  2NVX H;  3J7Y W;  3Q0A A;  2A68 C;  3OMG A;  4A4I A;  1E3P A;  4LFA Q;  4C1N K;  4B3R L;  4Z9C B;  3UDX A;  2UUC L;  2UUB L;  3N6R A;  4H44 C;  2VZA A;  3QWN A;  2Y0S G;  1A2U A;  1U9R A;  3LWU A;  1HH2 P;  3U58 A;  2RSO A;  4AYB G;  1KRS A;  1I50 B;  2YYZ A;  3I4N G;  3CAM A;  1DOK A;  3JC6 6;  3FMC A;  5C5L A;  2ATW A;  4DUY Q;  3WOE A;  3UE1 A;  1PH4 A;  2BE5 C;  2K75 A;  4K6D A;  3TP6 A;  1CZG A;  3CMA A;  1SJE D;  4MHE A;  1H9M A;  3T1H Q;  1RDP D;  2GVB A;  2JA9 A;  3PUV A;  4P72 A;  4C3H H;  4A3F G;  3I4M B;  2F0M A;  4L5S A;  3U4Z A;  1V43 A;  3PIP A;  4WJW A;  3NUC A;  1XPO A;  2NVQ H;  4MTK A;  3S9W A;  5C0X I;  3P1H A;  4A3M B;  2WIN B;  1KL9 A;  4K5W A;  1QWY A;  1II3 A;  3NEM A;  1IYJ B;  1PTO B;  2NTT A;  3OWE B;  4HMI A;  5M3M H;  1EY4 A;  1MSG A;  1YNN D;  3J81 i;  2F0T A;  2PCF B;  4DV4 Q;  3RR5 A;  1ILP A;  3A7L A;  2ZJR A;  2PYK A;  2K50 A;  1ICW A;  5EGT A;  2DGY A;  3GTM B;  1LLR D;  4C3J G;  5K36 G;  2EY6 A;  1KIX A;  1GD7 A;  2XWB B;  3I4O A;  1U4L A;  2K5N A;  1YEZ A;  1WCM G;  2D9U A;  4A3E B;  4R4Q A;  1WVL A;  4RGN A;  4A3M G;  1TKW B;  2F0N A;  5I2X A;  1K8A C;  2F52 A;  4WJ4 A;  1XNR Q;  1WFQ A;  2QGQ A;  2ZXO A;  4IUR A;  5FLX E;  1WTP A;  5GAD C;  3CC7 A;  1N36 Q;  4DV5 L;  1EZ8 A;  1S40 A;  2KHS A;  1IBK L;  1STH A;  3HOX G;  4ZYS A;  4X65 L;  2KUM A;  3X3N A;  2MQH A;  1YBY A;  4B3S Q;  3NEN A;  1STB A;  2FXQ A;  4JI8 L;  1B3A A;  1WTH A;  4LF9 L;  3U50 C;  5KRU A;  1JCK B;  1NJI C;  3SK4 A;  4UP9 A;  2ZXP A;  2A6H D;  2H5X A;  4DFA A;  4HCS A;  2ZTE A;  3F2D A;  4HMJ A;  4UY8 C;  3VYT A;  4Q5V A;  1CKN B;  3M9B A;  1H9S B;  3I3C A;  3CPF A;  3CXC A;  1HJP A;  2R7D A;  4H13 C;  4G7Z C;  1B1Z A;  5IWA Q;  1ESR A;  1CHP D;  1VQ5 A;  1EIY B;  4BXX G;  1TR5 A;  2B2T A;  1DGS A;  4PMB A;  1LTR D;  3WOF A;  5C44 B;  5CBA E;  1Q12 A;  2L9H A;  4JI3 L;  4G4K A;  4ID6 A;  4CDE C;  4A93 G;  2PQA A;  3H15 A;  1H95 A;  1BCP D;  1FYC A;  1TY0 A;  4A3D B;  2HDL A;  5IGF A;  3GTL H;  1Q8K A;  3ONA B;  1XMQ Q;  1W2B A;  2G5D A;  1LTT D;  2B29 A;  1D7Q A;  2H1E A;  2JEB I;  4B3R Q;  2R61 A;  2KQ3 A;  2UUB Q;  2UUC Q;  1PRT B;  3BDO A;  5DLQ E;  4DAY B;  4JV5 L;  1TWA H;  1CK1 A;  1UE5 A;  3VR5 A;  2R7Z B;  4DV1 L;  4C3I H;  4U68 A;  2GA4 B;  4GN3 B;  4KY6 A;  4EQ5 A;  3D6W A;  1QCB D;  3CU7 A;  5I4D A;  2B2T C;  1EQT A;  4J15 A;  1HNZ L;  4GLA C;  1H9R A;  5ELE A;  5M3F G;  3RZD B;  1V1O A;  4OO1 G;  1RJT A;  2EZV A;  3SXH A;  5IIF A;  3TME A;  1PHJ A;  1S5B D;  3OPO A;  3ITP A;  3H94 A;  4LMQ D;  1CKO A;  4A3D G;  3OIQ A;  4TKO B;  3BVG A;  1DCZ A;  1KRT A;  5KGU A;  4QUC A;  5KNC A;  2ZM6 L;  1W3S A;  2A1A A;  3OHX C;  4LUV A;  3MVV A;  3PV0 A;  4X3U A;  1G6P A;  2WP8 J;  3GP7 A;  3GTK B;  2F4V L;  1YNJ D;  2ZJQ A;  4FVM A;  1Q90 A;  3NE5 B;  5FO8 B;  4R8N A;  1E7Z A;  4DR4 L;  4QF4 A;  3NEL A;  3TS0 A;  1E1T A;  2D62 A;  4DUZ L;  3P20 A;  1KC8 C;  4F7X A;  1UWV A;  3MXG A;  4PG3 A;  3GTP B;  1SE3 A;  1QZG A;  1JOR A;  1I3Q B;  3H09 A;  4LFC L;  1O80 A;  4HID A;  2F0O A;  1MBY A;  4Y7N H;  4JI5 L;  1Z6H A;  5J39 A;  3MFG A;  2AUK A;  4DV7 L;  2BH2 A;  2E74 C;  5C0X J;  2MO1 A;  3TP5 A;  1RD9 D;  3G7L A;  4IPH A;  1XPR A;  5I9O A;  1CA6 A;  4A3J H;  4RKL A;  5DEH A;  2JJQ A;  2WB1 B;  2OTL A;  1NNX A;  2HT1 A;  2FJ2 A;  2RHS B;  4X3K A;  2N49 A;  1RKN A;  2NB0 A;  4IFD H;  4HJ8 A;  1FNV A;  3HGB A;  3MFY A;  4ZUJ A;  1IBK Q;  2SOB A;  4X65 Q;  4HJA A;  3J81 c;  1YJW A;  2E2J B;  1DM0 B;  1F2Y A;  4JI8 Q;  2KEN A;  4BXX H;  2E75 C;  1SRU A;  1HHV A;  2JA5 H;  1JWU D;  2LKV A;  3DHQ A;  3H91 A;  4BA1 I;  5CV9 A;  5JOB A;  4BY1 G;  1IYV A;  2ZT9 C;  1PTO F;  4YWK A;  1H9J A;  5C3E G;  2QEX A;  1QVF A;  4DGZ A;  1Z9F A;  4GLV B;  4P73 A;  1ASY A;  5JPN C;  1MD2 D;  2HIV A;  4HED A;  1XNQ Q;  1TVX A;  4RAU C;  4IJL A;  3BZC A;  3L0O A;  5T1I A;  1EQR A;  2H4O A;  4O0A A;  4JI3 Q;  5JJK A;  1TWH B;  1OXV A;  4A3I B;  2JYO A;  3T51 B;  1GUO A;  1JB7 A;  4N8F A;  2A69 C;  3K7U C;  1JJC B;  1Y1W B;  4XT1 B;  4RA8 A;  2Y0S E;  2G9D A;  2RBM A;  4AYB E;  3K5O A;  2F0V A;  3K59 A;  2MGS A;  2PW7 A;  3S1M B;  3IKJ A;  4JV5 Q;  2N3S A;  3TP7 A;  4DV1 Q;  3LWE A;  3C0M A;  2MFI A;  4J1M A;  1I4X A;  5FLX L;  2K04 A;  5IOD A;  2VQF L;  1LTB D;  4L5T A;  2O5J C;  3G4S A;  3E9I A;  2JP1 A;  2E2H H;  3FPP A;  1PFM A;  1D5X C;  1F9P A;  3U9S A;  5IY0 A;  2JA7 B;  1TWF B;  1VQ8 A;  3C0O A;  3NP8 A;  5EPL A;  3S14 B;  1A62 A;  3KLW A;  1BOS A;  4BBR H;  2TSS A;  2BOS A;  3L9A X;  1DD2 A;  1I4G A;  3CCL A;  1SNP A;  2PQA B;  5IP9 G;  4HN7 A;  4K6L A;  4KN7 C;  1OXU A;  3OW7 A;  4DR4 Q;  1UNS A;  4WFN 3;  4CBV A;  2QKI C;  5EPJ A;  4K0K L;  4JPB W;  1C9O A;  1GKH A;  5AFW A;  4BBS H;  5LHY 1;  4BY7 H;  1TWG H;  3MEF A;  2K52 A;  1XXG A;  2WKC A;  5H1S E;  4LFC Q;  1NBW A;  4E6I A;  1U4M A;  1VQI A;  3U4V A;  4JI5 Q;  2ZXR A;  2B63 G;  2IY5 B;  4DV7 Q;  1ET6 A;  4DV2 L;  1WJJ A;  2JA7 G;  1SNO A;  4I7Z C;  3GQB A;  5IGD A;  5M5W B;  3UE0 A;  4B3T L;  5IYB H;  4IZ8 A;  1KLU D;  1KDA A;  1DON A;  2Q8I B;  3PO3 B;  1SSO A;  2QW7 A;  1VDZ A;  2WII B;  3E5S A;  2K4K A;  2L1B A;  3KJP A;  2AKW B;  3FDT A;  4DU9 A;  4GOP A;  3DM1 A;  3H3V H;  1HUM A;  3C1E A;  1SND A;  3A7A B;  2KA7 A;  1YHB A;  1BBX C;  1FL0 A;  2JA6 H;  4RMF A;  3CF5 A;  5JAV A;  5C4X B;  3M4Y A;  4YWL A;  1JC7 A;  2NZO A;  4BS9 A;  5FLM H;  3BVZ A;  1HR0 L;  4FP5 D;  2X6G A;  1EY0 A;  2ID0 A;  4FO2 A;  1RTN A;  2NN6 G;  2SNS A;  1SR3 A;  5FO7 B;  1WD1 A;  1YJ9 A;  2I07 B;  4DA2 A;  3HOY B;  1VQ6 A;  3HOV H;  1G2T A;  3HP3 A;  1VQA A;  4GOP C;  1D8L A;  1HZA A;  2NVY B;  3HOZ G;  3S1Q H;  1K8G A;  2L12 A;  4B9W A;  4YCW A;  4LFB L;  1QNK A;  4JI6 L;  1F2L A;  5FJ8 H;  3CCS A;  3S1R B;  2NUC A;  4JW0 A;  3NSW A;  4X66 L;  2EYF A;  2HQL A;  1B53 A;  4DK0 A;  4L5R C;  3QR8 A;  5KND A;  2CVR A;  2AWO A;  1B2T A;  1NCV A;  4DV3 L;  3F2U A;  4C56 C;  3T1Y Q;  1ZEQ X;  5DAU A;  1S5E D;  1JOQ A;  2L5T A;  3NK9 A;  4JBJ A;  4KKT A;  4KKS A;  2EXZ A;  5DNF A;  3GTQ H;  3P7J A;  5I2Y A;  2ICI A;  1HA5 A;  1ET9 A;  3NPP A;  5IT9 c;  2DNC A;  2ES2 A;  4APV A;  5J22 A;  2YTV A;  3ERQ A;  4M8A A;  4LFA L;  3S2H H;  3TP8 A;  3A8I E;  1YIJ A;  2L55 A;  3W2D A;  2NVX B;  1EOV A;  5LMN Q;  4A3B H;  1BO0 A;  5JVG 3;  3H6M A;  4U67 3;  4J8Q A;  1QG7 A;  5FKA C;  1FD7 D;  1TS4 A;  1K83 H;  2B8G A;  3E0E A;  5E1F A;  4IUQ A;  1ENC A;  2IHF A;  3CCJ A;  3EN2 A;  1ONL A;  1VS0 A;  2E2I H;  1YHA A;  3IFT A;  1PDQ A;  1PTO C;  2K32 A;  4NXM L;  1EY5 A;  1HNX L;  1CZW A;  3CHB D;  4R4I A;  4FF2 A;  4C1N I;  2PW5 A;  2VNU D;  1EEI D;  1QUQ A;  2NWG A;  2JXM B;  3WWV A;  2VUM H;  3PQI A;  3PCO B;  2J7Z A;  4QQB X;  4B3T Q;  2EOT A;  4QY7 A;  2B39 A;  4DV4 L;  1GO3 E;  3E0J A;  3G6J B;  3K81 C;  4DK3 C;  2JN4 A;  5M3M B;  3BZD B;  5NUC A;  1TS5 A;  1ASZ A;  3CCU A;  2PZT A;  4RH6 A;  1R9T H;  5C0X G;  1ILQ A;  3E3X A;  3OYY A;  5C4Z A;  5EKL A;  3PUY A;  1VQE A;  3FKI H;  1EWH A;  2J0T D;  3ULP A;  3PO2 G;  1XWE A;  2EIF A;  4FXD A;  1KNE A;  2RDH A;  4NW2 A;  1HR0 Q;  1KXL A;  4JBM A;  3X3M A;  2K5D A;  3FP9 A;  2K03 A;  3F8T A;  1JJ2 A;  2EY5 A;  1N36 L;  1NR4 A;  1B9N A;  1D5M C;  4RGM A;  2MO0 A;  2F0K A;  2PMZ E;  2GVA A;  3S17 B;  2B2Y A;  3S1N B;  5IP7 H;  4IJH A;  2EJG C;  2AMC B;  2VQE Q;  2D2C C;  2YTX A;  5ELD A;  1JIC A;  3PSI A;  4JBK A;  3P75 A;  4FXG C;  3I4L A;  1QJO A;  4FDB A;  2ZTD A;  4X66 Q;  3KYH C;  2X69 A;  5CV4 A;  3J81 L;  4KY7 A;  3PIO A;  2DY7 A;  4GOP B;  3CME A;  5IWA L;  2FMM A;  1G6Z A;  4HCE A;  1EIF A;  3RMH A;  2F0W A;  4R4C A;  4DV3 Q;  1IW7 D;  1EFW A;  2B2Y C;  3EVQ A;  3CRK C;  3D4D A;  1OTC A;  2EYJ A;  5CBE E;  3TDQ A;  2CCZ A;  4A3G B;  3GDE A;  1VF5 C;  3RD4 A;  3HOU H;  2NYZ D;  4L5Q A;  2K28 A;  3S15 B;  3FVQ A;  1SMX A;  4B9X A;  2FFK B;  2R3Z A;  3FHW A;  5IYC G;  4V19 0;  4KV6 A;  3MA2 B;  3GTL B;  1UE7 A;  2Q2U A;  1IXR A;  3PUX A;  1E22 A;  4FF4 A;  4A75 A;  1PZI D;  3SR1 A;  1B3Q A;  1ZYR D;  1TS2 A;  2VB2 X;  2XTI A;  5KNB A;  1TWA B;  5M5X H;  1P16 A;  2F1M A;  1NUC A;  4XDX A;  4C3I B;  3MTS A;  1XTC D;  2JSO A;  3K80 C;  1PH9 A;  3BZK A;  3FPU B;  5BR8 Q;  1SYE A;  2AUJ D;  4A3G G;  1SMY D;  5EKK A;  2R93 H;  4NXM Q;  1HNX Q;  4WOR A;  4K2L A;  4LF4 L;  1MKH A;  1G29 1;  1PH6 A;  1MJE A;  1SFO H;  3CKI B;  3S2D B;  2Q2I A;  2RA4 A;  3QOJ A;  2HUG A;  3A55 A;  5EBC A;  1BXT A;  3HG9 A;  1VF7 A;  1VMC A;  1A15 A;  2ENB A;  5L37 A;  2KBN A;  5GRO A;  5BN4 A;  3LGJ A;  3KFU A;  1ZXT A;  3F1Z A;  2RDF A;  5J1Z A;  3N52 A;  4I7A A;  2R92 B;  3DWA A;  2KOL A;  2K5Q A;  1G8Z D;  1SNM A;  2JK8 A;  2EDG A;  4HIM A;  1Q7Y C;  1PH7 A;  1IBM Q;  4LF5 L;  4YHH Q;  3I4M G;  4CKE A;  3V96 A;  1SYC A;  4G7H C;  4NMZ A;  4Y7N B;  3B6Y A;  4CDD C;  1STE A;  4IUN A;  1CUK A;  1PYB A;  4OWW B;  3QO2 A;  1JOO A;  1EY7 A;  1OXT A;  2QCP X;  3H3V C;  1CT1 D;  4G7O C;  3M4O H;  2C35 B;  4A3J B;  2OQK A;  3D8G A;  2CWP A;  1DYQ A;  3CD6 A;  4RGO S;  1QUQ B;  2R92 G;  2K05 A;  2DJG C;  1XTD A;  4JI1 Q;  4JI2 L;  3BG3 A;  1MIU A;  4IO9 A;  2CWA A;  4A3E G;  4X62 L;  4PV1 C;  3I90 A;  3H0G B;  2F0J A;  2JA8 H;  4PZ7 A;  4UAI A;  2DJF C;  4HJ5 A;  3K7A H;  2UU9 Q;  2CW0 D;  5C4J H;  3L2P A;  1PRE A;  4M1U B;  3CCE A;  1XNQ L;  2F0G A;  3KDF A;  1S5C D;  1PH1 A;  2Z4H A;  1AH9 A;  1G2S A;  2R6G A;  3NBH A;  2K33 A;  3SE0 A;  1EOT A;  3J7A V;  5M5Y H;  1LO5 D;  3GTJ H;  2B2U A;  2E5L L;  2G9H D;  4R4T A;  3ND8 A;  3C3L A;  4X6A H;  2R7F A;  2AQ3 B;  3I4N H;  1VQH A;  5JJI A;  3H0G G;  3CCV A;  1JWS D;  3KBG A;  3NTH A;  2CQA A;  2HD3 A;  4IUV A;  2PI2 E;  4ALP A;  4MN3 A;  3DWQ A;  4A3F H;  2QF7 A;  3RUZ A;  3K6O A;  4LF7 L;  1PRT D;  1KD1 C;  4RHR A;  2N55 A;  1Q1E A;  5C44 G;  5IGG A;  5I9P A;  4WJ3 M;  4DNR B;  2I46 A;  4RG1 A;  3G4O A;  1UE6 A;  1SAP A;  1I50 H;  2PZW A;  3BYY B;  2A73 B;  3DLL A;  1FGU A;  2A68 D;  1VQN A;  4GN4 B;  4XQQ A;  4QIW B;  3TZU A;  3RZO B;  2IX3 A;  1BBU A;  3E9H A;  4LF4 Q;  2E2H B;  5KYL A;  3BYT B;  3A0J A;  4IN3 A;  4ODG A;  5IT9 L;  4C3J H;  4QJF A;  5K36 H;  1JMC A;  3GO5 A;  4PZ6 A;  1A63 A;  5CYU A;  1XJV A;  2R7Z G;  1EY6 A;  1WCM H;  3SDZ A;  2BE5 D;  1W6J A;  4IUU A;  4O2D A;  2P5Z X;  4F87 A;  3NHH A;  1T9H A;  4A3M H;  2E8G A;  2XRS D;  2IW3 A;  4A3K B;  1Z52 A;  2EYO A;  1HZ9 A;  2F0Q A;  4HR7 B;  2I5M X;  3K0X A;  4BBS B;  3STB C;  4UPA A;  5C5M A;  1EYG A;  3U9O A;  4AQY Q;  1TWG B;  4BY7 B;  2VXW A;  3OW2 A;  4LF5 Q;  2XSC A;  3HOX H;  4DNT B;  3NWT A;  3JAM c;  3KLS A;  1STG A;  4P2C B;  1KDB A;  3CP0 A;  3I56 A;  4X64 L;  1EY8 A;  3QOL A;  2F4I A;  5JEA G;  1MSH A;  2L15 A;  3R2T A;  1ML0 D;  2K5H A;  1B50 A;  2HQE A;  4N8X 1;  3I72 A;  1Q86 C;  1YJN A;  4R8I A;  1EQQ A;  2B8F A;  5LMU L;  2Q2T A;  4A3K G;  1TY2 A;  5BN5 A;  4OWT B;  1M4V A;  3MHB A;  1WOC A;  1KNA A;  2I5H A;  3TZD A;  1D2B A;  2KHI A;  3QB3 A;  2FHT A;  4JI2 Q;  3IFD A;  4IFD I;  1C0A A;  1VQD A;  1XX8 A;  4X62 Q;  5DM6 3;  4DK1 A;  3RNU A;  3OWF A;  2KJX A;  4MIU A;  3IAY A;  4A93 H;  3HEJ A;  1F9Q A;  2WB1 G;  2YTY A;  2RCN A;  1PYW D;  1TWC B;  5COR A;  1EL0 A;  4LUZ A;  1EUJ A;  4UP7 A;  1LAC A;  1J6Q A;  1WD0 A;  4ZCK A;  3EJI A;  1CKM A;  1S3O A;  1NY4 A;  2SEB D;  5GAE C;  3GD7 A;  3IRB A;  3M4P A;  1O78 A;  1H9K A;  2Z4I A;  3HOV B;  1N32 L;  4K5X A;  1PFS A;  5JJZ A;  1KQS A;  2E5L Q;  4PZ8 A;  4R9W A;  3HOW B;  1F77 A;  1YIT A;  2EY2 A;  1CQF A;  4NDX A;  1F9R A;  1MI2 A;  1SYF A;  1BKB A;  5HY6 A;  5M3F H;  1JE5 A;  4NP5 A;  4GKJ Q;  4OO1 H;  1LM0 A;  1F2Z A;  1QE6 A;  2UUA L;  1I6H H;  2KEE A;  2KVM A;  5ELC A;  2Z6B A;  1RL2 A;  1DOL A;  3MZ5 A;  1PH3 A;  4A3D H;  3MXN A;  1M1K C;  1GUS A;  1PZJ D;  3T1Y L;  1SEB D;  3KK7 A;  1C48 A;  4DAP A;  4LF7 Q;  4JYA L;  1QZH A;  2I5L X;  3T53 B;  1LUZ A;  4EVO A;  1UAP A;  3Q24 A;  2NVT H;  2EYL A;  4A3I G;  4GZY C;  1EWI A;  2F0F A;  3HOW G;  3HKS A;  3J7Z C;  3GTQ B;  4OEL B;  4OL7 A;  5T1G A;  2NZ1 D;  3NTK A;  5LMN L;  4DV6 Q;  4DR7 Q;  3KDF B;  1Y1W G;  2QEJ C;  4TQU S;  3RZD H;  1CI3 M;  3S2H B;  3NBH B;  1Y14 B;  2M2L A;  1GUN A;  3ER0 A;  1L2F A;  3JAM E;  4DV0 Q;  3OMC A;  3GV6 A;  4YIJ A;  3NWS A;  3QG1 A;  1MJC A;  2ICE C;  1TXY A;  2K7V A;  1G51 A;  1GUG A;  3TQY A;  3VYS A;  1A3U A;  1Z7T A;  1PYS B;  4QB4 A;  5C4H A;  1QNU A;  2UXC L;  4OIJ A;  1GUW A;  1LTS D;  3PF4 A;  4JI7 L;  4CKB A;  2FMC A;  1BDO A;  4RHS A;  3KF8 A;  1EWC A;  2MP1 A;  2N8N A;  3M3Y B;  2MNA A;  1O7I A;  1BCP F;  1I3Q H;  2VUM B;  1K8O A;  2BDN A;  1VQ4 A;  3V05 A;  4X64 Q;  1EIH A;  2MHV A;  3T56 B;  1CA5 A;  4A3L G;  1Y1V B;  4BY1 H;  5HGQ A;  1AE3 A;  5C3E H;  3C2P A;  4C2M H;  1HNW L;  1VQB A;  5LMU Q;  1A3V A;  3KJO A;  2XN9 C;  1E24 A;  2KCM A;  2AWN A;  3AB9 A;  4O42 A;  4KI0 A;  1HPC A;  1I5F A;  2XIW A;  4A3C G;  3H3V I;  4BWG B;  1K73 C;  3A5Z B;  1PV4 A;  2Z0S A;  4QGU A;  2E2J H;  5ELF A;  5IE8 A;  2QA4 A;  1HCZ A;  4DR1 L;  4N9P A;  4N9T A;  4EQO A;  3PO3 G;  1HTL D;  2L0C A;  5FOB B;  3I55 A;  1Y1V G;  5CV8 A;  2F0P A;  1U4P A;  3GTG H;  2VQE L;  5KIX A;  2K01 A;  1STY A;  2EPB A;  2EJF C;  1LV9 A;  2QDB A;  1FNW A;  3KUP A;  3CCQ A;  4IFD J;  5JVH 3;  1N32 Q;  1CFM A;  2O2L D;  4MTN A;  5C4X G;  3AU7 A;  5CC4 A;  1D6E C;  3EBE A;  2F0E A;  2SNM A;  2M9V A;  2D0P A;  4DPG A;  3AEV A;  3SEB A;  2KCN A;  4B08 A;  1Y8P B;  1TWH H;  3C1F A;  1KLG D;  2UUA Q;  2YU9 H;  3D4W A;  1F9S A;  4ZLT F;  2AQ2 B;  2Z9H A;  2A6E C;  3CCR A;  1EU3 A;  3HOY G;  4QUF A;  1Y1W H;  5IYD G;  4IPD A;  4JYA Q;  1UEA B;  4KHV A;  3A8J E;  5IP9 H;  4DXF A;  2LFN A;  2ZJP A;  2A69 D;  3VYU A;  2HDM A;  3URY A;  3KLR A;  3HOU B;  4LWC A;  3AYH B;  1LTG D;  4JG2 A;  1VQL A;  3R2I A;  2EVB A;  3LX0 A;  4OXP A;  4DR5 L;  4EGV A;  5CV7 A;  2B63 H;  2PPB C;  2XVS A;  3VR3 A;  2JA7 H;  2F0H A;  1TWF H;  5BR8 L;  4Q0F A;  4Y52 H;  3T16 A;  1I6V C;  1LTI D;  2HCI A;  3MAQ A;  5M5X B;  2UXC Q;  1E2Z A;  4FYD A;  2IWH A;  2K5W A;  4DR6 L;  4JI7 Q;  1LT3 D;  3TBI B;  3MXN B;  4C3H B;  3HKZ B;  3F2B A;  1X65 A;  2NVQ B;  1YNN C;  3BJU A;  4AIM A;  1SFO B;  4LJZ C;  5M9O A;  1HRJ A;  1K9M C;  1OXX K;  2K6A A;  1J5E L;  1O7L A;  3DXJ C;  4FXK C;  1SE2 A;  1U0L A;  5JEA J;  2IL8 A;  4HIK A;  2ZTC A;  1VCI A;  1FGB D;  2NN6 H;  2CKZ B;  1UUP A;  1C7Y A;  1IBM L;  4YHH L;  1N34 Q;  1DJR D;  4X3T A;  3T13 A;  5A35 A;  1HNW Q;  1RTO A;  5E4W C;  3HRZ C;  3O13 A;  1QVG A;  3HKZ G;  1CSQ A;  3FEW X;  3J80 i;  3M7N A;  4PNY A;  1MGS A;  2EQS A;  3ND9 A;  1FR3 A;  1X3E A;  4DKA C;  3HOZ H;  3S16 H;  1K3B C;  2WB1 E;  4DR3 Q;  2F3W A;  3UI2 A;  1X6O A;  1KAW A;  3OIP A;  3DEO A;  1AZP A;  3JAM L;  2DUD A;  1HUN A;  4DR1 Q;  4XTC S;  5M3M G;  3KF8 B;  4JI1 L;  4DAM A;  3PUW A;  1X3G A;  1BBW A;  1TII D;  1IHZ A;  5CR3 A;  1Y8N B;  1C4Q A;  2A6H C;  3BU2 A;  1N33 L;  1A6X A;  1SDF A;  2EY1 A;  1CQV A;  3D3R A;  3TS2 A;  1L1O A;  4ME5 A;  3CQZ H;  5A2Q E;  2UU9 L;  2VB3 X;  4GN5 A;  1IYU A;  2JQO A;  1V1P A;  3LNN A;  4RCO A;  4DAY A;  1GOZ A;  1NMG A;  4JCV E;  3S1R H;  5BN3 A;  2K14 A;  3K7A B;  4XYQ A;  4ABN A;  4K5V A;  3MXU A;  5C4J B;  5CV6 A;  4IPC A;  5AJ3 L;  3TRZ A;  2RF4 A;  1XMO L;  1EIG A;  4JI4 L;  1BCP C;  1K3R A;  2M00 A;  2PO4 A;  4HTH A;  5JPM C;  1FJG Q;  1G91 A;  3G4N A;  5M5Y B;  1M90 C;  5D3D A;  4ZKC B;  3FRP B;  3RLN A;  1GUT A;  1V1Q A;  2WKD A;  3EFX D;  1Z47 A;  2IHE A;  1JE4 A;  5ELB A;  4EX5 A;  1L1O C;  1HQM C;  4RGT A;  1L0X B;  1GHK A;  3V2T A;  1IZ6 A;  1SBB B;  3TRE A;  1SNQ A;  3K58 A;  3BDC A;  4BA2 I;  4DR5 Q;  2OF1 A;  5LL6 S;  4UP8 A;  4XT3 B;  3ZYY X;  1WI5 A;  2O5I C;  2XWJ B;  3L7Z C;  4A3F B;  3AMU A;  3PGZ A;  5FK9 C;  4P74 A;  4IUT A;  3JAM i;  1HFN A;  4LAA A;  1SNC A;  1JB3 A;  2LXK A;  1JT8 A;  1LTL A;  5EKI A;  2HHH L;  4L6T B;  4ZKB B;  4KKU A;  3K5N A;  1QB5 D;  4DR6 Q;  1I4P A;  3PIP 3;  2I0Q A;  3VR2 A;  1YNJ C;  4ZK9 B;  4NXN Q;  5C0X H;  1WTV A;  1Q81 C;  1BVS A;  2DY8 A;  3VA7 A;  1PVO A;  3MXP A;  4IPG A;  4FF3 A;  4LF8 Q;  4C3J B;  3PO2 H;  3AFQ A;  1EEF D;  1PA6 A;  1IL2 A;  1AW7 A;  4DR2 L;  1J5E Q;  2JE6 I;  2F3V A;  1PTO D;  4C3I G;  2L4N A;  1WCM B;  4KHP Q;  1B8A A;  2EYP A;  3UDF A;  4ILW A;  2RQX A;  1LT4 D;  5JJL A;  4RFB A;  4AQY L;  4KHZ A;  1WTO A;  1C8C A;  4KD3 A;  5TSS A;  1ZKO A;  4YWM A;  4H02 A;  2RVL A;  3IL8 A;  5IOC A;  3HOX B;  1RCV D;  1L0W A;  3RLO A;  1E2V A;  2D0O A;  4XYO A;  1HA6 A;  2BH8 A;  1Y8O B;  4CGY B;  4NKL A;  2EE1 A;  2LSS A;  1KAB A;  1Q1B A;  4J6H A;  4JI0 Q;  3BDL A;  2OCE A;  1R4Q B;  4KJN A;  1IBL Q;  1X56 A;  1AFP A;  1PMR A;  2KEC A;  3K8A A;  5IGC A;  1K8M A;  3SGI A;  2OXP A;  3ERO A;  3VR6 A;  4XXE A;  1WTQ A;  1SLJ A;  1K0S A;  3S17 H;  1N33 Q;  3S1N H;  5HGT A;  2K5V A;  1JQY D;  2JA5 B;  2GN5 A;  3NQT A;  3OOC A;  1VQF A;  2IPK D;  4A3J G;  3CC2 A;  1VQK A;  4A93 B;  4CDF C;  1BNZ A;  3J80 c;  2CHB D;  4B3M Q;  2A5H A;  5IYC H;  4GNX A;  2RDG A;  1T5X D;  1CSP A;  5AJ3 Q;  1WTX A;  3K0Y A;  1XMO Q;  4IFD G;  2HIX A;  4JI4 Q;  3CC4 A;  1SXT A;  1FNU A;  2VW9 A;  4LUO A;  1VQ7 A;  3NTI A;  4KTA A;  1XPU A;  5F2D A;  1TT2 A;  3DEP A;  4GKJ L;  2VL6 A;  5EQ0 A;  2MUY A;  2TMP A;  3SVM A;  3Q23 A;  3GTO H;  3TN2 A;  5EPK A;  4A3G H;  2B2W A;  5LMN W;  2A19 A;  2J4X A;  4CDC C;  2JA5 G;  5M3F B;  1BCP B;  1ICF B;  3PMF A;  1ENA A;  3M4Q A;  3S15 H;  4RCN A;  4CJ0 B;  4F8M A;  1I6H B;  4YY3 L;  3L3O C;  1NTG A;  1ROD A;  2Q2H A;  4R4O A;  1BF4 A;  4IAL A;  4GNX C;  2LS0 1;  1I4Q A;  1L1O B;  1FVI A;  2RHQ B;  2B2U C;  4QCL A;  5C6A A;  1JOK A;  3BS1 A;  1A8V A;  4S3S A;  1V1P B;  2XGT A;  5D3I B;  1D5Z C;  4L63 B;  3W1G A;  4DV6 L;  4DR7 L;  4K8J A;  2NVT B;  3ICE A;  4DN4 M;  1QIL A;  4KMU C;  1PFB A;  1KHI A;  3A5U A;  1TQO A;  2CFM A;  2HHH Q;  2F0I A;  4KK7 A;  2B2W C;  4DV0 L;  4TRD A;  4PQX A;  3W5O A;  5LL6 X;  2Z1C A;  1B44 D;  5A2Q L;  2C9O A;  3E6Z X;  2KCT A;  3I4M H;  2EJM A;  1RF2 D;  3DUZ A;  4BBR B;  3S2D H;  4F88 A;  1HZB A;  1V9P A;  4DR2 Q;  2BDO A;  4KY5 A;  1U5K A;  3CW2 C;  2O4X A;  1N8R C;  2OWO A;  1PTO H;  1GM5 A;  2WAC A;  1CHQ D;  4DXG A;  4JVZ A;  1YVC A;  1DZ1 A;  3HKZ E;  4CJ2 C;  2R92 H;  1O7Z A;  1SYG A;  1UE1 A;  1HR0 W;  2PNR C;  1SN8 A;  3GTM H;  1V8Q A;  2E76 C;  3S24 A;  3D0F A;  5D65 A;  1HQR D;  4GS3 A;  3ULJ A;  1EZ6 A;  4TVA B;  4BBR G;  3I7F A;  4A3E H;  5E4X A;  2PQE A;  3M7G A;  1WTR A;  1CTM A;  1GXD C;  3UDI A;  3A74 A;  3J80 E;  3ZJY C;  1VQM A;  4CJ1 B;  4HSP A;  4RWS C;  1J8I A;  2VS1 A;  3R93 A;  3OTO L;  4RKB A;  3T4A C;  4BY1 B;  4BBS G;  3I2Z A;  5C3E B;  3KOJ A;  2NZH A;  4C2M B;  4BY7 G;  3K57 A;  2AHO B;  1P8L A;  4ZAI A;  2BA1 A;  1KAA A;  2JA6 B;  3G6E A;  1EU4 A;  3TSS A;  2PMZ B;  4FF1 A;  1X3P A;  4HJ7 A;  4DV5 Q;  2PI2 A;  2RCF A;  5IYB G;  2F3I A;  3H0G H;  5G3L D;  1VQ9 A;  1X54 A;  1YNX A;  1LAB A;  2WAQ B;  1E2W A;  1ENF A;  1LTA D;  4LF9 Q;  3CPW A;  3RLF A;  1NAP A;  2F0S A;  2OQ0 A;  3QJY A;  1VQJ A;  4QMG A;  3GTG B;  5K5P A;  1LYL A;  2BCO A;  1Q8I A;  4NB3 A;  2LMC B;  3S1Q B;  3RN5 A;  2WFW A;  1AN8 A;  5C44 H;  2JA6 G;  3A8K E;  5KEE A;  4R1J A;  5FLM G;  1I94 L;  1HTP A;  3SHL A;  4LW1 A;  2B2V A;  1J9O A;  5EBD A;  2YU9 B;  1KDC A;  5CGK A;  2OT2 A;  4YY3 Q;  2WAQ G;  1KTK A;  4CKC A;  4OO1 I;  5KYI A;  4XQJ A;  3HOV G;  2YV5 A;  2K1B A;  1A3T A;  4P71 A;  3R8B A;  2R7Z H;  5EJW A;  4EQN A;  4HAE A;  3SK5 A;  4QL5 A;  5ISR A;  3CCM A; 
#chains in the Genus database with same CATH homology
 1EFI D;  3R3O A;  1EQV A;  5COY A;  1Q3L A;  1LT6 D;  4A3B B;  1OO9 B;  1E0B A;  2XRQ D;  2B2V C;  1ESF A;  3DMU A;  4ULL A;  3NBI A;  3SK8 A;  4H7B A;  3M85 A;  2B63 B;  1BUV T;  1K83 B;  4K14 A;  1RHP A;  5JEA H;  1D1K A;  5HUR A;  2E2I B;  5CV5 A;  2MPM A;  3MC0 B;  1O7Y A;  1I4H A;  4G57 A;  4WRD A;  2IX1 A;  3NXW A;  2EYH A;  4EQP A;  4X3S A;  4HSV A;  1SJH D;  1IL8 A;  2LY7 A;  2IX0 A;  3J81 E;  2AQ1 B;  1PRT F;  2F03 A;  3VA5 A;  4TSS A;  3I73 A;  1R9T B;  1S5D D;  1HXY D;  2BA0 A;  2SDF A;  4I65 A;  3FKI B;  1BR9 A;  1IKM A;  3HZX A;  2EYM A;  3HOZ B;  3S16 B;  4OIK A;  1XYI A;  4KJO A;  3HS0 C;  3A56 A;  1SYD A;  2HCC A;  3J7A F;  4ZQ3 A;  2NBF A;  1A2T A;  5I6Y A;  1OXS C;  3BVM A;  3QIA A;  2X6L A;  1HFG A;  1S4Z A;  4ZUI A;  2C5C A;  1I4R A;  3CQZ B;  3EA6 A;  1IW7 C;  1PFN A;  3C46 A;  5IGE A;  1LT5 D;  2F0U A;  1X3Q A;  3J80 L;  3D31 A;  4UDU C;  1AEX A;  4KN4 C;  3Q22 A;  3OSO A;  3KLS X;  3Q6S A;  1ZYR C;  3EQL C;  1EYA A;  1PZK D;  2PZU A;  2A74 C;  1SE4 A;  4KD4 A;  2IT1 A;  3NQI A;  1SMY C;  3I8Z A;  4ZRZ A;  1EYC A;  5G3L F;  4OGQ C;  1TS3 A;  5DM7 3;  1EY9 A;  5IGB A;  2R93 B;  4JK1 C;  3CRL C;  4IQZ A;  1U4R A;  4XIG S;  1L0Y B;  4O1N A;  3W3A A;  2DN8 A;  1DOM A;  1D1I A;  2XNA C;  1PLF A;  1M8A A;  1AP0 A;  2KED A;  3PO2 B;  3K5L A;  2OEO A;  1IKL A;  2E2D C;  1WTW A;  1X32 A;  1TU2 B;  2QIL A;  3K5M A;  1STA A;  3D6C A;  4C3H G;  1AZQ A;  4IUP A;  2NN6 I;  1SYB A;  2NTS A;  3I70 A;  1H9S A;  2IJ0 A;  2V4D A;  5FO9 B;  5C3W A;  1Y69 U;  1R4P B;  3M4O B;  3MEH A;  4XQN A;  3WDN A;  1STN A;  2F0D A;  4FNF A;  1GJX A;  2L11 A;  5D14 A;  3GV3 A;  1W6K A;  4OHJ A;  2RSN A;  3VYR A;  2MJ8 A;  5C3X A;  4PMW A;  2CW0 C;  1DXM A;  4DAV A;  1JWM D;  2KCC A;  2N88 A;  4CHT B;  3VR4 A;  2D5D A;  1B9M A;  1JR0 D;  2JA8 B;  2JEA I;  3PIO 3;  2Z8L A;  4JBW A;  2WV6 D;  2RKS A;  3I91 A;  5CMD A;  1NSN S;  3SK6 A;  2F0L A;  3MWY W;  4LK1 C;  2FIN B;  5E3F A;  5IT9 E;  1BQQ T;  1F2M A;  1EYD A;  2Y0S B;  4K8I A;  1VMP A;  3GTJ B;  1S5F D;  4AYB B;  4H0L C;  1QOH A;  3PUZ A;  4PMC A;  3I4N B;  1CM9 A;  1B4O A;  1T5E A;  4DF7 A;  5I6W A;  3C0N A;  1GHJ A;  1NR2 A;  2DNE A;  3KBX A;  2Q8R E;  4V0B A;  1PRT C;  3DWP A;  3GTO B;  2A6E D;  4L8J A;  4K2K A;  3D4R A;  2Q8T A;  3A54 A;  1PXU A;  3J7Y W;  3Q0A A;  2A68 C;  3OMG A;  4C1N K;  4Z9C B;  3N6R A;  4H44 C;  3QWN A;  1A2U A;  1U9R A;  3LWU A;  2RSO A;  1I50 B;  2YYZ A;  1DOK A;  3FMC A;  5C5L A;  3WOE A;  2BE5 C;  4K6D A;  3TP6 A;  1CZG A;  1SJE D;  4MHE A;  1H9M A;  1RDP D;  3PUV A;  3I4M B;  2F0M A;  1V43 A;  4WJW A;  3NUC A;  3S9W A;  5C0X I;  3P1H A;  4A3M B;  2WIN B;  4K5W A;  1QWY A;  1II3 A;  4HMI A;  1PTO B;  2NTT A;  3OWE B;  1EY4 A;  1MSG A;  1YNN D;  2F0T A;  2PCF B;  1ILP A;  3A7L A;  2PYK A;  1ICW A;  5EGT A;  3GTM B;  1LLR D;  4C3J G;  5K36 G;  2EY6 A;  2XWB B;  1U4L A;  2D9U A;  4A3E B;  1WVL A;  4RGN A;  1TKW B;  2F0N A;  5I2X A;  2ZXO A;  4IUR A;  5FLX E;  1WTP A;  1EZ8 A;  2KHS A;  1STH A;  4ZYS A;  2KUM A;  3X3N A;  1STB A;  1B3A A;  5KRU A;  1JCK B;  3SK4 A;  2ZXP A;  2A6H D;  4DFA A;  4HCS A;  4HMJ A;  3VYT A;  4Q5V A;  1H9S B;  3I3C A;  4H13 C;  4G7Z C;  1B1Z A;  1ESR A;  1CHP D;  1TR5 A;  2B2T A;  4PMB A;  1LTR D;  3WOF A;  5C44 B;  5CBA E;  1Q12 A;  2L9H A;  4G4K A;  4ID6 A;  1BCP D;  1FYC A;  1TY0 A;  4A3D B;  2HDL A;  5IGF A;  3ONA B;  1LTT D;  2H1E A;  2JEB I;  2R61 A;  2KQ3 A;  1PRT B;  3BDO A;  1CK1 A;  3VR5 A;  2R7Z B;  4U68 A;  2GA4 B;  4KY6 A;  3D6W A;  1QCB D;  3CU7 A;  5I4D A;  2B2T C;  1EQT A;  1H9R A;  5ELE A;  3RZD B;  1V1O A;  4OO1 G;  1RJT A;  2EZV A;  3SXH A;  5IIF A;  3TME A;  1S5B D;  3OPO A;  3ITP A;  3H94 A;  4LMQ D;  3OIQ A;  4TKO B;  3BVG A;  1DCZ A;  5KGU A;  4QUC A;  5KNC A;  3OHX C;  3MVV A;  3PV0 A;  4X3U A;  2WP8 J;  3GP7 A;  3GTK B;  1YNJ D;  4FVM A;  1Q90 A;  3NE5 B;  5FO8 B;  4R8N A;  4QF4 A;  2D62 A;  3P20 A;  4F7X A;  3MXG A;  3GTP B;  1SE3 A;  1JOR A;  1I3Q B;  3H09 A;  1O80 A;  2F0O A;  1MBY A;  1Z6H A;  5J39 A;  3MFG A;  2AUK A;  2E74 C;  5C0X J;  3TP5 A;  1RD9 D;  3G7L A;  5I9O A;  1CA6 A;  4RKL A;  5DEH A;  2WB1 B;  2FJ2 A;  4X3K A;  1RKN A;  2NB0 A;  4IFD H;  1FNV A;  3HGB A;  3MFY A;  4ZUJ A;  2SOB A;  2E2J B;  1DM0 B;  1F2Y A;  2E75 C;  1HHV A;  1JWU D;  2LKV A;  3DHQ A;  3H91 A;  4BA1 I;  5CV9 A;  5JOB A;  1IYV A;  2ZT9 C;  1PTO F;  1H9J A;  4DGZ A;  5JPN C;  1MD2 D;  4HED A;  1TVX A;  4RAU C;  5T1I A;  2H4O A;  1TWH B;  1OXV A;  4A3I B;  2JYO A;  3T51 B;  1GUO A;  2A69 C;  1Y1W B;  4XT1 B;  4RA8 A;  2G9D A;  2RBM A;  3K5O A;  2F0V A;  3K59 A;  2MGS A;  2PW7 A;  3S1M B;  3IKJ A;  3TP7 A;  3C0M A;  3LWE A;  4J1M A;  1I4X A;  5FLX L;  2K04 A;  5IOD A;  1LTB D;  2O5J C;  2JP1 A;  3FPP A;  1PFM A;  1D5X C;  1F9P A;  3U9S A;  2JA7 B;  1TWF B;  3C0O A;  3NP8 A;  5EPL A;  3S14 B;  1BOS A;  2TSS A;  2BOS A;  3L9A X;  1DD2 A;  1I4G A;  1SNP A;  4HN7 A;  4K6L A;  4KN7 C;  1OXU A;  3OW7 A;  1UNS A;  4WFN 3;  4CBV A;  2QKI C;  5EPJ A;  5AFW A;  5LHY 1;  1XXG A;  2WKC A;  4E6I A;  1U4M A;  2ZXR A;  1ET6 A;  1SNO A;  4I7Z C;  3GQB A;  5IGD A;  5M5W B;  4IZ8 A;  1KLU D;  1KDA A;  1DON A;  2Q8I B;  3PO3 B;  1SSO A;  1VDZ A;  2WII B;  3E5S A;  2L1B A;  3FDT A;  4DU9 A;  3DM1 A;  1HUM A;  3C1E A;  1SND A;  3A7A B;  2KA7 A;  1BBX C;  5JAV A;  5C4X B;  3M4Y A;  4BS9 A;  1JC7 A;  3BVZ A;  4FP5 D;  2X6G A;  1EY0 A;  2ID0 A;  4FO2 A;  1RTN A;  2NN6 G;  2SNS A;  5FO7 B;  1WD1 A;  2I07 B;  4DA2 A;  3HOY B;  1G2T A;  3HP3 A;  2NVY B;  2L12 A;  4B9W A;  1QNK A;  1F2L A;  3S1R B;  2NUC A;  3NSW A;  2EYF A;  4DK0 A;  1B53 A;  5KND A;  2CVR A;  2AWO A;  1B2T A;  1NCV A;  3F2U A;  4C56 C;  1ZEQ X;  5DAU A;  1S5E D;  1JOQ A;  2L5T A;  3NK9 A;  4KKT A;  4KKS A;  2EXZ A;  5DNF A;  3P7J A;  5I2Y A;  2ICI A;  1HA5 A;  1ET9 A;  3NPP A;  2DNC A;  5J22 A;  3ERQ A;  4M8A A;  3TP8 A;  3A8I E;  2L55 A;  3W2D A;  2NVX B;  1BO0 A;  5JVG 3;  3H6M A;  4U67 3;  4J8Q A;  1QG7 A;  5FKA C;  1FD7 D;  1TS4 A;  2B8G A;  5E1F A;  4IUQ A;  1ENC A;  1ONL A;  3IFT A;  1PDQ A;  1PTO C;  2K32 A;  1EY5 A;  1CZW A;  3CHB D;  4FF2 A;  4C1N I;  2PW5 A;  2VNU D;  1EEI D;  2NWG A;  2JXM B;  2J7Z A;  2EOT A;  2B39 A;  3G6J B;  3E0J A;  5M3M B;  3BZD B;  5NUC A;  1TS5 A;  2PZT A;  4RH6 A;  5C0X G;  1ILQ A;  5C4Z A;  5EKL A;  3PUY A;  1EWH A;  2J0T D;  1XWE A;  4FXD A;  1KNE A;  2RDH A;  4NW2 A;  3X3M A;  2K5D A;  2K03 A;  2EY5 A;  1NR4 A;  1B9N A;  1D5M C;  4RGM A;  2F0K A;  3S17 B;  2B2Y A;  3S1N B;  2EJG C;  2D2C C;  5ELD A;  1JIC A;  3P75 A;  4FXG C;  3I4L A;  1QJO A;  2X69 A;  5CV4 A;  3J81 L;  4KY7 A;  2DY7 A;  1G6Z A;  2FMM A;  4HCE A;  3RMH A;  2F0W A;  1IW7 D;  2B2Y C;  3EVQ A;  3CRK C;  3D4D A;  2EYJ A;  5CBE E;  3TDQ A;  4A3G B;  1VF5 C;  3RD4 A;  2NYZ D;  2K28 A;  3S15 B;  3FVQ A;  4B9X A;  2FFK B;  2R3Z A;  4V19 0;  4KV6 A;  3MA2 B;  3GTL B;  3PUX A;  4FF4 A;  1PZI D;  3SR1 A;  1ZYR D;  1TS2 A;  2VB2 X;  5KNB A;  1TWA B;  2F1M A;  1NUC A;  4XDX A;  4C3I B;  3MTS A;  1XTC D;  2JSO A;  3FPU B;  1SYE A;  2AUJ D;  1SMY D;  5EKK A;  4WOR A;  4K2L A;  1G29 1;  3CKI B;  3S2D B;  2RA4 A;  3QOJ A;  2HUG A;  3A55 A;  5EBC A;  1BXT A;  3HG9 A;  1VF7 A;  1VMC A;  1A15 A;  2ENB A;  5BN4 A;  1ZXT A;  2RDF A;  5J1Z A;  3N52 A;  2R92 B;  3DWA A;  2KOL A;  2K5Q A;  1G8Z D;  1SNM A;  2EDG A;  4CKE A;  3V96 A;  1SYC A;  4G7H C;  4NMZ A;  4Y7N B;  1STE A;  4IUN A;  3QO2 A;  1JOO A;  1EY7 A;  1OXT A;  2QCP X;  3H3V C;  1CT1 D;  4G7O C;  4A3J B;  3D8G A;  1DYQ A;  4RGO S;  2K05 A;  3BG3 A;  4PV1 C;  3I90 A;  3H0G B;  2F0J A;  4UAI A;  2CW0 D;  1PRE A;  4M1U B;  2F0G A;  1S5C D;  2Z4H A;  1G2S A;  2R6G A;  3NBH A;  2K33 A;  3SE0 A;  1EOT A;  3J7A V;  1LO5 D;  2B2U A;  2G9H D;  3ND8 A;  3C3L A;  2AQ3 B;  1JWS D;  3KBG A;  3NTH A;  2CQA A;  4IUV A;  4MN3 A;  3DWQ A;  2QF7 A;  3RUZ A;  3K6O A;  1PRT D;  4RHR A;  2N55 A;  1Q1E A;  5IGG A;  5I9P A;  4DNR B;  2I46 A;  3G4O A;  1SAP A;  2PZW A;  3BYY B;  2A73 B;  2A68 D;  4XQQ A;  4QIW B;  3TZU A;  3RZO B;  2IX3 A;  2E2H B;  5KYL A;  3BYT B;  4IN3 A;  4ODG A;  5IT9 L;  5K36 H;  3GO5 A;  5CYU A;  1EY6 A;  3SDZ A;  2BE5 D;  1W6J A;  4IUU A;  4F87 A;  3NHH A;  2XRS D;  2IW3 A;  4A3K B;  1Z52 A;  2EYO A;  2F0Q A;  4HR7 B;  4BBS B;  5C5M A;  3U9O A;  4BY7 B;  1TWG B;  2VXW A;  2XSC A;  4DNT B;  3NWT A;  3KLS A;  1STG A;  4P2C B;  1KDB A;  1EY8 A;  3QOL A;  2F4I A;  5JEA G;  1MSH A;  3R2T A;  1ML0 D;  1B50 A;  2HQE A;  3I72 A;  4R8I A;  2B8F A;  1TY2 A;  5BN5 A;  1M4V A;  3MHB A;  1KNA A;  3TZD A;  1D2B A;  3QB3 A;  2FHT A;  3IFD A;  4IFD I;  1XX8 A;  5DM6 3;  4DK1 A;  3OWF A;  2KJX A;  4MIU A;  3IAY A;  3HEJ A;  1F9Q A;  1PYW D;  1TWC B;  5COR A;  1EL0 A;  1LAC A;  1WD0 A;  3EJI A;  2SEB D;  3GD7 A;  1O78 A;  1H9K A;  2Z4I A;  3HOV B;  4K5X A;  5JJZ A;  4R9W A;  3HOW B;  1F77 A;  2EY2 A;  1CQF A;  4NDX A;  1F9R A;  1MI2 A;  1SYF A;  4NP5 A;  4OO1 H;  1F2Z A;  1QE6 A;  2KEE A;  2KVM A;  5ELC A;  1DOL A;  3MZ5 A;  3MXN A;  1GUS A;  1PZJ D;  1SEB D;  3KK7 A;  1C48 A;  4DAP A;  3T53 B;  4EVO A;  1UAP A;  3Q24 A;  2EYL A;  4GZY C;  2F0F A;  3GTQ B;  4OL7 A;  5T1G A;  2NZ1 D;  3NTK A;  2QEJ C;  4TQU S;  1CI3 M;  3S2H B;  2M2L A;  1GUN A;  3JAM E;  3OMC A;  3GV6 A;  4YIJ A;  3NWS A;  3QG1 A;  2ICE C;  2K7V A;  1GUG A;  3VYS A;  1A3U A;  1Z7T A;  4QB4 A;  5C4H A;  1QNU A;  4OIJ A;  1GUW A;  1LTS D;  4CKB A;  2FMC A;  1BDO A;  4RHS A;  3KF8 A;  1EWC A;  2MP1 A;  3M3Y B;  1BCP F;  2VUM B;  1K8O A;  2BDN A;  3V05 A;  1EIH A;  2MHV A;  3T56 B;  1CA5 A;  1Y1V B;  3C2P A;  1A3V A;  2XN9 C;  2AWN A;  3AB9 A;  4O42 A;  4KI0 A;  1HPC A;  2XIW A;  4BWG B;  5ELF A;  1HCZ A;  4N9P A;  4N9T A;  4EQO A;  1HTL D;  2L0C A;  5FOB B;  5CV8 A;  2F0P A;  1U4P A;  5KIX A;  2K01 A;  1STY A;  2EPB A;  2EJF C;  1LV9 A;  2QDB A;  1FNW A;  3KUP A;  4IFD J;  5JVH 3;  1CFM A;  2O2L D;  3AU7 A;  5CC4 A;  1D6E C;  2F0E A;  2SNM A;  2M9V A;  3SEB A;  2KCN A;  4B08 A;  1Y8P B;  3C1F A;  1KLG D;  3D4W A;  1F9S A;  4ZLT F;  2AQ2 B;  2A6E C;  1EU3 A;  4QUF A;  1UEA B;  4KHV A;  3A8J E;  4DXF A;  2LFN A;  2A69 D;  3VYU A;  2HDM A;  3URY A;  3KLR A;  3HOU B;  1LTG D;  3R2I A;  2EVB A;  3LX0 A;  4EGV A;  5CV7 A;  2PPB C;  2XVS A;  3VR3 A;  2F0H A;  4Q0F A;  3T16 A;  1I6V C;  1LTI D;  2HCI A;  3MAQ A;  5M5X B;  1E2Z A;  4FYD A;  2IWH A;  2K5W A;  1LT3 D;  3TBI B;  4C3H B;  3HKZ B;  2NVQ B;  1YNN C;  1SFO B;  4LJZ C;  5M9O A;  1HRJ A;  1OXX K;  2K6A A;  1O7L A;  3DXJ C;  4FXK C;  1SE2 A;  5JEA J;  2IL8 A;  1VCI A;  1FGB D;  2NN6 H;  1UUP A;  1DJR D;  4X3T A;  3T13 A;  5A35 A;  1RTO A;  5E4W C;  3HRZ C;  3O13 A;  3FEW X;  3M7N A;  4PNY A;  1MGS A;  3ND9 A;  1FR3 A;  2F3W A;  3UI2 A;  3OIP A;  3DEO A;  1AZP A;  3JAM L;  1HUN A;  4XTC S;  3PUW A;  1TII D;  1IHZ A;  5CR3 A;  1Y8N B;  1C4Q A;  2A6H C;  1A6X A;  1SDF A;  2EY1 A;  1CQV A;  3D3R A;  4ME5 A;  5A2Q E;  2VB3 X;  1IYU A;  1V1P A;  3LNN A;  4RCO A;  4DAY A;  1GOZ A;  5BN3 A;  3K7A B;  4XYQ A;  4ABN A;  4K5V A;  3MXU A;  5C4J B;  5CV6 A;  1EIG A;  1BCP C;  4HTH A;  2M00 A;  2PO4 A;  5JPM C;  1G91 A;  3G4N A;  5M5Y B;  5D3D A;  4ZKC B;  3FRP B;  1GUT A;  2WKD A;  3EFX D;  1Z47 A;  1JE4 A;  5ELB A;  1HQM C;  4RGT A;  1L0X B;  1GHK A;  3V2T A;  1SBB B;  1SNQ A;  3K58 A;  3BDC A;  4BA2 I;  2OF1 A;  5LL6 S;  4XT3 B;  3ZYY X;  2O5I C;  2XWJ B;  3L7Z C;  4A3F B;  3AMU A;  5FK9 C;  4IUT A;  1HFN A;  4LAA A;  1SNC A;  1JB3 A;  5EKI A;  4L6T B;  4ZKB B;  4KKU A;  3K5N A;  1QB5 D;  1I4P A;  3PIP 3;  3VR2 A;  1YNJ C;  4ZK9 B;  5C0X H;  1WTV A;  2DY8 A;  3VA7 A;  3MXP A;  4FF3 A;  4C3J B;  1EEF D;  1AW7 A;  2JE6 I;  2F3V A;  1PTO D;  4C3I G;  2L4N A;  1WCM B;  2EYP A;  4ILW A;  2RQX A;  1LT4 D;  4RFB A;  4KHZ A;  1WTO A;  1C8C A;  4KD3 A;  5TSS A;  1ZKO A;  2RVL A;  3IL8 A;  5IOC A;  3HOX B;  1RCV D;  1E2V A;  4XYO A;  1HA6 A;  1Y8O B;  4CGY B;  4NKL A;  2EE1 A;  1KAB A;  1Q1B A;  4J6H A;  3BDL A;  1R4Q B;  4KJN A;  1AFP A;  1PMR A;  2KEC A;  5IGC A;  1K8M A;  2OXP A;  3ERO A;  3VR6 A;  4XXE A;  1WTQ A;  5HGT A;  1JQY D;  2JA5 B;  3NQT A;  3OOC A;  2IPK D;  4A93 B;  1BNZ A;  2CHB D;  2A5H A;  2RDG A;  1T5X D;  4IFD G;  1WTX A;  3K0Y A;  1SXT A;  1FNU A;  3NTI A;  4KTA A;  5F2D A;  1TT2 A;  3DEP A;  5EQ0 A;  2MUY A;  2TMP A;  3SVM A;  3Q23 A;  3TN2 A;  5EPK A;  2B2W A;  2J4X A;  5M3F B;  1BCP B;  3PMF A;  1ENA A;  4RCN A;  4CJ0 B;  4F8M A;  1I6H B;  3L3O C;  1BF4 A;  1ROD A;  4IAL A;  2LS0 1;  1I4Q A;  2B2U C;  4QCL A;  5C6A A;  1JOK A;  3BS1 A;  4S3S A;  1V1P B;  5D3I B;  1D5Z C;  4L63 B;  4K8J A;  2NVT B;  4DN4 M;  1QIL A;  4KMU C;  1PFB A;  1TQO A;  2F0I A;  4KK7 A;  2B2W C;  4TRD A;  4PQX A;  5LL6 X;  2Z1C A;  1B44 D;  5A2Q L;  2C9O A;  3E6Z X;  2EJM A;  1RF2 D;  3DUZ A;  4BBR B;  4F88 A;  2BDO A;  4KY5 A;  2O4X A;  1PTO H;  2WAC A;  1CHQ D;  4DXG A;  1DZ1 A;  4CJ2 C;  1O7Z A;  1SYG A;  2PNR C;  1V8Q A;  2E76 C;  5D65 A;  1HQR D;  1EZ6 A;  5E4X A;  2PQE A;  3M7G A;  1WTR A;  1CTM A;  1GXD C;  3J80 E;  4CJ1 B;  4HSP A;  4RWS C;  1J8I A;  3R93 A;  4RKB A;  3T4A C;  4BY1 B;  5C3E B;  4C2M B;  3K57 A;  4ZAI A;  2BA1 A;  1KAA A;  2JA6 B;  1EU4 A;  3TSS A;  2PMZ B;  4FF1 A;  1X3P A;  5G3L D;  1LAB A;  2WAQ B;  1E2W A;  1ENF A;  1LTA D;  3RLF A;  1NAP A;  2F0S A;  3QJY A;  4QMG A;  3GTG B;  5K5P A;  2BCO A;  1Q8I A;  2LMC B;  3S1Q B;  1AN8 A;  3A8K E;  5KEE A;  1HTP A;  3SHL A;  2B2V A;  1J9O A;  5EBD A;  2YU9 B;  1KDC A;  5CGK A;  2OT2 A;  1KTK A;  4CKC A;  4OO1 I;  5KYI A;  4XQJ A;  2K1B A;  1A3T A;  3R8B A;  5EJW A;  4EQN A;  4HAE A;  3SK5 A;  5ISR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...