1BD4A

Uprt-uracil complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
224
Chain Sequence
b'QEESILQDIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGTM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL PHOSPHORIBOSYLTRANSFERASE
molecule tags Transferase
source organism Toxoplasma gondii
publication title Crystal structures of Toxoplasma gondii uracil phosphoribosyltransferase reveal the atomic basis of pyrimidine discrimination and prodrug binding.
pubmed doi rcsb
total genus 70
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 1998-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bd4A00
1G9TA 4RHUA 1A96A 4RACA 2EHJA 4LZOA 1ZN7A 5BRNA 1CJBA 1J7JA 4X45A 4QRIA 4FYMA 2P1ZA 4RHTA 2WNSA 2JBHA 1ECBA 3M3HA 3EFHA 1IBSA 1ECFA 1JLRA 5E38A 1L1RA 4WMLA 1A98A 2JI4A 1UPUA 4LZNA 4RAQA 4RV4A 5BQPA 1Z7GA 1ZN9A 1DBRA 4PFQA 2GEBA 3MJDA 4P84A 5IAOA 1ECJA 3OHPA 4LZAA 5ESWA 3ACCA 5EUCA 3LRTA 4LYYA 1VCHA 2PRZA 1UFRA 4QYIB 2IGBA 5ESXA 3S5JA 3HVUA 1HMPA 4S2UA 4LYGA 4WN3A 1AO0A 1QCCA 4M0KA 1NULA 5IPFA 2JKZA 1DQPA 1FSGA 2PRYA 3GGCA 3OZFA 1XTTA 1R3UA 3N2LA 2H06A 1L1QA 4RQAA 4ZFNA 1A95A 1ZN8A 1QK4A 5JSQA 2YZKA 1I14A 1PZMA 1GRVA 1I13A 4P80A 1D6NA 3ACDA 4JITA 1QB8A 3MBIA 1VDMA 4P82A 3G6WA 3LPNA 1BZYA 1JLSA 4JLSA 1G2PA 3DEZA 4P83A 1OREA 1QB7A 4KN6A 1TC1A 4RHXA 4X44A 4P86A 4P3KA 1GPH1 3H83A 4F8EA 1NONA 1A4XA 4QYIA 1ECGA 1A3CA 2JKYA 4RANA 1G9SA 4M0UA 1I0IA 3GEPA 4P81A 3ACBA 1DKUA 4IJQA 4M0PA 3OZGA 3DAHA 1A97A 5KAMA 1LH0A 1I5EA 1P17A 4PAWA 1XTUA 4TWBA 1P18A 2PS1A 2H08A 5K51A 4Z1OA 1BD3A 1OPRA 1QCDA 1O57A 2XBUA 4RQBA 1U9ZA 1UPFA 4RAOA 1OROA 1V9SA 5HIAA 3NAGA 1I0LA 1DKRA 1STOA 1DQNA 5KAPA 2FXVA 1G2QA 5BQOA 1YFZA 4RADA 1BD4A 1ECCA 3DMPA 1XZ8A 4MB6A 5HKLA 5JV5A 1QK5A 1U9YA 1QK3A 3O7MA 1P19A 5BSKA 1XTVA 1Y0BA 2C4KA 2VFAA 2HCRA 1WD5A 1XZNA 1W30A 3QW4B 4RABA 3KB8A 1MZVA 4OHCA 1TC2A 4RHYA 1HGXA 2AEEA 1VSTA 1P4AA 3GGJA 2E55A 2DY0A 1O5OA 2H07A
chains in the Genus database with same CATH superfamily
3V4RA 4YMLA 1T0PA 5L3QB 1SQ5A 2QB5A 2DWPA 2NV0A 1BX1A 3QVKA 5LPNA 2A14A 3RC8A 1P0CA 1E59A 3TIVA 1PGQA 2IYQA 4ND6A 4OA8A 4CM3A 1ZSNA 4JYBA 3CUKA 3NRCA 2JFHA 3PHCA 4GPAA 2DBQA 3DO6A 4I3GA 4RZSA 3FD8A 2LCFA 4MMZB 2DHQA 1WOMA 2JGRA 4UU1A 2OP0A 1HDRA 2UVPB 3PI7A 4KX3A 3FB4A 3GLHE 3R77A 4G2NA 4CKEA 1L5MA 4XUEA 3BTSA 1QWOA 4J0CA 3TLCA 1NUSA 3AONB 5JPIA 1Y3DE 5CM2Z 1I10A 4NV0A 1ISRA 1F2TA 1JKJB 4GT1A 5DM4A 3UTCA 1Z17A 1B6SA 5DM2A 1JHMA 2WINI 3AI3A 3HABA 4HGRA 3EF3A 2B1IA 2W6QA 3WYDA 1G2IA 2RDMA 5GOZA 1JG2A 3OHSX 5AK4A 2DY1A 1NDHA 5AVSA 5CIQA 4DY6A 3NTVA 4O4LA 5GGYA 4PCLA 4PIVA 5CB6A 1IB0A 2HFKA 1KMCA 2CJWA 3HY4A 1W0JD 1S4MA 3SHOA 1N9KA 1KYVA 1X0VA 1EJ6A 3O90A 1FFEA 1KH2A 2RGYA 3OA0A 3R4CA 4L5AA 3VR2A 4FVTA 3JZFA 4I99A 3L8EA 3UMJA 5EE9A 1PAUA 4IIXA 4DILA 4PX9A 1D1SA 4LBWA 4TRJA 1KZHA 4AUNA 3WB9A 2IXBA 1DXOA 4V02A 2PH7A 3AVXA 3SJCA 3IEVA 3AXSA 4XH9B 3GCXA 4WNIA 2PMKA 4PZAA 1IQRA 4LFCB 4Q1FA 3H4IA 2LWIA 4FHEA 3G9ZA 4BAZA 1MQSA 1JL3A 3PGKA 3FSGD 4HNRA 3SLKA 1L3CA 4PGAA 1HORA 8ABPA 3D5QA 5KS2A 1LJ8A 1M8PA 1QMGA 4RETA 1RYBA 5DB4A 1ECGA 4IJ5A 3L1VA 1JIJA 4LK2A 4QHTA 5JJKA 3USCS 3KM0A 3QEJA 3JX9A 4BTLA 1M34E 1U02A 4MZDA 5BXQC 1U2DA 2I76A 3TM4A 1XDGA 5F2NA 5AK5A 2HK6A 4A36A 2X19A 5B53A 4LWPA 3I73A 5EJAA 3WDSA 2NUAA 3L3BA 3FR7A 5JNLA 1N8KA 2C20A 5AXDA 3D7SA 2NQTA 2E85A 1GAEO 2RD2A 2PWZA 2RKBA 1SXHA 2PUDA 3WLHA 1ZGHA 4J9VA 2Q41A 5JNRA 3OKPA 4LJKA 5E7QA 2BFDB 4Y67A 3IT0A 3WNZA 4RD6A 1W88B 3KPVA 3PL5A 4ZVLA 4XFKA 2FHSA 5MDHA 5K0FA 5BYBA 3K2EA 1B43A 1LLQA 1TW3A 2AYXA 3U7IA 5FWYB 1XZ8A 4DMUB 1U6IA 3E61A 1T4MA 1QG6A 3OA2A 4CIBA 3OQHA 4BY9E 3ASUA 3IEMA 4PG5A 3UOGA 4DVJA 2CB0A 5HF6A 5KNDA 4IVNA 3RR2A 5B3JA 5IYZB 5JAMA 3I2FA 3KTOA 1JV2B 2XKAA 3AUAA 3DVLA 1KI3A 1KO7A 4TM7A 5G0VA 3GD5A 4QTYA 3A3YA 1I9CA 2PKWA 3KYIB 3I2HA 3TSZA 1VJDA 2DH5A 4ZXPA 3T41A 3O8RA 1YMUA 1A96A 1LUAA 3R6TA 1NN1A 1GTMA 2FMHA 5I8WA 1W6RA 1EG2A 2HBYA 3MK31 3RJ5A 1TM1E 3H2YA 3VKWA 4I8XA 1X86B 4HCJA 1M2OB 4US2R 4ZAWA 3KS9A 4OUDA 3S1LA 4ZZIA 3ORFA 1X7ZA 2OBLA 3VZCA 1L8QA 2AVDA 2CXHA 2NUBA 4Z0NA 5A71A 4DR1B 2X0DA 1WEHA 3JWGA 4A9AA 1FPMA 4B31A 4DG9A 4L8VA 3UAOA 5IKPA 3CVVA 3OZCA 4Z4GA 4TTQA 4LHZA 2HCBA 1PLKA 4WOKA 2HSZA 2XSZA 2QXTA 2XB6A 2ODAA 4GMXA 3PE6A 4QOIA 5TMPA 1FJHA 5MN5A 1SRQA 5B1EA 1J0EA 3AGQA 2AFHB 3DVAB 4C5BA 4HZUB 1XHEA 1D1QA 2H59A 4NH0A 2WQ6A 1LK5A 4MS1B 3IILA 4UTNA 4ZVUA 2HU2A 3GH3A 1DJNA 3FGPA 4RZUA 4GPZA 3HB1A 1CJCA 1J49A 1B8OA 2ZIUB 5FBLB 1Z4QA 1CG6A 5I7VA 1R0WA 2YXBA 3DZFA 4XJTA 5K20A 3GGCA 3L93A 3Q7IA 2YNMA 5BSRA 1GAQA 1I1QB 1QIMA 1W49A 2ERCA 2EEZA 2FSSA 2OCXA 3K4PA 1QS0B 2PLNA 2YS7A 3KWLA 4UXHA 3PJGA 4W63A 1X94A 5DSZA 4YT5A 3G7UA 3ESRA 5FBWB 2BKAA 2CLFB 2NYVA 5K99A 1E6WA 2PL3A 4FFOA 1UXIA 4L0MA 3T7SA 4DLKA 3PQ7A 2ID4A 4MYRA 3E8MA 3MW8A 4U0JA 5TSDA 2W22A 1ZUNA 2Z2YA 3E5MA 2X1LA 3IDSA 1NP6A 1Z0DA 4Y2GA 1UZMA 2ID7A 1SVMA 3NUQA 3I6QA 4PX2A 2A9OA 3ADDA 1NBHA 2AK3A 5IC6A 2UVPA 2GFHA 1TAGA 4C0QC 4EG7A 3OFSA 3NXSA 4RFSB 3SM3A 1PL8A 3VU9B 4OLJA 1P2BA 4KXLA 1BKDR 1AV6A 3FOFC 5IJWA 3U4QB 4V2UA 3AINA 1KFKB 1A50B 5LCXA 1CJKC 1T4CA 3BRWA 5T6MA 2GA9A 2XX3A 3VH2A 4B17A 1YI8A 2LV8A 5JANA 4C78A 5BSWA 4L4XA 5IKMA 1GFIA 1VDZA 2QAGA 1G5FA 1X7WB 2ZRQA 1OGJA 2UZIR 1AGNA 4P7FA 4BX2A 3DH0A 4TMXA 1NQAO 3NX4A 3RRYA 1K1EA 3UWPA 3KXDA 2C07A 2CHFA 2HREA 2NZWA 3CXUA 1MO3A 4EA6A 4IRUB 2DBRA 1G9XA 1R6AA 4P4SA 621PA 1JDZA 2JJ2D 4B74A 2W6IA 1NYTA 3CEAA 1A9YA 3NPAA 1R27A 2OZEA 3U3MA 3V2GA 3OY2A 3MILA 2AOUB 4UHFA 4FE3A 2ESRA 5CVVA 4I5DA 4Y2PA 3WTCA 2XH8A 1DO8A 3FMVA 4ZANA 2Z9CA 1PFQA 1V1JA 4MQFB 3ZDXB 2J9ZB 2ZT7A 1A0OA 5T4BA 4L73A 1NUQA 2VJCA 3L01A 1YE8A 1YJXA 3EXHB 3LP6A 4CQNA 5HUHA 1L6IA 4HB4A 5F35A 5A4IS 3AW9A 3IP9A 1A5BB 1D1PA 2PBZA 3O8DA 1ZM7A 2F48A 2VDQB 4FMCB 3TDMA 4C89A 3LX6A 4EVQA 1MW8X 3FTFA 3CVJA 4PG6A 1NE7A 1XN4A 3N87A 3BHNA 4JOSA 2I2FA 2JFYA 3P1JA 1HWYA 2GX6A 1MW9X 1GKIA 2FMKA 3G1UA 1YQTA 3K15A 4DSNA 4EFLA 5LJLA 2EWWA 4OA5A 1OFVA 3RWBA 1NR7A 2IYYA 1ZS9A 2FPRA 5EZYA 3W6PA 4O2RA 4PHTA 1UK9A 4MKRA 5JSZB 2CVHA 2V65A 3IOEA 5DMHA 1ZH6A 3PTAA 4NSNA 3EF1A 4DLRA 3QLJA 2G5PA 1MO6A 4ENQA 3EXHA 3TB6A 3LTEA 1S7CA 4EPYA 2XYRA 3G9XA 4IHJF 4TVKA 1N9GB 1QOPB 1XRNA 1DBPA 4BNHA 2G9ZA 2QG9A 3CM0A 4CR6A 4D0RA 1ATIA 1QOZA 1VXOA 1J9GA 2VUUA 5K0TA 2Y71A 2BZSA 3GLRA 2WUFA 3E3NA 4FD2A 3VMMA 3GHYA 5DFAA 1U4OA 2JLAA 3FZQA 2C96A 4Z7QB 1IJKA 3IIEA 1KAQA 2UYQA 3WK7A 3OFVA 3ECCA 1W19A 3SXPA 1KXZA 2N75A 4ZA2A 5IDVA 3RVQA 4JL6A 5TIIA 2PUWA 5EQDA 2R48A 5BT9A 2IYTA 4JJGA 3OLYA 2HF8A 4JT4A 1DJOA 3TTWA 5I7OA 4MGKR 1I13A 2FW9A 5BWNA 4Z49A 5B6JA 2PKQO 3AJDA 5EYPB 3V4OA 3UWMA 3R3HA 4D26A 3C39A 1RWBA 3RTAA 4HMQA 2NYRA 3AHFA 1E1CA 1G20E 2HQ1A 2WVAA 4GUAA 2VWQA 4BUJA 1QHSA 2JFXA 3HXPA 3Q41A 4OK5A 4OUDB 4XCXA 4ZCSA 3PNYA 1T0JB 2O2XA 4NWIA 2B4QA 2WUDA 2HA2A 5K3SA 2XIQA 3Q7PA 4N8DA 3U7QB 4DNFA 2UU9B 3ILVA 4U3JA 4CEIB 1NG1A 3D6UA 2E6KA 2Z09A 3RRZA 4BJHB 2Z8YM 5HQ3A 3CVOA 1UPXA 2RK3A 1PJRA 2V8OA 3EC1A 2D8MA 2NP6A 1VKJA 4R0MA 2FX5A 2DFLA 3N8NA 3R7SA 5IZCA 4FOTA 1QZUA 2PAFA 4KXXA 5AR1A 4BVJA 3AUYA 4CIAA 1XD8A 1L5KA 1NOKA 3DWIA 2RGRA 3FZNA 4G26A 4XGIA 1I3KA 1VFNA 2F1RA 3BE8A 4AJOA 1QF6A 3AP2A 1E66A 3QKSB 3NUZA 2ENUA 3N2GA 3IIIA 1PT9A 4YV0A 1J4AA 2GTHA 1TCVA 4M46A 5DLDA 3SC2A 3FWHA 4ZC1A 1PK9A 2XE8A 2ZB4A 3MBKA 2QIOA 2Q2WA 4MDYA 4OGLA 2DFVA 2WJZB 3MLEA 2HUNA 1YJ5A 5KYYA 4DNXA 1GYRA 3Q2OA 3Q3GE 3AHDA 2ECKA 2IYZA 3WKAA 4ALLA 4EDFA 5DISB 1L8AA 3WAJA 2GJSA 4DL9A 3L1IA 1ABEA 1PI3A 2GZAA 1RCFA 2PH5A 3NAMA 1P4SA 1J7JA 1P2DA 3A04A 4OMCA 4ZAFA 4CKBB 3R0JA 4HH1A 4D4HA 2P4HX 1OKKD 3PDWA 5JH7F 3PLRA 2BFWA 3KLOA 5GONA 2V5VA 4OHFA 4TWRA 5HDQA 3VOSA 3UJDA 2GJ9A 3JQ7A 3COVA 1TQDA 1E1CB 3NBYC 4DLZA 5KOYA 5FEMA 2RGUA 2AZTA 1NIPA 1NQTA 1V1MA 1L5QA 1KSFX 3IVAA 4JLWA 4UHEA 5FPHA 2D0DA 3UPUA 4L1KA 3VHQA 1M1NB 5LQDA 4BNTA 4LSMA 1OXMA 3O8OA 1PRYA 3KOYA 2PSDA 1U98A 4YR9A 4ZVRA 3OBIA 1P5HA 3RROA 4CMAA 1Y7PA 1J2EA 5JECA 2X2OA 1NN3A 3QPDA 1B6GA 5F5NA 1I2MA 2OHXA 2ZTVA 5GAJA 1RAAA 1U2RA 1ND6A 2J30A 4MGEA 1AK9A 1U9IC 3SC3A 4UBLA 1M8KA 1IBLB 3FKJA 3D4IA 1W8IA 1FJGB 2VSQA 3A1UA 1L5HB 3WRXA 2HCTA 1YJ8A 1GPWB 2AFRA 3PDCA 2R6DA 2M1ZA 5YASA 3B3GA 2PUAA 1JAYA 1WY5A 1YDWA 2QTVB 3D64A 3L40A 3QGMA 2Y99A 2GB4A 4B6EA 1U7TA 2YXLA 4G0XA 4DLYA 3GPDG 4FP9A 2AW3A 2WMNB 2AJCA 1A9XA 3WMRA 1DCFA 3I5UA 5K0JA 1Z73A 2PRYA 3HWX1 5COAA 2ZJYA 1MABA 3QMMA 4FNAA 4H0CA 4Q3LA 4ARCA 3FFBA 3LZ6A 5E2IA 4HXYA 1M34B 4J75A 4A27A 1RBQA 3IJPA 1XRJA 1T1RA 2XCLA 3F3MA 1N6NA 5AI0A 2H0QA 1YFJA 4DLPA 3IALA 1Q12A 3CISA 2NO7A 3T9FA 1TOAA 1EK0A 3KQSA 2PYZA 1MG0A 4H7KA 2CBXA 2WIFA 5SICE 1ZOSA 2VT2A 1OILA 2A5LA 1EDBA 1CY4A 2X86A 3F4LA 5ALMA 4OX9B 2VAWA 4OUKX 4R54A 4L6IA 5CLIA 5ALQA 5K01A 3OPQA 2ZYSA 4XLLA 5TXGA 3WNBA 5E6RB 2F1JA 3FDIA 3M9XA 4NICA 1O94A 2GI4A 3MS4A 5BQ3A 4LJ9A 3KAKA 4RANA 5CMLA 1Y82A 3V4ZA 1VI2A 2C00A 2FPMA 4D1YA 4RA9B 2OV2A 4HN4B 4BVFA 2NSLA 1ZGCA 1E89A 1OTXA 2CB9A 3OJWA 5FNVB 3BAFA 2QRNA 3T94A 1F5SA 3ITKA 3PNKA 5CURA 3PXUA 3VRHA 4E22A 4GPEA 2VT6A 3C7KA 5I9NA 4WINA 4QXRA 6Q21A 5DYGA 1G41A 1YQDA 3GCZA 1P7ZA 4ENSA 4L2IB 2H4YA 1PSDA 2BI7A 2J3KA 5C8DA 4MRPA 2GO1A 2QSYA 3NT5A 2DWOA 5CEEA 2IBSA 2IHUA 3STHA 2QE6A 3U17A 2I1WA 4EG6A 5ALDA 5KYTA 5LU9A 1ZI9A 3AW8A 3SSAA 3H0CA 4RDXA 2O5RA 3HZRA 3Q5GA 1NY5A 4TT3D 3NEPX 4OY3A 2WG2A 3ZS8A 5EIBC 4IF6A 4IO1A 4MWGA 5CDFA 4L4SA 1KEZA 3SVLA 4CV2A 1ZAKA 3SC6A 2QTHA 4B2LA 2XODA 4X1KA 1H94A 5KEIA 1P4AA 3EZNA 2MINA 2JNWA 4N48A 4BYGA 3QUAA 3WHKA 3ZOZA 2VYCA 3AI1A 4R8KA 5C46F 3GRYA 1TA9A 4M83A 5E4YA 1M0EA 4JJEA 3ICCA 4QJBA 1PVDA 2O2SA 3HDTA 4W9NC 2D6FA 3K8OE 1C9NA 3MTAA 3WI7A 2IXGA 2ONKA 4DV3B 4XQ0A 2ZR0A 1SWVA 4IXWA 2YVAA 3EGVA 3F5DA 4Q05A 2EATA 3EBLA 4I66A 3KP1A 3V42A 3F49S 2R44A 5A1JA 1HTBA 1G55A 2OXFA 3HGMA 3MTBA 3CPJB 1N2JA 2I80A 2NGRA 5DHQA 1R50A 3WLIA 4CMBA 1R4ZA 3LHSA 2JI4A 2WIDA 3HSKA 4K28A 1F8YA 1JQJC 5BNFA 3RQIA 5AXBA 4YRIA 1FFAA 4ENUA 5D3QA 3JQ8B 4ILEA 4L3VA 4LTNA 3D6VA 4EUSA 3KKLA 1F0KA 2GK4A 4CG0A 3OHPA 4DDHA 4BO3A 5F7XA 4LVNA 1O9HA 1CDOA 2WJVA 4C6RA 3VOAA 3KEMA 1OH7A 3IV7A 3D3KA 3E9DA 4YDRA 5LDHA 4QDTA 2GN4A 4L2IA 5AKEA 5A4JA 1V5EA 4Q1BA 4Q4AA 3WGUA 2FDXA 4LCEA 5JSHA 3AUJB 1IY0A 1A5AB 4QJ3A 3B89A 2X1HA 2SECE 4FYXA 5EZQA 2I6TA 1XDBA 1KI7A 4OQZA 5J43A 2COUA 1U2EA 2WM8A 2FPUA 2JJ1A 1UMCB 3DBOB 1G19A 4DW8A 3TJZA 5LXTA 4YROA 4PYOA 5JCJA 2OSVA 4ZOEA 1QGAA 3MM4A 1ULBA 2B8NA 2H51A 2ADOA 4N0EA 4EJ6A 4QYSA 4YCSA 4CQLB 3OE5A 1XPJA 5IFLA 2HT6A 4ZXFA 4B9EA 3DFFA 3ZK9A 4EM6A 1BCRB 3VHLB 4YJ3B 3LQKA 3B9PA 4K1LA 1XPOA 4GSYA 2ZAYA 3RUCA 3P26A 2JAQA 3P52A 2G28A 4TMWA 4EI7A 5FIUA 5EQJB 2C2BA 2W8BA 1HRKA 4V3CA 3D1LA 3CW8X 1JU3A 2ADMA 5J5VA 4M88A 2JKYA 4B3JA 1FX1A 1T5OA 1J24A 1RRMA 1FXUA 3KVNA 5F7JA 2V74B 2W7TA 3UKOA 3FWZA 5HZGA 3EEIA 3KAQA 1C2YA 2ZAOA 3H9CA 3TLMA 1OE0A 1HSOA 1WXWA 3ABOB 3LCUA 4FMBB 4OQXA 2YYAA 2V45A 3A1NA 1LH0A 3FUWA 4U7TB 4AY2A 4QEZA 3OSUA 1YS9A 5D01A 3ZBQA 3E7WA 1UDCA 2ZAIA 3GJ6A 3UG7A 2Q3EA 2XVXA 4OXNA 4G37A 3ZDBA 1L4EA 1D0IA 1WCWA 3CKKA 3PJEA 2QQ5A 2I22A 4YK7A 3L07A 3NHZA 5DGCA 4LIPD 4HADA 4PQEA 1E2EA 4ZYVA 1YASA 1U8EA 1Z5GA 3JR7A 5I5EA 2NTNA 4LK3A 5JRZA 1VBMA 1ZONA 1JDBC 3QEKA 3DUWA 4JLMA 4BO6A 4DCSA 5IX8A 1G291 4IVPA 1YE5A 3VSAA 1KWKA 3OAAA 3VC7A 1Q0TA 1T5TA 4ZOLF 4JI2B 1KZYC 5DBGA 1XP5A 2VSFA 3QW4B 4K9MA 4RF2A 3M5CA 3OJFA 3GP5A 4AULA 5T3UA 3RFFA 2CFOA 3AEQA 3CN7A 3LLVA 3OU2A 2DVMA 2XYQA 2LDXA 3PE3A 5F51A 4AS3A 1QHGA 1Z5ZA 4C0JA 3NR2A 1VKNA 5JRDS 3ELYA 1U3TA 2OHFA 3BJIC 3PHGA 3ROFA 3SFTA 1ZRSA 3QPCA 4PXYA 4ARIA 1NDUA 3NYIA 3HUFA 4M86A 5JZSA 2C0CA 3R3XA 3KQQA 3RFXA 5CW1A 4F5EA 5FWXB 2X0FA 5JYCA 4KR3A 1P8JA 5DE3A 3W5VA 1XELA 2XRYA 3UK6A 2P9CA 2VDVE 3EGIA 2BGMA 4DZTA 4B1FA 2MSWA 4QBHA 3I01M 1DHRA 3K92A 4G0YA 3SN6A 4M1KA 4GOMD 1ZQ9A 5IVDA 1GQOA 1QVVA 1T0HB 5BPFA 2XCRB 1L0BA 2G82A 1QAQA 2JIBA 2JIMA 2QYHA 4DPKA 1R6BX 3LKDA 2QK4A 2JLSA 4GICA 4KGDA 4QG7A 3NV9A 4TX1A 3PGJA 1O54A 3ZGNA 3PEVA 1LBTA 4GHWA 4MV9A 1WETA 1GZUA 2P0EA 2DFNA 4K7JA 3EGXB 4D25A 1MX3A 1G38A 4MA4A 3GVXA 5EZYB 1AY0A 1T0BA 3T3NA 3KT8A 3KOXA 3GAFA 4J76A 1EGAA 1YI1A 1E9RA 2FG5A 4K6CA 2ZUTA 2G80A 4AQYB 1Z4NA 3DLCA 1KI6A 2VLIA 4RVUA 5IAAA 2XXBA 3WBJA 1MJNA 1UDRA 1YZYA 4UEJA 4B3DA 1N2HA 2PR7A 1VSVA 1NUHA 1F17A 2HO5A 3BMXA 1UKCA 3DOJA 2R96A 2BMWA 3SZMA 1V96A 5AW1A 4DR6B 2R6HA 1GD1O 2CNBA 4Q9DA 2OYRA 1CQJA 3WP1B 4IFBA 1MOZA 2KYRA 3P94A 2C3UA 4ARSA 3JQCA 3THYB 5DXFA 4GRDA 2G70A 3I05A 3QVGA 3N7TA 3T3EA 1DTWA 3N07A 3EJWA 3W3AA 1E94E 1YR6A 1C4OA 1R0BA 3BD7A 3FNRA 2FOLA 1HG1A 3A10A 3MWLA 1BX0A 3LZCA 5JWHA 4PG4A 4C0LA 3Q11A 1RXUA 2J32A 5H3CA 4DJFC 3IL2A 1V5IA 3QHPA 2WD9A 2VYND 3O8BA 1TUEA 4QPDA 5EZYF 4RULA 2BH2A 1T2UA 3AF5A 5ELMA 1II8B 3PFCA 3B1YA 4P08A 3LXXA 3GR6A 3S2SA 4L07A 2R6AA 2FEAA 1D2AA 1UBMS 2RJNA 2C58A 3D7MA 5G1PA 2F8TA 2Q5JA 2ZVPX 4K6HA 4AICA 1XE3A 5EJ7A 5DULA 1UC8A 2OK8A 4OB7A 3EIXA 5ALXA 5CIWA 2IDMA 4H35A 1XUOA 4ECEA 5KQLA 2FDCA 2OXRA 4UXIA 1XVUA 1R0SA 5D1NA 3WK9A 2RHBA 1TD9A 1YK1A 1YZQA 5IAKA 4KYTA 3TX2A 1HF3A 4Q3AA 3L5OA 3SDZA 4E5UA 1AOXA 2IW3A 1S4QA 1IXZA 3B3QA 3CLRC 4G56A 1RRCA 4DB4A 4K3UA 2J3HA 3GNTA 1MRNA 1WQ3A 1YCGA 4EFDA 1FMFA 4NCIA 3HBNA 3P9YA 3T7EA 4YV2A 3EIFA 4LHSA 1V6SA 4QEKA 2PX5A 2J6IA 3QIAA 3CCFA 4RABA 2RHGB 4K2AA 5A6VA 3LFUA 4NEHB 5DNUA 5EWMA 3O2NA 5H1YA 4XWTA 4BNZA 2PZMA 2GT1A 5ES4B 4IW3B 3RS7A 5FOTA 3VNSA 4NNOA 4EY8A 2HWUA 2W2MA 2P9HA 2PUTA 3GFGA 3HJGA 1K5DA 3K1JA 2VEOA 3QFTA 3MBOA 4FOPA 4BQIA 2E55A 2Q3LA 1Y3HA 2FPKA 3PFKA 3WL4A 1P7WA 4WY8A 4YCNA 4QT0A 1T6NA 1PVVA 2CLEB 1QLJA 2VJDA 3H7IA 5AM2A 1WD7A 4TV9F 3EQ8A 1GNVA 4YR7A 3GLGA 3AKCA 2WSSA 2VPQA 4IGIA 4Y1FA 2WNSA 3C74A 3UXEA 1IK4A 5H0IA 3VGJA 1XNQB 1D6JA 3D7LA 1L5SA 3JW8A 4PIMA 3RO7A 3U0VA 4YYZA 2XQIA 4QXQA 1A98A 2W43A 4O33A 4C01A 1YA6A 1XDUA 4PXSA 3TRHA 5L6LB 4IIJF 2A30A 5KDDA 1X0XA 2QSJA 3O5AA 4HDMB 1ELOA 5TX7A 4YRSA 3UMMA 4KCGA 4CKCB 3W5BA 1DC4A 4Q6WA 3NONA 2JFPA 1DCTA 3PEYA 4COKA 2P9JA 1KMHB 4KGVA 3GEGA 3HBFA 4XEHA 4LTMA 2D5AA 4YJHB 2IYSA 4PZPA 2JGLA 4J2HA 2IHKA 1PR3A 3F3SA 1U80A 4JHLA 3MEQA 1EJBA 3L43A 5EWLA 2HLHA 2NIPA 1L4GA 5AW9A 1IRIA 3KV3O 2HJWA 1XXHB 4GXTA 3DB1A 5FUVA 4OQMA 5CH3A 1E5VA 2J5KA 1YZHA 4Q66C 2PLRA 2IZ5A 2DUMA 2VA8A 4JXJA 4OKIA 4YFYA 4UE2A 3WL7A 4H16A 1BDJA 3DKKA 2OV6A 3G5LA 3AFGA 1GYQA 1YXMA 1UFQA 1XA0A 3QYFA 4L75A 3JARB 4XWYA 2EZ8A 3C97A 4KQIA 2ZIXB 3ENWA 5ADHA 4X1YA 1E3DA 1E9AA 5GWXA 3LT5A 4M8KA 4B3CA 2QG6A 1QF9A 2QUHA 1CZKA 3P0EA 4I4TF 2QVGA 4DIMA 4YVFA 4MJ7A 1H2FA 2GKGA 4PU0A 2ZYDA 4DJ5X 1S7GA 1XEXA 3H11A 4NL4H 3QU7A 5AKHA 2E37A 2OECA 3ZCSA 4KREA 4LMBA 1OV6A 1VBKA 3S40A 1QGUA 2W2XA 4E21A 3IB3A 4WASA 2QTTA 3WGTA 4NU0A 1MVNA 2BELA 2QE7D 3EGWA 2C7OA 4PV7A 4O6VA 2FE1A 1P1JA 2JH8A 1FP1D 1YVPA 1N2CB 3PC8C 4WCFC 9LDBA 1JKXA 5IC5A 1T9HA 4R68A 4JXXA 1RKVA 4G0PA 4IDPA 4EQ6A 4JGBA 1JFRA 1VCOA 1NW3A 3DT9A 2JL1A 3HCWA 4GZMA 4L9SA 2PPLA 4X1YB 2V7EA 1NHWA 2QN9A 1M9NA 1X9HA 1L5LA 2X3YA 2Z5FA 2YHIA 3JQAB 2YC2C 4GNRA 4IKEA 4JR2A 3ZWBA 1FYDA 2UYCA 1Z7EA 1SKYE 1WPXA 3L1UA 3PRHA 4HNSA 4LYHA 4CFSA 1O7JA 5IN4A 3LDUA 3L0CA 3IHTA 5DK4A 2O5CA 3K8QA 3QVSA 2LZ0A 1BDIA 3BDIA 2NVUA 1PTJA 1PW7A 1XC7A 3IUMA 4I46A 2H1CA 4LI0A 1OC2A 3LWDA 3SX0A 4A0SA 1A4IA 3E0XA 3H4VA 5IT4A 5LBIA 1U0FA 1TMKA 3W8FA 5DU2A 1RWVA 1MEOA 3ORYA 1KQPA 1LQUA 2CMHA 3IPYA 4RH0A 1U1CA 2P2YA 3OX4A 4DDMA 1KOGA 1WUTA 2ZIXA 3ZTTA 4OBEA 4MVJH 4YS6A 4BMDA 4ZCTA 2RMKA 2C3PA 5HRUA 5FAKA 3VA7A 2QR2A 4I3FA 4D80A 4ZDKA 4ZQIA 3AKYA 2VJBA 4BQSA 2WR8A 2YRFA 2ZYRA 3B5IA 4R7GA 5LP6C 2A0UA 3RKRA 1Z2NX 4HEHA 3WQRA 1UK6A 1XZIA 1Y1QA 3A8TA 4H7DA 1D2HA 5CBPA 4PNHA 5IXYA 1DJLA 4RF3A 4HQLA 1HMYA 5FQNA 3BD8A 3NEJA 4EYSA 5MF6A 3KEQA 1K88A 4XJSA 1DQYA 1ZLYA 5CRIA 2G9RA 4PYRA 4DG8A 3JASB 3KDPA 2NNWB 1RJDA 5JXIA 2YFKA 4IXMA 4HLNA 1BHSA 3TOXA 1Y33E 1XTPA 1FEZA 2G9VA 4OXIA 3V8EA 2ZU0C 3EOBI 2AQHA 1BHQ1 1SBYA 1X38A 4LDZA 3DBHA 4JUDX 1WUJS 4YT4A 5A9RA 3HZOA 5DO9A 2O7VA 1W5EA 3MA0A 4I5IA 5JYDA 1E6KA 4FDVA 3QYPA 3SX4A 4JLKA 4MUBA 1J20A 1M10A 2H1IA 5CUQA 4DR5B 4FLEA 3LBHA 4FS8A 1SA0B 2ACVA 4HB3A 3W05A 3T5AA 3QHAA 3I6ZA 5A5DA 1B16A 1WU8A 1Q57A 3IAM6 3IAS1 4I6GA 4KXUA 5KX5A 5MN4A 2BZ1A 2E87A 1Z5NA 1W73A 4LZPA 4YJ3F 3EE6A 3QTBA 3AM3A 3RARA 3VR5D 2O8EA 1V8OA 1XX6A 3PPYA 1UQRA 4L9RA 4LSGA 2ZR7A 1DINA 3VFDA 3A6LA 4AP6A 4DXHA 3OO1A 2GEVA 4L8GA 1U8AA 2V3VA 2ZUUA 4MKZA 4MQLA 5TJHA 4BLSA 2VBGA 3AB7A 3IUJA 2GRAA 1X1SA 1CETA 2P3OA 4DIUA 2R8XA 3EXG1 1MABB 2YJ5A 4J16C 1SVWA 5JPDA 2DHEA 2DSTA 3RYCA 4DMKA 2Y9PB 4QOJA 4FFBB 5C3MA 3LYHA 4GECA 3MNFA 4E31A 3VI4B 4URZR 4DQXA 1K5PA 1OAOA 1G2PA 2NACA 2ZSBA 1MB3A 4B43A 2ZRNA 1FP4B 4FFWA 3NH9A 1NFFA 1SB8A 4GQIA 1S01A 3OQ1A 3WHPA 3EAGA 2OCBA 5KX5B 3FXAA 2AFVA 5C4GB 1EI9A 1VL0A 1XCOA 2HPAA 3F1KA 2E82A 3RC7A 3V4PB 4G0UA 2HT1A 5ULLA 2ZXEA 4EHJA 3SQWA 3TZBA 3GEPA 1J23A 2BEWB 4I6JA 4D8VA 1H69A 4NYJQ 4C0WA 2CLOB 5JALA 3PHLA 3Q3JB 1TE2A 2AS0A 2HU8A 3MGCA 3WMEA 1EP1B 1RYZA 1UPCA 3W2IA 4LFAB 3HN6A 2BUAA 4PAWA 3ZNQA 1YF3A 4DCGA 2PT6A 2H11A 1UBOS 1XZCA 1UT8A 2FPXA 4G5HA 5BUCA 4M1SA 3Q8LA 3KYDA 4BCDA 4KK3A 2DFTA 1V9SA 4AZ0A 1ZICA 3NIGB 1BDMA 5FTKA 3H5VA 1TJPB 4RK1A 4WL0A 1IVYA 3GFVA 1JR2A 1VBFA 4RCVA 1JF8A 4TXLA 5I7WA 1TZCA 2FR8C 1ODTC 1A7JA 2TRSB 2ZWMA 4N3BA 3AFNA 3P9KA 2OYCA 4BZQA 1BROA 1X7WA 2XBLA 2WG1A 1RAGA 3STYA 4I36A 5DSXA 2X8BA 1Z0ZA 5KVVA 4XCQA 5C51B 2W0SA 4KBGA 3IC5A 4EABA 3AI7A 1JQAA 2Y6UA 4OHCA 5EHZA 5KOJA 3OOHA 1BWQA 1U8YA 3F47A 4ILKA 1B76A 5TT1A 2UZ1A 3B8EA 4JB0A 1EWKA 3ZDRA 4GE3A 3EDOA 1BOFA 3DVRX 3OKAA 4L78A 1YSCA 2CMFA 3LHFA 3OESA 4IOJA 4PAQA 5GTDA 1JR6A 2A1UB 2XMQA 2NWQA 3O03A 4KAAA 4N65A 4DIEA 3W8EA 3MINB 2EZTA 4LTDA 3ZH2A 2NVBA 1MJGA 4TMTA 4ZDJA 4RTPA 1V37A 1KETA 3STUA 5DTJA 1FSSA 1TVKB 2JBHA 3NBAA 1H8HA 1P2VA 3P71T 4OGKA 1BH6A 3MLAA 4JDPA 1UC4B 1BE1A 3SNHA 2B92A 3HYSA 3FKSA 4KDFA 5A9TA 3SGLA 3TFOA 2I29A 3K1AB 3V2IA 3THOA 3OO0A 1ZRMA 1NG9A 1Z8HA 1ZVMA 1NQUA 4UW9A 2OBXA 5AM5A 4FU0A 1NYLA 1S2NA 1NJFA 3G59A 4PX3A 2WB4A 3DEAA 1PWXA 4MUKA 4WQMA 5B5SA 2XTZA 3WWYA 1M75A 4WOPA 4KNVA 3BSWA 1JB9A 2Q4TA 3SYTA 4EMTA 4EX6A 5HJ7A 2FTKE 2IHYA 2P7IA 2H3EA 3HDVA 4F92B 3C6ZA 3KZMA 3JAWA 4UM5A 5CVUA 4JENA 5JTTA 4WWHA 1Y8QA 2PLAA 4AUEA 2RGDA 5AHRA 3QYJA 5CVJA 5AI5A 2Z0MA 2WLSA 1CQPA 1VI6A 1KGSA 3ZWPA 1QKKA 3RVPA 3UWSA 2UDPA 3RABA 5JAOA 4UU7A 3PUZA 4CXMA 3ROPA 2C54A 3JQQA 4LF5B 3AQIA 2YL2A 1N7JA 1HFKA 2FWMX 3IQDB 3PVSA 2GN1A 2HJGA 3PYXA 5L95A 3UPDA 4S1OA 3IOCA 1CEXA 1OMOA 1QBGA 1ZVKA 4QTZA 2J3IA 4XGRA 1CZNA 3GOHA 1NPTO 1T9GS 5FI1B 4PYNA 2AXPA 4C7JA 4YASA 3BUSA 5TC4A 2VJLA 3ILXA 4RC9A 3MINA 1E9VA 4KI0A 3C3WA 1FK8A 1KZ6A 1UKBA 2OCLA 3IH5A 4YTEA 4HDNB 1ZD9A 4TLEA 2B4YA 3EFBA 4JROA 4IJKA 4U7FA 4X61A 1J5EB 4BO1A 2C8VA 1R2QA 1RD4A 3RODA 3K9BA 4MGHA 3F8WA 5A2GA 1EX9A 1FDSA 1CKEA 2XCTB 5I3ZA 2ZWPA 3KNZA 3H8SA 5E4JA 3AR7A 3ZWYA 4EK9A 3AY6A 5ELXA 2WKWA 3V1MA 3KFVA 1XG5A 1L8LA 2WSSD 1XTUA 5ILOA 1KKLA 1N8NA 4DCPA 2AOTB 2R65A 5GM1A 3VYVA 3J7AC 5CCXA 2GWRA 2DGDA 2VDMB 4P2GA 1UPFA 4UUAA 1JHPA 3DEYX 4ZEOA 3S68A 1QIFA 3WKEA 1E1NA 3UPTA 5DBIA 1UDXA 1ZHFA 4EY5A 5K4HA 4GGOA 4B8ZA 1VSBA 5F98A 2AYZA 2EVWX 1FDOA 2B21A 3R4VA 4J90A 4RV9A 4CJXA 3WQSB 2YYYA 2P11A 1C1XB 1CVLA 5TNXA 4EHAA 1KOFA 1KIFA 4MAFA 1R0LA 1QQTA 4EUNA 1I3LA 2OHHA 1EEHA 4DMFA 4RWZA 1E1QD 1P77A 2V9ZA 5ALNA 4DHEA 2HW8A 3IVMA 1CDEA 1EFHA 1CY1A 2OOSA 3ZNNA 3Q7SA 2IS2A 2NUTA 3ISTA 3LUAA 1JPVA 3CSSA 2GHTA 4ZT5A 4HNVA 3QVLA 2JKVA 4R5HA 3T99A 2GA8A 4QDKA 2BTEA 1C3JA 3O3OB 3UUFA 4AXBA 1E3IA 3I4FA 1E4VA 2EHJA 4ZHQB 4BQPA 1UJ6A 2I4IA 5F9FA 4AMVA 1FDTA 3KV1A 4PYIA 1MRSA 4MR8B 1M2VB 3KQWA 5CT5A 4J4HA 3A1FA 2CVZA 2AMLA 1JYFA 4LRUA 3JQ7B 2AR7A 1L7AA 1U2ZA 1UDAA 2CLSA 5AW5A 2FWPA 1V4NA 5AHOA 5DYYA 3WTBA 2B37A 2MCFA 3A31A 3TD2A 1BE8A 3DTVD 3X3HA 4F9FA 1AC5A 1L7XA 2NYUA 5T6BA 3NM5A 2BGNA 3P2KA 3TTVA 4LV6A 2GEBA 2EJBA 2G88A 1CS0B 3H75A 3WGHA 4BDSA 1VE3A 4ERNA 1FP2A 1PR0A 1VG9B 5CYFA 3B7WA 3ZYCA 5TB5A 3LS2A 1OT5A 2M6KA 1DX6A 4YRJA 1B0ZA 1Q15A 2FB9A 3N76A 5CYOA 4PBTA 1XA4A 4O1IA 1L5HA 5AW8A 1NZJA 3IJ5A 1LWOA 4J7AA 4N18A 2C3YA 1KY4A 4JASB 4P7JA 4GKBA 1G63A 3F2IA 4QGFA 3UATA 4YJ2A 1C3EA 5KSZA 5C8VA 1NJGA 1FNCA 1NY6A 2ZRGA 3BWMA 4IDEA 4X0EA 2CF5A 4EECA 1W36D 2XF2A 1VG0B 2WIGA 3ESBA 1A9XB 2DWUA 1TRHA 2YV3A 4QPPA 1EWTA 2HF7A 4IGEA 1AN9A 3OC0A 4RD4A 4JC4A 3ND7A 1FYFA 4D98A 1BA3A 2BFDA 1ZVQA 4MV3A 5IKOA 1P1FA 1ZK0A 3S8MA 3KVOA 4OIMA 1K4YA 2BGRA 3IEKA 1E2BA 3MBIA 1E3QA 1VHJA 2J46A 4EB6A 1QV9A 2R84A 3PD0A 3VOTA 2PG3A 1KH1A 3HEMA 4E09A 3K0FB 2QRKA 4ZHQA 1L7NA 2L82A 4TZ0A 5CYGA 3GQVA 1JIKA 4G4GA 2O8VA 3QQ5A 1FQKA 4LQ4A 3JQFC 3QLVC 1SKYB 1T1GA 4K5QA 4QEDA 1OZAA 2OY0A 3WB0A 5C80A 4HH3C 1RXYA 1P9RA 3TB4A 2QUKA 2PJRA 2OZKA 2D1QA 5LUAA 3DMYA 4H7PA 4EGAA 1HFEL 1NI5A 5KNCD 2ZYUX 1OY1A 2OQ2A 3LF2A 3EARA 1VP3A 2ZSEA 4FR0A 2CXTA 3DPUA 1KDVA 5LQKA 3GLHA 3W8DA 3ZDQA 1Z12A 3V7NA 3U4AA 1QTRA 2J9FA 4MTLA 4X7RA 1T5BA 4P35A 4RK0A 4E03A 4L5BA 1PFUA 5KDOA 3KQPA 1IC6A 3RIYA 1EJ0A 1RXVA 3OCCA 1HYQA 1N77A 1BDHA 2R97A 2IW1A 3MTDA 3F67A 2NQ8A 2OC9A 3KC2A 3QF4B 4URHA 1TCUA 3A6GA 4OQQA 3DQQA 4C7XA 3IQXA 4DQVA 1KRWA 1QP7A 1QIHA 3CIFA 3GY0A 5FADA 4OI0A 3FPBA 4DSZA 3T95A 1VIMA 5AIBA 3HU1A 2EKDA 2X7XA 3V8BA 1N7IA 1OFIA 1RQRA 4WKCA 2ZWAA 3O6VA 3BMQB 4UEOA 4X8MA 5CXXA 4F4JA 4E3ZA 1EX6A 3PQ2A 1X2BA 1JI0A 1SPBS 2P1RA 4LXUA 3U19A 3L8MA 5LSAA 3BD9A 1EK1A 1HEIA 1V26A 1SQGA 3IUQA 4AN4A 3BWDD 3VC2A 2DM6A 2UUOA 4C08A 3PG5A 2VOJA 1WMSA 3RB8A 3UJCA 5CB4B 3NS7A 2P75A 4J1TC 3D4OA 5BR4A 5IDYA 2PX8A 2ZUVA 2R6ZA 5THQA 4MICA 3OG9A 4IYRA 4Y2JA 4UFPA 4J7CA 2H16A 2P5YA 4P7BA 4TL6A 3S7TA 4NCAA 1EHIA 2NTEA 5E8RA 2Q0HA 1UC9A 4BLUA 1JT9A 3QITA 3SAJA 1EDEA 2SKDA 1NSYA 3EASA 3A6FA 4RVCA 5BOVA 2AJLI 3P2JA 4UMVA 5HQ3B 2WTBA 3PGA1 3HKBA 1EBBA 3PB3A 3QWFA 2HYIC 2GEKA 4MO2A 4E1BA 1H2BA 5JI2E 5H80A 1EB8A 2BISA 2VQ3A 2EX1A 3L8YA 4UREA 5EP4A 5KIAA 1MAVA 5KOIA 1X42A 4QWMA 3IT3A 1KI6B 2A6PA 2WP8J 4XFJA 1V9CA 5D6OA 2V7QA 5ALOA 2CYBA 1Z7GA 4Z0HO 5C1IA 2WWVD 4YPVA 4FUTA 1RRPA 3G2MA 3HL4A 5E1BA 3U3JA 4JT2A 2OM6A 3DMTC 5DNAA 3B38A 5EKUA 5ESWA 2VPTA 1XRQA 5FLYA 3RBXA 4WK2B 3NOOA 4BMZA 4ZCIA 4W5OA 4PPQA 1P1RA 4V0ME 4WVFA 1CZHA 2YUIA 3STTA 3LKZA 4PQYA 4Y2SA 3E81A 3KG2A 5L3ZA 5KUTA 2E5LB 1L7QA 1VLHA 2XT0A 4N01A 2X15A 4PY2A 3WNQA 1O97D 3FAKA 3UB4A 3QYAA 3NT2A 4JIMA 1W93A 4WDQA 1Q2XA 3OZFA 5FTNA 3NRBA 5E4FA 2IVZA 4A8HA 4HBZA 4ISBA 3WRWA 4LC1A 3BTOA 3IAAA 2NUTB 4WXMA 2KQUA 2JB9A 3RRNA 3EH1A 5I47A 5C8YF 5EHXA 4GBJA 4DA7A 2OUIA 4CM4B 1MR3F 1WDTA 1M7GA 5DNEA 3UQZA 1GRVA 1Z37A 2OCGA 2R1VB 1IEWA 2I1LA 4TWIA 4UNSA 4Y2RA 4QZVA 3PCTA 4FYHA 4JBYA 4E0BA 3FX2A 2CMGA 4M0LA 5KYNA 1ZNYA 4UEKA 4I1IA 4YAUA 4B4UA 1BU8A 1P0MA 3RKSA 5K6AC 2CD9A 1YRYE 2GUGA 2H65A 3ETHA 3QXHA 4XVQA 1XMOB 4C6HA 2LP4Y 3E0QA 2PS9A 1GCIA 4MUYA 5ICFA 1L4KA 2XUQA 3AF3A 5AW2A 5IJ9B 4OATA 1JHQA 1R5NA 3D2CA 3GCGA 4BRUA 2XUGA 4FB5A 2Z8ZA 4U39A 5D3MA 2EC5A 4DLVA 5KTNA 1L1EA 4TWBA 3HI6A 3NU1A 1J99A 3MGAA 3R3JA 2QTWB 3HU2A 4PSAA 1X80A 4R16A 1KMQA 5ENZA 1EYZA 3SDBA 2HCJB 5J63A 4TVSA 1NP3A 3UAGA 2J31A 3CF4A 1CRLA 1DKLA 2AC7A 4X6LA 4YC7A 5AM4A 5K3DA 5KX5F 3NIDB 5IZ4A 1JECA 1NRXA 3EQ6A 3AETB 3VR6A 1W36B 3MYRA 1JEOA 2BFMA 2FOIA 3O4IA 4REMA 1CB0A 1ORWA 3KDAA 4PYKA 1O95C 1V7PC 7MDHA 5J2TF 4MGZR 3DEJA 2JRLA 2ATEA 3R5TA 1NNSA 4IWNA 3LUFA 2NVOA 2QLMA 4DLLA 1VQ1A 2ZU6A 1MGOA 5KREA 3TVTA 3GMTA 4ETIA 4DAEA 4W5RA 2EERA 2EGHA 3AF1A 4R01A 4B2IA 2I1QA 3T1TA 3TW0A 2PGOA 1G9TA 3ADOA 4F9TA 1JEYA 1WE2A 4YCBA 4L8LA 2A3RA 5IYZF 3PA8A 3T35A 4C4ZA 5FI3A 3DO5A 1UXKA 3FIJA 1M5TA 5JC8A 3EPJA 2P91A 3PX7A 2MYPA 4TS3A 1Z25A 4Q4LA 1EMDA 1SCQA 3PFFA 3S5UA 1O96B 1WDWB 3AERB 1V8BA 4GM0A 3RVOA 4RIIA 4KZPA 4A1OA 4CYMA 5ICSA 5BR8B 2WB2A 4JQSA 4HAXA 4YDQA 5LDDC 1P9OA 2B61A 1SUEA 4KO3S 3FTQA 3T9BA 2DECA 3EW9A 4XVUA 3H3JA 1O94D 2TMYA 2H1FA 5DN6D 1T4DA 4RMGA 3WFIA 2J1LA 2NUPA 1XL0A 4OXYA 1OH5A 2VHXA 1BTOA 4QDXA 4BX8A 2P6NA 3K9WA 2ECFA 9ATCA 1BVHA 3K4HA 1NWCA 3CY6A 4LMRA 2EP7A 1B8PA 6PFKA 1XZMA 5CLQA 1GTJ1 1PQYA 3E22B 3RF6A 1U1DA 5BSHA 2FMFA 3CNEA 3E48A 1OA1A 1LRLA 1Z6QA 2P68A 3DAOA 2VP3A 2V1XA 3P9IA 4TZTA 3RTBA 1DUVG 2HK9A 1JQ3A 3N6XA 1W4BA 1KYXA 2V0GA 4NCKA 2REBA 5G4LA 1P44A 3W78A 4GP7A 3A3PA 4QUDA 1MD9A 5JTUA 2FN8A 2WTAA 4YRFA 1XZKA 3BWXA 5K8UA 1US8A 1TKCA 5DHUA 1ULAA 2IF2A 3W9YA 5FBZA 2PD4A 4MV4A 2OQRA 3AF0A 2ATXA 3QEBZ 1LNZA 4JI3B 1DVRA 2ZI7A 3OQIB 3P5SA 1VG8A 1XAJA 2B78A 4UDXX 2O06A 2ZVDA 2GXAA 1GV1A 3I6YA 4AUMA 2Z1DA 3MCVA 2GZ2A 3E3OA 1YVEI 3K94A 1XV5A 4NBVA 4X65B 3GLFB 3FHOA 4DWVA 1DQSA 3WNVA 1D5WA 4ZI7B 3UC9A 1DKUA 2WM2A 3IMGA 4D6XA 2HQSA 2PUVA 4EB8A 5H9WA 5L4NA 1VP9A 3FCEA 3DM5A 1GAXA 3A4MA 2BBTA 1KNXA 5FTMA 2OSBA 3VUEA 3DLPX 5B1DA 5BRAA 1QCZA 4CCYB 2I8LA 1KA9H 1UFKA 2D06A 2OKGA 4HNTA 3VSCA 4BJ5A 1EFTA 4N0MA 2I03A 4K0RA 4OJTA 2QPAA 4E6EA 3LDGA 1M1YA 4G1MB 3PP8A 3UBMA 2ZW9A 3YASA 1YR7A 2V4ZA 1UT6A 2WE7A 2HNKA 3A36A 1OX4A 3D2LA 3M6IA 2ZT8A 3PFGA 5I5GA 4C0SA 4D92A 3FNGA 3L8DA 3ZCTA 2AA3A 2F64A 1YE3A 3V00A 2FQQA 2BEJA 2FZGA 1KRHA 1GN9A 1YAJA 1KR2A 3AH8A 4MUFA 4Q9HA 5EL0A 2GNOA 2JC3A 1L7PA 4I5GA 1PJBA 2F3TA 1Z8NA 2ASVA 3KEOA 1AKRA 3OT5A 5D6NA 2Q7OE 1KYYA 2C4NA 2FG6C 5FCDA 3RVDA 3TTXA 1C9DB 4D7AA 3LQRA 4ZT7A 4HEA1 4EF6A 1F8FA 4INZA 4MCJA 4N3GA 4E13A 4DYVA 2GBIA 3O7WA 1CQIA 3IOYA 4J0FA 2OZVA 3AR9A 2IUUA 5IANA 2XDAA 2EYQA 2GZMA 3GLSA 1M2WA 1Y8AA 1PWEA 1TD1A 1R5JA 3L4BC 4NR0A 3T1QA 1LA2A 4JYZA 2XKJE 3IDFA 3C2QA 3ILHA 2ES4A 2DOKA 2KI5A 4G01B 5FHQA 5T67A 3TE7A 3VVMA 2DBVO 1LBSA 1PFWA 1HE2A 2FV8A 2X6TA 4IIYA 5LA6F 1NVMB 4Z1MD 1RMYA 3IBSA 5HW0A 1K06A 1P31A 5JVDF 4G4IA 4Y9TA 1XRSB 2QYTA 4LV5B 1JR3D 4D8YA 3S8YA 1U0LA 1AQYA 3H19A 1QDUA 1AZWA 2BSAA 3L7KA 1IOVA 1E3WA 2O07A 1ECJA 2XT6A 4X71A 3V80A 4I1SA 1Q22A 1QG2A 3AJ8A 1KYZA 1Y80A 3ENQA 3KHSA 1U2GA 1NFQA 3N2KA 3F0TA 5ES3A 4LC9A 3FLAA 4QLBA 2R0QC 4LXYA 1Q74A 1R0ZA 2L18A 1D2RA 4XZ3A 3ID6C 1PVOA 1XJWA 4PYMA 1BXRA 4URXR 2AVNA 1KQOA 1LRKA 4K6KA 3CLKA 3ISJA 4M9QA 4OJYA 4EZBA 2A9VA 4UQPA 2MMGA 3DEFA 1F7UA 1F2DA 5LIPA 2F90A 4GXRA 4BQQA 4AFNA 1J7KA 3NEAA 5EWLB 1IJBA 1DADA 1J8VA 1JRLA 2WA1A 4ARAA 3MSXA 5JCXA 4A0HA 2VSXA 2YJNA 1BXZA 4JBGA 3VPXA 1UK7A 2RCNA 2QAGB 1U31A 2ZRMA 3FFTA 2JASA 3BDVA 1NXVA 3QPAA 1XZBA 221PA 4WCFB 4P80A 1IN8A 5GVRA 3L4KA 1E62A 1QB8A 2Z30A 3MELA 3KFXA 3MTGA 5F76A 4PO9A 4D9NA 4KR6A 2YFYA 1QZTA 4RHXA 3TX6A 5DKFA 1YJAA 1OHHD 1H0SA 4HD8A 4MLZA 1Q50A 4QU5A 4BZWA 2FSUA 2GZSA 5C3UA 2XD4A 3CA8A 3NGMA 5BYJA 4AAYA 4D99A 1RPJA 5FBKA 2MSNA 2ONYA 2PTHA 3P32A 2BBOA 4RJKA 3VKUA 1TEZA 1V8DA 2AHRA 3H0EA 3B2NA 4WZZA 1QZ3A 4DZZA 1A97A 3U9SA 3LNCA 4QBIA 1H65A 2YW2A 3PC8A 4WCFA 4ZOLA 3PYLA 1M72A 3VX4A 4K8RB 4QOGA 2R5NA 4FYVA 4KACA 4RZ3A 4HS9A 3NH6A 3O4HA 2B8JA 2BE9A 3AO0B 4TTIA 2G17A 2YWBA 2O59A 1UINA 2I78A 3BQNB 2NSHA 4I4NA 2AOTA 4FSXA 3RLIA 4CQMB 1TAQA 4P58A 2VHTA 1I7LA 1GNQA 4AECA 4OQEA 3I52A 3PXGA 1GVHA 5EGNA 3JQGA 5G4KA 1W0CA 3SHVA 5AO9A 2Y1WA 4RY0A 4ZVNA 3P9QA 5AK6A 3WE7A 3S55A 4D9HA 4ETNA 2FMUA 3OTQA 2F7SA 3PJRA 5HRCA 2BFEB 3P0HA 4GS5A 5THKA 2DQ4A 6ADHA 1MH1A 1RJ9A 2POCA 4HNUA 5EPUA 5TQVA 3H42B 2VH1A 2VP4A 3MOIA 5HQTA 1NBMA 3P9PA 1V43A 1BC5A 2GN8A 1RQNA 2WMYA 4Q9AA 1IG0A 4CL2A 4YB8A 2R7KA 2YX1A 3JYLA 5CNIA 5G1OA 1UWKA 2O5EA 2MU1A 2AI3A 4YCAA 1JX6A 2QVYX 7AT1A 1QHHA 1CRWG 4WXPA 1KJWA 3DD5A 1C7ZA 1SXJA 4CODB 3R3VA 1AHHA 4KEAA 1EP2B 1DTSA 5K0EA 1ZRNA 1SULA 4GI1A 2RONA 4QSHA 2Q3MA 1O6FA 4GGMX 2UZ3A 4G5FA 4UBIA 1ZA1A 3LE8A 4MR7A 3DULA 1NXWA 3WHLA 2ST1A 1WR8A 3F96A 3EPKA 1SOAA 1MBZA 1V11B 3ROMA 3NP7A 3PT9A 1W1UA 2VT3A 3OP1A 1ZVJA 1T34A 1N5OX 1VCHA 3EEQA 4BNYA 3N74A 1OX5A 1DDIA 3L82B 4ZO6A 1G0OA 3M6VA 4RDHA 1NVUQ 1OFTA 4GEKA 2QV0A 4D0SA 5K4GA 1Q1BA 2JARA 4AVYA 4XYLA 4WN3A 5AW4A 2PPVA 1GZ7A 1G8MA 4KK4A 4G1CA 4WK6A 5IPFA 1KC1A 3OT1A 1ILEA 1NM5C 1FPQA 3IQEA 4IIDA 4MRSA 2IEIA 3L79A 4P5PA 3WJ7A 2JJQA 2NZ8A 3C98A 5TQ2A 4XGKA 3SFVA 4GOOD 4H27A 1YFLA 3AIKA 1NI4A 1VLVA 2E1RA 1JSLA 2FRVA 2AJ8A 3IX7A 3QU5A 1UK8A 3W2TA 4HZGA 3Q9SA 4JITA 3W3AH 3ADBA 3BXHA 4MWOA 2PXCA 3F1LA 2F43B 1V5FA 3G2HA 3P0FA 1Z5PA 3LFTA 2G7ZA 3QVWA 4F1KA 3AUXA 1VE5A 1K7FB 2KHZA 3U5TA 2B30A 3DTNA 4R1QA 3GGGA 5CLLA 1H6DA 3OEHA 2CCGA 1DXQA 1K8ZB 1SXJB 3MWDB 4NBTA 3DCYA 1N2EA 4NPHA 2J9XB 3U49A 3BWEA 2AWNA 4NFLA 1HZZC 3JVIA 2QXUA 3ESAA 5K3BA 5HUJA 1M2HA 3TZQA 2W93A 3OZGA 2ZANA 1FDIA 1P7PA 3OY7A 3MWGA 4LRSB 5ENVA 4C30A 4JR1A 3T15A 1CTQA 4C3ZA 2XXAB 2RHLA 1WCIA 2P6PA 1D4AA 2C78A 1U8ZA 2BEWA 1E7WA 2ERYA 3BK2A 3ML1A 3ZXUB 1J1ZA 1X87A 4XWGA 2H7VA 2LTAA 2AG0A 4ZOBA 1UBUS 1XYYA 2C9YA 1YZVA 3E18A 5DBFA 4J8PA 1NMXA 1M2JA 2IOQA 4S3MA 2IOFA 4BATA 2WNIA 4DJEC 1ZINA 2O1XA 4DT1A 2BM1A 1HDOA 4FYYA 2AE1A 5H4HA 3WLAA 4DM7A 4E5YA 1ECCA 4JNCA 3NTUA 4JFAA 5ECWA 4K9SA 2IYVA 2VXYA 3ZZ0A 1XU9A 3NHSA 4EVIA 5IBCA 4MI9A 3KUCA 1W5TA 3LCCA 5T3YA 5JAZA 2XUFA 4RVOA 3DG9A 3DM9B 3ZVRA 2EP5A 3WQHA 4HUQB 2R86A 3K70D 2GYUA 3MUOA 1KJNA 3L77A 4ZI5A 5JY1A 3L0OA 2VBFA 3Q5DA 5SZJA 5BN5B 4K0KB 3OPNA 3M6WA 2VP5A 4GO1A 3BIJA 2NXNA 2O7RA 3EN0A 4R81A 5DP1A 1D03A 4TYQA 4F6RA 2Y2UA 4RACA 4UBKA 3SR0A 5KVSA 2CK3D 5HCUA 1QX4A 2CXPA 2MSEB 3H7AA 3LG2A 2VJPA 2O52A 3T4PA 1Y7LA 5DHRA 5ALHA 3VKVA 1JH9A 4KRGA 4B0PA 4ARBA 4FDAA 1MJHA 1LJUA 2NU6B 2ZIZA 1RYYA 1B3RA 1U2QA 3GEEA 1YR8A 4Y0NA 3VO8A 3VZRA 4GBED 1V2HE 3UYKA 4HDOB 3IA2A 5KTPA 4FFSA 4Z3KA 3G8YA 3IUSA 5AKJA 2ZYIA 1YR1A 3AHJA 3I9LA 1GFWA 2E4YA 2WWFA 1LRJA 2WJWA 1T0IA 1WSDA 1CZUA 1DARA 3DL2A 4L27A 4EF4A 1RFGE 5ELLA 5LZ5A 4IZOA 1XQYA 2UZ4A 1QH0A 1TVMA 2OO5A 2V59A 3JARA 1E2JA 1O5TA 3BB1A 2GRJA 3F3YA 4FXOA 2GBFA 4KR2A 4QWWA 3OCUA 2FFRA 1WQ4A 2EIHA 3FAZA 3HN7A 4L57A 3BIFA 4Z3OA 3AP3A 3KPWA 5FLXA 1NF2A 2JJ1D 4K6OA 4WHMA 1YHYA 2EJTA 2M6SA 3U2QA 4DEXA 1KP2A 1SVLA 2R7NA 4HDRB 2O8DA 2X0EA 3DLTA 1A8SA 4C22A 2FVYA 2IIQA 2CLCX 1QCCA 1KEPA 3PUHA 2FGKA 4M0KA 4RM2A 1TA0A 2R7LA 3UH1A 1WPQA 1TB4A 4CUJA 3D5TA 2PKYX 1A77A 1YCDA 3KHUA 4LXGA 3UHOA 3N0WA 4GXNA 1N36B 4MVCA 3CN9A 2OD9A 1EVZA 1ODSA 1TNDA 3G0DA 3VDMA 5DTEA 3WWEA 2X9LA 1N2CA 2QPLA 4PVDA 4TMVA 1X7ZB 2FPLA 4H7IA 3LYAA 3RWMB 2IU3A 1K0UA 1E32A 1PZMA 2JBWA 3A9WA 4MRRA 4XDHA 1Z07A 3IESA 5H5JA 1AMUA 1ZD5A 5LMZA 1ZWLA 3OM0A 1XMXA 3BYZA 4ZAZA 2W6MA 3ZI7A 3KE8A 2VP9A 4RLHA 2AXQA 3OQBA 1SO8A 1LY1A 1RYNA 2VJYA 1TC1A 1CR1A 2PRJA 3L0YA 3T3IA 4LOAA 5KI6A 4YX9A 1CJVC 2DTDA 3GRPA 3DB2A 4WKBA 4CMEA 4F1JA 4O3MA 2NZUG 3A1WA 1Q3HA 3KELA 2O57A 1MA3A 2XOXA 5EPEA 3RSZA 1XEWY 2HTEA 2D5BA 3FBWA 3GJXC 2IXFA 2PRIA 3OWHA 4V1CA 5K8TA 5KYKA 1EQUA 3AP1A 1DZ3A 1MJGM 3FVRA 3NWBA 4TN5A 4UPDA 1KRXA 1U0GA 4OH1A 3VZPA 1E9SA 4PZLA 3NWJA 3KKOA 4I50A 1IXRC 3GV0A 1MB2A 1C9YA 5FB3A 1M8GA 3TCKA 4JR0A 3USZA 4FM9A 2QBYA 1QG4A 3HXTA 1PLJA 2A92A 3G68A 1HDGO 2BSQA 4URWR 1MC5A 5AJWA 1V5WA 2RKWA 1G16A 3OURA 1S2LA 4R2WA 3CWQA 1WPRA 4YBZA 1RS0A 4K6FA 3IAS6 4ZQGA 4AY5A 3PFIA 4FFVA 1GJRA 2HQOA 5ALFA 3SEQA 2ZS8A 2REQB 3EIEA 1EPUA 3DMRA 3UGKA 2AG6A 1FSPA 3AVTA 4JXZA 2OBYA 4Q19A 4DMCA 1H2XA 3D2BA 3FCAA 2P2SA 1CLUA 3BERA 4LS3A 1BFUA 2Q1YA 1E6LA 1GHTA 1OJLA 2W8ZA 1PLLA 2Z1NA 3MN1A 3M5PA 4KVAA 3ZX4A 4AYTA 4DA6A 4KQFA 1DQRA 3NYWA 2X5NA 1VHTA 3HUUA 3L0PA 4TYPA 3RU2A 1LQ2A 2FW8A 2R87A 1YRHA 2BMDA 3KYJB 2GJ8A 1A9PA 4NJEA 2BFCA 2FJ0A 1C3OB 3C4JA 3G79A 4L4YA 3FCYA 3RUPA 5HZMA 4EB0A 2VAMA 1RWNA 3WWZA 3ANLA 3RUIA 2P2LA 3ROXA 4D41A 1DOAA 2FMXA 1IHXA 1JNYA 3K6RA 1OZ0A 5AVKA 4YUZA 1JAIA 2QGZA 3A58B 3HGQA 4ZT2A 2C98A 4W6QA 3Q9LA 5BWBA 1SELA 3U9TA 2FEOA 3VPBA 1G1AA 2ARKA 1SOWA 2Q5IA 1P2TA 3GZNA 1X92A 3EUWA 1Q7TA 1VIAA 3LH5A 3TJRA 4ZRMA 1ADGA 1HA3A 2QGNA 2BHSA 3UK0A 4BC1A 4X66B 4B0OA 5H7XA 3O73A 5M34A 4IH9A 5AW3A 4CLRB 3U61B 3FNFA 2CSXA 4OKSA 2Z6AA 1HY3A 2ABWA 3O82A 2JH3A 4FN4A 4M4SA 3CKMA 1RYEA 2OR3A 4UAJA 2AK2A 1HMPA 3G89A 4PVCA 1QV6A 3A2MA 1ULHA 3LOPA 3WFJA 3AVWA 4MQBA 1PZNA 1ECPA 3PVZA 5T57A 1X8JA 4JBHA 3FPEA 4LV8B 4ZVVA 5TPZA 1NTOA 1J2UA 2D8AA 3WRYC 4LHYA 3LBIA 1KPIA 3GMSA 1JG3A 3NXKA 3W7AA 4UCQA 1G7RA 2VDLB 3ZLVA 1OFUA 4ZTUB 3R3WA 4JXKA 1QTIA 4EJSA 1BS9A 4MKFA 4HDSA 1NFRA 1A7UA 2VRCD 4HNHA 4QDJA 1F3LA 1Q84A 1CBUA 2CEKA 2N3ZA 3K2BA 4XPIA 3KEGA 3S4YA 3GLGB 4N4AA 4XQGA 2DUJA 4G97A 3PGVA 1UAYA 1J90A 1TZKA 4Z2AA 4A26A 3K0BA 3KR2A 3MZ0A 1GM5A 4BHTA 1RWKA 2ZI6A 1W581 4EW2A 3DTTA 3KJXA 3NOXA 3A6ZA 4MVJM 4BOYA 4IIJA 4OFXA 3WDLA 4DNQA 4EYOA 1LC0A 4FONA 1N5MA 1T3TA 2ORWA 3FPAA 4J07A 4X63A 2HDHA 1SHTX 1NW8A 1TEVA 2HNBA 3F9IA 3ZHXA 4JYMA 4EJSB 3HP7A 5DI3A 5IH3A 3T7JA 2M6LA 3K9HA 3CWCA 3OH8A 4KQ9A 2CBGA 2PMDA 3DBIA 1M8FA 3IKJA 5J9FA 4ZEMA 5HVNA 2FOXA 2VJKA 3BZBA 2JHFA 4W1SA 3E7DA 1THTA 5KDLA 2JHGA 3MG9A 4KO2S 2GVNA 3VQTA 5DHAA 2ISQA 3C8MA 2RGXA 3A4VA 3EVTA 4EI2A 4HWKA 4P3YA 2QR5A 1YMQA 2H2DA 2J59A 2QAIA 5JD5A 1YRAA 3FTCA 2JG3A 3OAAD 1WD5A 2R2AA 3BE5A 3VHRA 2PX6A 4OREX 3HYLA 3ZW7A 5HA5A 3TQHA 1OXUA 4RGBA 3NASA 4Q7QA 1TEHA 4M1YA 4Q4JA 1E1MA 1GPKA 2I66A 3VJMA 4E30A 5EKSA 5BVHB 3WIOA 1P4JA 2RK6A 3MC1A 3GPBA 1OYVA 2E4ZA 2DY0A 4IS2A 2YV2A 4NAUA 4UEWA 4W7SA 3SZGA 4YPOA 3HVRA 3QVXA 3G8BA 1V7ZA 3OJXA 1B8NA 2X1VA 4FDMA 4MWEA 4P92A 5HPYB 1L5GB 5DTRA 4JVLA 4CF6A 3C8UA 2ZDHA 1NYRA 2X4IA 3CKLA 2I7VA 1V2GA 4L7QA 4YXWD 5I7HA 2R2GA 5K8VA 3RBVA 1JLLA 5TV2A 4MPPA 3NI2A 4V1CB 2DBZA 5ADVA 1N6HA 5FX2A 1Y1PA 4D56A 5DM0A 1B4DA 4N5LA 3A11A 3GZTB 2J85A 5EJ8A 2X8WA 3EBPA 4UULA 3I6IA 2B99A 4Q3NA 2W6ID 1VHDA 4G24A 3DYIA 1O5IA 3P8ZA 2R5WA 2BGIA 2VF2A 3PSHA 4JL5A 4WNAA 3JAMA 4XX0A 2ZBEA 1QHHB 1X1RA 2JPDA 1P9NA 1H1LB 3LC2O 4IQ8A 3WLNA 3K70C 3O1HB 1J6UA 5H59A 4Y6PA 3K8ZA 3FDJA 2A84A 1IONA 4WJKB 4ZI7F 2ASEA 4U9IS 1MQ9A 3DMTA 1PU2A 4ROTA 2NPFA 1C5KA 1EVLA 1EM8B 3OIGA 4S0ZA 1E3WB 3VBEA 3EQ9A 2Z58A 3KT3A 3PQEA 1Z2PX 3ANNA 1F7VA 1XWWA 1QVZA 3B78A 3NBUA 4C05A 5JAIA 1XVAA 1OKKA 2VIIA 3TLAA 2ODTX 3MWKA 1ZOPA 1TQ8A 3S3TA 1Z2AA 3MB5A 1PT8A 4KE7A 1X70A 4F3NA 1ZN8A 4KQ6A 4UC0A 1L7BA 1AU9A 1W4CA 5A3QA 2C29D 4RNCA 4A8PA 3AFOA 3UENA 5K3AA 4YBRA 1D3AA 1E1QA 2BMJA 4DUPA 3AY0A 1IEVA 1RLOA 3RHFA 1H1DA 1WSAA 2BKEA 3BBPA 3L0DA 3IO5A 4F6LA 3C5WP 1X77A 4HPWA 2FK7A 3BWVA 5EMNA 2EYUA 2GM4A 2Q5QA 4HWTA 2H8GA 3AUSA 4KMOA 3TUJC 1RCUA 2G8LA 1G6KA 1OU4A 1NONA 5BWOA 3L7BA 1QFZA 1C8BA 2OE2A 3FDFA 4XUCA 4YMWA 5CA0A 2QW0X 1OGIA 5FLKA 1WVGA 5A5VA 5JJLA 1EFRD 3H8WA 1IHOA 5FWNA 4OSEA 4KFUA 2B5VA 3IMKA 2FPOA 5ALYA 4I4TA 3ZVMA 1MQ8B 3NMUF 2R8YA 1I5EA 3OETA 1J8MF 1JQLB 3CFYA 4XDYA 4Z1OA 2ZIWB 4INJA 5K5EA 1GU0A 1NYQA 3KCQA 3PGMA 4E11A 4PG8A 3HDHA 3DA8A 1JFVA 1O2DA 2RI1A 2OPHA 3C3AA 3ZY4A 3T7TA 4RAOA 2Q1UA 4OPMA 1QP4A 3ZHOA 2C0QA 5K1ZA 1L4NA 3ZE2B 4I3HA 4I8DA 2PBLA 3LCMA 3WYGA 5AVXA 3GNQA 5HKLA 1ZX1A 1GNRA 1Z83A 3WWOA 4C29A 3FPGA 3QXGA 3RU7A 4QOSA 5AUNB 1HX7A 1XBTA 1KK1A 1J2RA 3AX6A 1JHUA 2ZI3A 2YQ4A 4AZVA 5I4BA 4V0RA 4IKPA 4TUYF 1D07A 3T5MA 2PIDA 1WMDA 3U7EB 1KY2A 4RA9A 2WICA 4LECA 4H3HB 4W99A 5EESA 3NUGA 4AG3A 3DV9A 2J6HA 3L6OO 2Q4BA 4LGMA 2HWYA 1BCSA 3B9QA 2PDAA 4JBNA 3VU8A 2QW1A 3R7WA 4DLBA 4UHKA 4H4EA 4UFOA 4YREA 1WDKA 3UAVA 1ZIXA 4WXYB 1J8QA 1U5AA 2X42A 3MJRA 4YQFA 1CUSA 5K09A 1ULZA 5DTIA 3IP3A 5K0ZA 3V5NA 3OTIA 2ODNA 1NM5A 5L6MB 2CNLA 4UTRA 4QXAA 5E7JA 4IILA 3K96A 3VAZA 1QKIA 4H4DA 5F23A 4FHDA 2GGSA 2VLBA 1QO7A 1Z2DA 2DHDA 2ZYAA 4P4UA 3ZV3A 1ZN9A 2C4UA 1YJQA 3CE6A 3E05A 4XIJA 3ND9A 2PVCA 4L02A 1XMJA 2Y4OA 3ACCA 3L0IB 4MWZA 1UKVY 4BAUA 4KX5A 5T5QA 1N2XA 3IMFA 4B32A 4JU8A 3IXQA 1AKVA 4RZXA 5A4FS 1ADBA 1E2HA 1ORVA 4PE5B 4QXOA 1AS3A 1EE2A 3CLRD 5SV2A 1E9EA 2R9VA 3KXKA 2GBLC 1A4RA 1E1YA 4FE4A 2ZYWX 4TZ6A 2QTVA 3P4XA 1XDDA 4ZHQF 4J2TA 5EA2A 5B4UA 3HP1A 2I99A 3FGNA 3NVAA 3GI1A 4ND7A 2VYFA 4OQFA 5JCOC 2XOEA 1C9JA 3VR3D 4FYIA 2XUAA 3LDFA 3TQSA 3CLTC 1A69A 1VMDA 2YFHA 1NBEA 1N5DA 1GWNA 3P2OA 3FDZA 4BNUA 4D3ZA 4FHFA 4OAPA 1DNPA 3ORHA 3MRXA 3H1TA 3NNNA 1KJ8A 3AC0A 3M0EA 2BTOA 2D2XA 3GU3A 3OLXA 3FNIA 1B2RA 1USGA 4QOHA 3QI7A 4P86A 4YRDA 4F8EA 5JQGF 3I01A 1QH8B 5JARA 3MRSA 2VF7A 2MSDB 5F2KA 5BUQA 1MMFB 1HLPA 1QP8A 1QYCA 2J5BA 2WJ6A 2ZROA 2B98A 3C8DA 4HYEA 4Q5IA 4UM8B 4HTAA 1JHZA 3OQIA 4X54A 2HXGA 5EIBD 2ODQA 2ZATA 1VPWA 4L85A 2KLBA 4MS4B 4MUEA 4MW2A 1VLJA 5AIAA 4RKRA 4YA6A 3P0RA 4OXRA 4X60A 5C9ZA 1L4BA 2H1VA 3QE3A 2ZXFA 1R4MA 4B6FA 1TPZA 1T6BY 1TKAA 1J0CA 3IJEB 3JSXA 3PXXA 4OHOA 3KJHA 1W0KD 4XQ9A 4C20A 1CUGA 3AOEA 5C5IA 2PA3A 2P78A 5HFNA 4DA9A 3OZ7A 3BJEA 3EIOA 3ROKA 2FZ5A 1E6CA 4DABA 1I36A 1DKRA 4E14A 3EMVA 2F6RA 3K9QO 2FG7C 1ESEA 1P6QA 3H5LA 5KMGB 2JLYA 1SU4A 2IYEA 4EDHA 3KAPA 1VXRA 2M6RA 3G8DA 1PW5A 1QK5A 4IIGA 4R8SA 5LZ9A 1YR2A 2VQFB 4DMMA 2GM5A 4NAHA 1QC5B 3PTLA 1JDUA 3LL7A 1L1FA 5LQRA 1LZKA 3SMVA 4R51A 4W7IA 3OHMA 3TQCA 5ARBA 4DA4A 2GSWA 3COZA 4WZBB 3VH3A 4RTRA 3QRWA 2C9ZA 3FVWA 5JOQA 1KWGA 3FNBA 4LF8B 4M37A 4U8HA 5CB4F 1XHLA 3IT2A 3L18A 2Y1KA 2YIDA 1LCIA 2J7PD 1NURA 2QD4A 3FPKA 2CGEA 5ED0A 1VCMA 1GUDA 1Z0SA 1RU3A 4B82A 2BUBA 2VI5A 2ODEA 1HE8B 2ZCUA 2C61A 2C82A 2ZE5A 4LJYA 2O8CA 1CUAA 1E6MA 3RT9A 1LC3A 1NUPA 3Q0IA 5IVKA 3EFHA 1YK0A 2O3TA 1G4HA 5DF1A 1R88A 2Y0PA 1GLNA 3L06A 3FCXA 3LSYA 1H22A 4H59A 4WDRA 4XYBA 1JP7A 4HXFB 1P5RA 1I32A 4U6QA 3CRNA 3M1YA 1KDYA 5EZ5A 2XEXA 3E70C 3UJHA 3ZD9A 1C3XA 1QIKA 1WDMA 5K3OA 4RAQA 4IXTA 4NJEB 4NMHA 3ZKWA 1CJSA 3TK1A 1G0NA 4J49A 2IEBA 2PFKA 1FP4A 2BEVA 4HAOA 4GZ3A 4JSTA 3H5TA 1CE8B 5EUCA 5JVDB 3CF6R 1B8VA 3ZHTA 4F56A 2B34A 2FLWA 1BGVA 4JFRA 1QRTA 4I9FA 1AKWA 2QM7A 4QU0A 3V1YA 1U2GC 4IFIA 1DC8A 3LI2A 2VUSA 5AJYA 2BF4A 3OCXA 1DX9A 4H1VA 5LOVF 3Q6IA 1D6SA 2VK2A 2Z1MA 3OU6A 3U40A 3TG8A 5DLEA 2ZAGA 1UXHA 1A9ZA 4RVDA 5JCZA 3VR6D 5FUBA 4YV7A 2YJ4A 1W4LA 3SR3A 3ZE8A 1C4KA 2E49A 2IY8A 2OXCA 1P4GA 3ZKWB 4QUIA 5ICEA 4B6PA 1R9NA 4AZ0B 3ZDYB 1ADFA 1I1HA 1L7EA 3T1HB 4NP6A 2EBFX 2PWPA 2QJRA 2Y1FA 2DU8A 2XUPA 1EGVB 3LP5A 1QPZA 3DE0X 2ZPAA 2A59A 4H7JA 4KI7A 4H17A 1OREA 3O74A 3FYUC 1QIIA 1JEJA 2G5CA 1C8KA 1JEAA 2OUKA 3HDGA 3JD4A 3BKWA 1PSZA 3A25A 3BK1A 3GVIA 2P2GA 4M53A 4Z0TA 3SZOA 2Z56A 4C1NA 4G9EA 4P4GA 2IHTA 4FFMA 3MCUA 4CDMA 4A6PA 4EI8A 4OXKA 4PX5A 3A3KA 4WBNA 1KMIY 5AJZA 3BJRA 3EB9A 3SJBA 5MGBA 4HB0A 1W2GA 3F7NA 1WG8A 2RIRA 1NHGA 3KOUA 2CXRA 2C1EA 1OXBB 4FDUA 1J97A 3M83A 2I6SA 2FSGA 4R1OA 1FTYA 3WQBA 1NUTA 1K5HA 1BXKA 2OAGA 2W6JD 2YICA 2EFEB 2VEDA 3M4JA 4MARA 4NATA 1E4OA 2CLHB 3R9WA 3L8HA 3F98A 4BE9A 3FOCA 1CYEA 5AMXA 3F46A 1AK1A 4C06A 3OF3A 1EWVA 5ERYA 2EXXA 1PWYE 5KTMA 3H04A 2I33A 4QREA 3QSYA 5AKKA 1YZNA 4BFLA 4OGFA 1SHKA 2X2EA 5TEWA 4AF7A 3D4LA 2RIPA 2OHJA 1PR9A 1TFUA 1R3DA 4X8LA 1F51E 3AEKA 1IN7A 2PGLA 3X2EA 2VOEA 4FILA 3T5GA 1SOVA 1UF9A 1Y4DE 4E88A 4AQ7A 1USKA 2ZSAA 3UB2A 1RTTA 2QZSA 3HUDA 1GDTA 1IY1A 2PQ0A 1R74A 3JTMA 5GPBA 1RJEA 1G6HA 3P7MA 1U94A 3C3YA 4LQCA 3SI7A 3TMKA 2WAOA 4LJ6A 3D2AA 4D57A 3TRDA 4YCMA 1J1UA 1AKEA 1FF9A 3M3HA 4MS4A 3JPWA 2O54A 2C83A 1JJBA 1PYGA 3TPZA 1R4NA 4AWBA 3FTPA 1E69A 1MJ5A 1Z06A 3L6CA 3AFIA 5E38A 3WLQA 4E70A 4DR4B 4MW0A 2PQ2A 4JP5A 2ONCA 2I2DA 3C6QA 5JT1A 2A5YB 4BAGA 3VH1A 2AT1A 1A8IA 2VS1A 4Y1RB 4A8JB 1PNTA 4NRDA 3GJSA 5GONF 1X8LA 1AGXA 4RSHA 3NHKA 4RXTA 3RAFC 4ZCMA 1MVLA 2B5OA 4X6UA 1S8OA 1C0LA 2Q6LA 2VZEA 3B6IA 4PO1A 2J5RA 5GMOA 5JPCA 3PWZA 3GRKA 2PSFA 2O3JA 2JLXA 4OL9A 4BXOA 3RJ9A 5GV7A 3WGJA 5ESXA 3E2MA 1Z2OX 4BNNA 1KDPA 2QL7A 1RJGA 1H9AA 3DWFA 4BYMA 3GN2A 2AFIA 1KTVA 3QVJA 4KPYA 2DTXA 4NPCA 1PQPA 2AZXA 4XB2A 2G06A 4JP3A 2UUAB 3DDHA 4TQUS 4R71A 4O2AF 4RF5A 1YQQA 3Q6NA 5GJBA 1MNAA 2EL9A 2G77B 3CF2A 3O9MA 2PZ8A 5FYQA 3KSDO 4M6WA 4HH0A 3OU7A 2Q62A 1A95A 1CIVA 2QTFA 4OGGA 4ACBA 5B64A 4F2HA 2PD3A 2HMUA 4II7A 4M9SA 3DTVA 3V3KA 3KQOA 1JYEA 3W6ZA 4ZZ2A 4TWAA 1M2FA 2VPIA 3K9NA 1G20A 1N2ZA 4YI3A 4BO5A 4BE4A 4HEA6 2IS1A 1Z75A 2V96A 4U7PB 3PA6A 4CTOA 4OCZA 2WQ7A 3X1MA 3LBNA 2I54A 3QBJA 1LPAB 4QFDA 4XR9A 3VUFA 1U28A 1M6WA 3M3PA 2FUNB 2IPMA 2VH2A 2UV8A 3WSVA 2QNBA 4TXNA 4FR2A 2XE7A 1GCUA 3EEBA 1DAEA 3PXDA 4ZI2A 1LSJA 3AEYA 3M7IA 5BUZA 3NIFB 1V8PA 3QEOA 2GVDC 1D2NA 3ETLA 2V6IA 5DNWA 2C4WA 4DUZB 1FL9A 5JC1A 5JCJD 3NHRA 2CCJA 5BMVB 2H8KA 3QBEA 4NKRA 1TF2A 2E1PA 5BQFA 1W52X 4EFNA 1BJKA 2XQFA 3N5KA 1GNSA 2UKDA 2IYRA 4FC7A 4G0OA 4OH7A 2AEJA 3MWDA 3W77A 3W5AA 2WA2A 1GN8A 2V1UA 4PQGA 4RBNA 4BRZA 4ERXA 1QYRA 4LJ8A 1ZUD1 3SY8A 2D74A 2XHEA 1DEOA 4BVLA 2JFVA 5E9JA 2PT9A 2J0UA 5LXTB 1Q11A 4HY3A 2YOGA 1V1RB 3COWA 3D8BA 3LWBA 2J08A 3PXBA 2DTEA 5GOTA 4CETA 1ONOA 2WSBA 3C6BA 1DT5A 1REQB 3FCCA 4F7DA 3H2KA 2WF5A 4MV8A 3ZG6A 1T36B 1SD5A 3EIUA 1NQ5A 5LKAA 3G9TA 3FJ1A 5F7ZA 2OCKA 1DV1A 5I4IA 3JYPA 2HSGA 4R9VA 4LKRA 3WOHA 3EVCA 4C7OA 5J47A 2I6GA 2XWPA 2XOKD 4HO1X 2PA0A 1M6HA 4CM6A 1IAQA 1QR6A 1S89A 1TT5B 3RFCA 3CF0A 3I2JA 5H68A 1U7PA 1X9IA 3I9V1 3K32A 2Y0DA 4FXPA 2HYDA 4ABYA 3GFQA 4LI3X 3FPFA 3SX2A 4G5QA 4TTJA 5JEDA 3DVSX 1U9IA 3WLEA 1ORRA 1ISHA 4G84A 3ZQUA 1F20A 3DBRA 1E8MA 3UN1A 3BEDA 4R8RA 1KI4A 1OU0A 3E6AA 2OCIA 4RJLA 2GF0A 4EIWA 1D8TA 5BSMA 3CPSA 2G1UA 3VU1A 1NE2A 1W8DA 3OVMA 3PHIA 3PYMA 1U1EA 4HUQA 2FI1A 2OGZA 5CX4A 3COPA 3NIWA 1TMOA 2P3SA 3DOEA 4GX0A 5F21A 1BXGB 1KJQA 4CKEB 1N5IA 4OXQA 3OIUA 1I3NA 4TKUA 3WXMA 3Q4GA 4DC1A 1YB4A 1YBHA 1W59A 4JUIA 4NDZA 2J6BA 5C7LO 1DWUA 3EWNA 3OX3A 4F2DA 5J4HA 4EKIA 5KQRA 5JNUA 5AH0A 1C81A 2FWRA 4KB5A 5DCUA 4AZSA 3U56A 4IIFA 3HVKA 4Z6KA 3CLUD 1SVUA 4ZTZB 4GLFA 3WLJA 1RLTA 4NONA 2XRFA 4YRTA 2XNKA 4QFBA 1Z0JA 2XLBA 4YMTA 1ZO8A 3WR5A 4LYYA 1GSHA 5F73A 3U7FB 5EC8A 4HRAA 1VL1A 4R41A