1BCYA

Recombinant rat annexin v, t72k mutant
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
318
structure length
318
Chain Sequence
ALRGTVTDFSGFDGRADAEVLRKAMKGLGTDEDSILNLLTARSNAQRQQIAEEFKTLFGRDLVNDMKSELKGKFEKLIVALMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELRAIKQAYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLENLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVIVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANNEXIN V
publication title Mutational and crystallographic analyses of interfacial residues in annexin V suggest direct interactions with phospholipid membrane components.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Calcium-binding protein
total genus 130
structure length 318
sequence length 318
ec nomenclature
pdb deposition date 1998-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00191 Annexin Annexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1bcyA02
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1bcyA04
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1bcyA01
1.10.220.10 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin 1bcyA03
1BCWA 2IE7A 1N41A 1N00A 1A8BA 1A8AA 1BC0A 1W7BA 1YIIA 1HVEA 2H0MA 1BO9A 1YJ0A 4HREA 1BC1A 1N42A 1AVRA 1M9IA 1ANXA 1ANNA 2HYWA 1HVFA 1HM6A 1YCNA 1HVGA 2H0LA 2RANA 1AXNA 2ZHIA 1AVHA 4MDUA 2H0KA 1G5NA 2II2A 1HVDA 1XJLA 2IE6A 1AIIA 1AEIA 2ZOCA 1AVCA 2IICA 1MCXA 1DM5A 1DK5A 2HYUA 1ALAA 1I4AA 1BCYA 1ANWA 2XO3A 4X9PA 4EVFA 2XO2A 2Q4CA 1AOWA 1W45A 3BRXA 4MDVA 1N44A 1SAVA 1W3WA 1BC3A 2HYVA 2ZHJA 1BCZA 1HAKA 4EVHA
chains in the Genus database with same CATH superfamily
4KMUX 1Q8DA 1N41A 1N00A 2K6XA 1C1KA 4HREA 1AVRA 1AXNA 1AVHA 4JMOA 3USWA 2VXGA 1R8QE 1AEIA 2IICA 1R4AE 4EVFA 4C0AA 1ANWA 2XO3A 4JXHA 2R09A 1SAVA 1BCZA 1BC9A 1HAKA 3USYA 4EVHA 4OIYA 1W7BA 1YIIA 1ANNA 4D7RA 1HVFA 1HM6A 1QC7A 1KU1A 2H0KA 1G5NA 1R8SE 1HVDA 2IE6A 3AO0A 3HJLA 2ZOCA 2HYUA 2HSNA 3SOHB 1BCYA 2Q4CA 2HYVA 2XO2A 4Q2SA 3ABQA 3ANYA 1BCWA 3ABRA 2IE7A 1A8BA 1A8AA 1R8ME 4C7PA 2H0MA 1UPTB 1BC1A 1N42A 1ANXA 4Z21A 2HYWA 4KN7X 1YCNA 2RANA 1HVGA 2H0LA 2ZHIA 2OY9A 4FQ0C 4JWLA 2II2A 3ABOA 2R0DA 1DM5A 4JMIA 4JK1X 1I4AA 1XSZA 1LKVX 3BRXA 4MDVA 1W3WA 1RE0B 1BC0A 1HVEA 3TW5A 1BO9A 1YJ0A 4FHRB 1M9IA 4D7QA 4A4PA 4MDUA 3ABSA 3SWVA 1XJLA 1AIIA 1PBVA 1AVCA 1MCXA 1DK5A 1XT0B 4X9PA 3AJCA 2QEZA 1AOWA 1W45A 1YGMA 3LTLA 3L8NA 1N44A 4KN4X 1BC3A 2ZHJA 1ALAA 1S9DE 4L5MA
chains in the Genus database with same CATH topology
1BCWA 2IE7A 1N41A 1N00A 1A8BA 1A8AA 1BC0A 1W7BA 1YIIA 1HVEA 2H0MA 1BO9A 1YJ0A 4HREA 1BC1A 1N42A 1AVRA 1M9IA 1ANXA 1ANNA 2HYWA 1HVFA 1HM6A 1YCNA 1HVGA 2H0LA 2RANA 1AXNA 2ZHIA 1AVHA 4MDUA 2H0KA 1G5NA 2II2A 1HVDA 1XJLA 2IE6A 1AIIA 1AEIA 2ZOCA 1AVCA 2IICA 1MCXA 1DM5A 1DK5A 2HYUA 1ALAA 1I4AA 1BCYA 1ANWA 2XO3A 4X9PA 4EVFA 2XO2A 2Q4CA 1AOWA 1W45A 3BRXA 4MDVA 1N44A 1SAVA 1W3WA 1BC3A 2HYVA 2ZHJA 1BCZA 1HAKA 4EVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCW A;  2IE7 A;  1N41 A;  1N00 A;  1A8B A;  1A8A A;  1BC0 A;  1W7B A;  1YII A;  1HVE A;  2H0M A;  1BO9 A;  1YJ0 A;  4HRE A;  1BC1 A;  1N42 A;  1AVR A;  1M9I A;  1ANX A;  1ANN A;  2HYW A;  1HVF A;  1HM6 A;  1YCN A;  1HVG A;  2H0L A;  2RAN A;  1AXN A;  2ZHI A;  1AVH A;  4MDU A;  2H0K A;  1G5N A;  2II2 A;  1HVD A;  1XJL A;  2IE6 A;  1AII A;  1AEI A;  2ZOC A;  1AVC A;  2IIC A;  1MCX A;  1DM5 A;  1DK5 A;  2HYU A;  1ALA A;  1I4A A;  1BCY A;  1ANW A;  2XO3 A;  4X9P A;  4EVF A;  2XO2 A;  2Q4C A;  1AOW A;  1W45 A;  3BRX A;  4MDV A;  1N44 A;  1SAV A;  1W3W A;  1BC3 A;  2HYV A;  2ZHJ A;  1BCZ A;  1HAK A;  4EVH A; 
#chains in the Genus database with same CATH topology
 4KMU X;  1Q8D A;  1N41 A;  1N00 A;  2K6X A;  1C1K A;  4HRE A;  1AVR A;  1AXN A;  1AVH A;  4JMO A;  3USW A;  2VXG A;  1R8Q E;  1AEI A;  2IIC A;  1R4A E;  4EVF A;  4C0A A;  1ANW A;  2XO3 A;  4JXH A;  2R09 A;  1SAV A;  1BCZ A;  1BC9 A;  1HAK A;  3USY A;  4EVH A;  4OIY A;  1W7B A;  1YII A;  1ANN A;  4D7R A;  1HVF A;  1HM6 A;  1QC7 A;  1KU1 A;  2H0K A;  1G5N A;  1R8S E;  1HVD A;  2IE6 A;  3AO0 A;  3HJL A;  2ZOC A;  2HYU A;  2HSN A;  3SOH B;  1BCY A;  2Q4C A;  2HYV A;  2XO2 A;  4Q2S A;  3ABQ A;  3ANY A;  1BCW A;  3ABR A;  2IE7 A;  1A8B A;  1A8A A;  1R8M E;  4C7P A;  2H0M A;  1UPT B;  1BC1 A;  1N42 A;  1ANX A;  4Z21 A;  2HYW A;  4KN7 X;  1YCN A;  2RAN A;  1HVG A;  2H0L A;  2ZHI A;  2OY9 A;  4FQ0 C;  4JWL A;  2II2 A;  3ABO A;  2R0D A;  1DM5 A;  4JMI A;  4JK1 X;  1I4A A;  1XSZ A;  1LKV X;  3BRX A;  4MDV A;  1W3W A;  1RE0 B;  1BC0 A;  1HVE A;  3TW5 A;  1BO9 A;  1YJ0 A;  4FHR B;  1M9I A;  4D7Q A;  4A4P A;  4MDU A;  3ABS A;  3SWV A;  1XJL A;  1AII A;  1PBV A;  1AVC A;  1MCX A;  1DK5 A;  1XT0 B;  4X9P A;  3AJC A;  2QEZ A;  1AOW A;  1W45 A;  1YGM A;  3LTL A;  3L8N A;  1N44 A;  4KN4 X;  1BC3 A;  2ZHJ A;  1ALA A;  1S9D E;  4L5M A; 
#chains in the Genus database with same CATH homology
 1BCW A;  2IE7 A;  1N41 A;  1N00 A;  1A8B A;  1A8A A;  1BC0 A;  1W7B A;  1YII A;  1HVE A;  2H0M A;  1BO9 A;  1YJ0 A;  4HRE A;  1BC1 A;  1N42 A;  1AVR A;  1M9I A;  1ANX A;  1ANN A;  2HYW A;  1HVF A;  1HM6 A;  1YCN A;  1HVG A;  2H0L A;  2RAN A;  1AXN A;  2ZHI A;  1AVH A;  4MDU A;  2H0K A;  1G5N A;  2II2 A;  1HVD A;  1XJL A;  2IE6 A;  1AII A;  1AEI A;  2ZOC A;  1AVC A;  2IIC A;  1MCX A;  1DM5 A;  1DK5 A;  2HYU A;  1ALA A;  1I4A A;  1BCY A;  1ANW A;  2XO3 A;  4X9P A;  4EVF A;  2XO2 A;  2Q4C A;  1AOW A;  1W45 A;  3BRX A;  4MDV A;  1N44 A;  1SAV A;  1W3W A;  1BC3 A;  2HYV A;  2ZHJ A;  1BCZ A;  1HAK A;  4EVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...