1BD4A

Uprt-uracil complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
224
structure length
224
Chain Sequence
QEESILQDIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL PHOSPHORIBOSYLTRANSFERASE
publication title Crystal structures of Toxoplasma gondii uracil phosphoribosyltransferase reveal the atomic basis of pyrimidine discrimination and prodrug binding.
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Transferase
total genus 70
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 1998-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bd4A00
2IGBA 3H83A 1BD3A 1G2PA 2YZKA 4WN3A 5K51A 4P80A 4PFQA 5JV5A 1ECGA 4M0PA 1P18A 1GRVA 1I0LA 1I5EA 1XTVA 1LH0A 3OHPA 1QB7A 3M3HA 1A98A 2DY0A 4RAOA 1ZN7A 5HKLA 5ESWA 1ECJA 1I13A 1CJBA 1QCDA 1VDMA 3ACBA 1J7JA 1XTUA 3S5JA 5JSQA 5ESXA 1VSTA 4RANA 5BRNA 4RACA 4M0KA 5BQOA 4RADA 1DKUA 2PRZA 2FXVA 4OHCA 1PZMA 5KAPA 4P86A 2PS1A 5IPFA 1XZ8A 4P82A 1ECCA 1ECFA 3HVUA 1DQNA 1ZN9A 1NONA 3ACDA 1JLSA 3MBIA 3DMPA 1L1RA 4QYIA 4X44A 1OREA 1R3UA 4F8EA 1G9TA 4JLSA 3DAHA 4Z1OA 2PRYA 4LZOA 1WD5A 2VFAA 4WMLA 1P17A 2H06A 5HIAA 1DQPA 4MB6A 3O7MA 1U9YA 4JITA 1A96A 4P3KA 3NAGA 1DBRA 2E55A 4RAQA 3N2LA 2C4KA 5IAOA 1IBSA 3KB8A 1G2QA 1Y0BA 4LZAA 1XTTA 4FYMA 4RHUA 1QK5A 2H08A 2JKZA 1QCCA 4RV4A 1A4XA 3EFHA 5BSKA 1I14A 1Z7GA 1UPFA 2EHJA 2AEEA 1O57A 2HCRA 3GGJA 5BQPA 2XBUA 3MJDA 1P4AA 1VCHA 2WNSA 1A95A 3DEZA 3OZFA 4LZNA 4M0UA 1O5OA 4RABA 4RQAA 1HGXA 1D6NA 1OROA 1JLRA 1U9ZA 1STOA 1G9SA 1QK3A 1FSGA 2JBHA 5EUCA 1QB8A 1A97A 4IJQA 4RHXA 1HMPA 2JI4A 4P83A 2H07A 3OZGA 4QYIB 4P81A 2JKYA 1BZYA 1XZNA 1L1QA 1TC1A 1TC2A 3LRTA 1ECBA 4LYGA 3GGCA 4P84A 1W30A 4QRIA 1UPUA 1MZVA 1YFZA 3GEPA 3ACCA 4X45A 1OPRA 1I0IA 2P1ZA 1P19A 4LYYA 4RQBA 4TWBA 5KAMA 1GPH1 5E38A 1UFRA 4RHTA 1QK4A 4KN6A 1BD4A 3QW4B 1NULA 2GEBA 1DKRA 1A3CA 4PAWA 3LPNA 1AO0A 1ZN8A 1V9SA 4S2UA 4RHYA 3G6WA 4ZFNA
chains in the Genus database with same CATH superfamily
2CMFA 2XOKA 3RTEA 1LW7A 1OOEA 3CVVA 3MS7A 4WN3A 2A9FA 2OHJA 1HEUA 4CWAA 1BDBA 5IT5A 5EWMB 3X1WA 4YIHA 3QEAZ 3HZOA 4W1RA 4XE5A 1M3SA 3CPJB 5BNIA 3GT0A 1ZI6A 1JJ7A 2DPLA 1YKFA 3A37A 3MIZA 4F9EA 2AA3A 1VDMA 2VDLB 3AERB 3MCVA 1JWBB 3HKCB 4XZ3A 4YJ2B 5DYIA 1PI3A 2XZPA 3PGJA 4J1TC 4PTZA 4V0ME 3RPEA 4G0VA 4NZ9A 1CJKC 4RQTA 2CYAA 2B5OA 3OZBA 4G84A 4KW7A 3BRQA 5TC4A 4Q4AB 1GP2A 1AK9A 1H1DA 2ECFA 3IQFA 2Z6VA 2CKMA 3DVRX 3R3JA 5G02A 4WXEA 5J2TF 4WQMA 5FTWA 3L84A 1FFSA 4E5KA 3AL3A 4K0RA 4J29A 5E0OA 4UUQA 5F7OA 3UAGA 1SD5A 1C1DB 4L72A 3S1AA 3KSRA 4WIAA 3IPAA 1WQ4A 3QU7A 1WCIB 1ZIYA 4QVKA 4QSHA 3ANYB 3KPUA 2GJ4A 3VNQA 1N3BA 4M9ZA 3R7BA 3ULKA 3VM6A 2RGXA 3SDZA 1NC3A 1WOYA 1OREA 3ZIAD 1IZYA 3MD9A 3O21A 4O0MA 4IS2A 1KYWA 1HOXA 2FPPB 1VHWA 3KKKA 2F3UA 3MQ4A 3F90A 3FGNA 1O4VA 4TPKA 2BM9A 4AJ1A 1TFUA 3BK7A 1M1ZA 3RYFA 2HXGA 4M0EA 2J31A 2NNLD 4JJIA 3ZJVA 1PVDA 1G20B 1ACLA 3HEMA 5B3AA 3RRFA 1W2WB 3S7TA 5DH9A 3WP0A 1J2UA 4HG2A 4DV7B 2PSEA 1TQHA 1HYHA 3FMVA 4CLOA 1P9OA 2YL2A 3RNOA 2G5PA 4OHKA 4QD3A 3S1SA 2KHZA 1P2UA 2H2WA 4JBHA 1RYHA 3L92A 4DANA 4YRAA 4LF9B 4LDAA 2OWEA 2VK2A 1C7JA 1I14A 1AKYA 2VAVA 3ESBA 4FQ8A 2WE8A 3A1NA 3D81A 4KR2A 3N70A 1LZLA 3DOIA 2JGIA 3F7OA 4BB6A 4DC1A 4S1VA 2RHJA 2VDPB 4URZR 1E6WA 4NPHA 5CFNA 1B0AA 3DLPX 3TLEA 4D4JA 5KMGA 5KWSA 1M2OB 4JT4A 1MAUA 4C06A 2PMBA 2Z3VA 1T1EA 2D5LA 4HJXA 1M2VB 4H08A 1QGYA 4IHJB 1HT3A 1XMOB 2VL7A 1JHXA 1KDTA 4M1WA 3E9CA 2C2ZA 3ICWA 3QVKA 1L9XA 1RXWA 3AVWA 3RC1A 1OZAA 2PZFA 4ABYA 1XQ6A 4HNQA 5JH7A 2ZYDA 1HSZA 1U8TA 4YRLA 2NTVA 3EVDA 2A6PA 1ST3A 3LRTA 4TL8A 1Z17A 4OGGA 3AF1A 4P4NA 3GA5A 2ZWAA 1K9VF 2AFIA 4ZZ3A 2IOHA 1VJ1A 2LV8A 2BHNA 3ASUA 3E4CA 3G88A 1KVSA 1SH7A 4FKBA 1JZQA 4L0QA 2BDUA 4BAUA 3PB3A 2FFQA 4LVCA 1MB0A 4EBFA 1JN0A 5A1JA 1GYQA 3VO8A 3R2JA 5LUBA 2QTZA 1H1TA 1K8QA 3RTBA 3GLHE 3V8PA 4I08A 5D5PA 4QUHA 4BKMA 3TUZC 4OCZA 1VYUA 4BV2A 4ZK6A 3NTVA 3NCTA 3V9AA 3K09A 4ZYTA 4C1BA 2EV9A 3OEHD 5KJFA 2XOEA 4GH5A 4ID9A 5D5HA 1U1CA 5C4MA 2JHFA 2VVTA 2XQVA 4NNOA 4C78A 1LDGA 2HX1A 3MGCA 3ZDYB 4DDKA 1XYGA 5HOEA 2WTUA 4KBFA 1Q7RA 2FUG1 2GYWA 4EY6A 3T1HB 2RI0A 4FMCB 4Z4EA 3QXCA 3UJHA 1E7SA 3DE5X 3LPDA 4OIFA 4EJ6A 2XE4A 3PGVA 2B4TO 2OO5A 2E4YA 3DVAA 2W6MA 4D99A 1JQBA 1Y81A 4COOA 2QPLA 2J5RA 4PV7A 7ABPA 3V55A 4D57A 1VPEA 5JS6A 3UAYA 4DB4A 2CNLA 1IVYA 2DHCA 5ED4A 1ZXBA 2EXXA 3NBAA 3VJMA 1ZJ4A 1JG4A 3HU5A 4XJTA 3ND7A 4MEJA 4ARVA 3E53A 4X8HA 1XAJA 4JUAA 5LIPA 5LP6B 5DX8A 4ZMSA 3KQNA 5IAGA 1HT0A 2ZT8A 3ANXA 4W5TA 3HRKA 3DMPA 2POCA 1KJZA 2AXPA 3SX2A 4OJQA 2TSYB 1AV6A 5I7WA 1E66A 4G0QA 4Q4CA 4UZSA 1AD2A 1RRKA 1OD6A 4URYR 4RX1A 2OOKA 3A3OA 2QTGA 4OGFA 4OD0A 3RRNA 3PIIA 4N6OA 1H5UA 3R0IA 1AKMA 1CQJA 2PUWA 3NDRA 1EFAA 3OPYA 4J3JA 3PI6A 4C89A 5H02A 3DVLA 1OJLA 3GP8A 1O0CA 1V2HE 2FN4A 4PSKA 2ID4A 4MVJM 3IUMA 1CEYA 1BRMA 1U28A 4HN2A 4JCOA 5ICCA 1SVLA 4ARZA 2C1EA 3GLFA 3BF8A 3BN3A 3R3YA 3U7QA 4LZZA 4RK4A 4UOEA 4ZGGA 1A4XA 1LNQA 1Z4LA 3DLHA 3R40A 1ATIA 3A31A 3RGGA 4I66A 1F5SA 1YZQA 2RAFA 4ZJYA 3N7TA 3R6GA 1YR7A 3ZS9A 4UEOA 4BKPA 2ZT5A 1Q3KA 1FLNA 2RMKA 3EGXA 3OC0A 1IXRC 5FKJA 3OKCA 4AFNA 3R8XA 4LJAA 4D3YA 1H4SA 3K0HA 2C5BA 3AUYA 2P90A 5ALUA 1E2UA 2FMFA 3OESA 3RJZA 3W6PA 1VHTA 3OM8A 2P5YA 4YRMA 4RTOA 3ZJ5A 5GONA 4I1RA 5I3ZA 4UFOA 4C7OB 5IYZF 1IHYA 2B94A 4ISCA 3KAKA 4KK4A 5JG7A 2A7QA 2ZULA 5DM70 1V11A 3OPYI 1VYTA 4TMWA 1QIEA 3U40A 1SRRA 1J5XA 3CBQA 2I6UA 1SU6A 1UMBA 1QONA 3GA7A 4IO1A 3RJTA 2PV7A 3RJ5A 1A9SA 3NANA 5B36A 3RVOA 4J0CA 5E3JA 2QLJA 4FJ2A 3EQZA 3T5PA 2I6GA 1SXGA 1VMIA 2CV2A 1H3FA 1UPAA 4HFMA 4EPVA 2Q1XA 3N59A 4KIGA 1FRQA 3IVCA 4EF6A 3DO6A 3KALA 2XV1A 3PUZA 1SQGA 4MINA 4POOA 1XCBA 1GQSA 2WJWA 1ZUHA 2X4LA 1UP7A 3B3AA 3OIUA 4UM7A 4EUNA 4FYJA 4IJ5A 2JGLA 5DNVA 3PUXA 3KZ1E 4UDYX 2X0JA 4FBMA 3IMGA 3V1UA 2FMTA 1U63A 2C29D 3NBUA 4GYKA 3DULA 1TB4A 2FEKA 1H3NA 3ANMA 1GQQA 2VZLA 2C3PA 3D0OA 5IVIA 4CQLA 1C4KA 4FDMA 4TKUA 2VDNB 5JY6A 4QGGA 2INGX 3K53A 5DRTA 1WTAA 1LPNA 3BBPA 1IUNA 4MRMB 3RSLA 2AF4C 3V2HA 2CXNA 5K0BA 2NUPA 3P0EA 4CQMB 2FYTA 3MAGA 1E3LA 1AX9A 3TW8B 3A58B 1VSTA 2GF2A 4FFOA 2AG1A 3NM5A 4RVCA 1EFLA 1OLUA 2VR1A 2ADOA 1AHNA 1M2NA 2YYAA 3MRTA 4X3CA 4RADA 3WV4A 1DQYA 3VPSA 3A9UA 2ZOSA 1ZUNA 2H1LA 4HNAA 3PRKE 1Q95A 1RCFA 4PICA 2JJ1A 3VV2A 5JMTA 2Q4DA 1YQQA 1ZL2A 4YQYA 1VP3A 1BA3A 3C4VA 5CYGA 5LQKA 5JFOA 1B2LA 4ZD6A 1Q7TA 2ZFUA 4IY1A 1TEZA 4M1MA 3GRFA 4TYPA 1E32A 3PGA1 4D4LA 5EINA 2NU6B 5AI9A 5JSYA 1SQ6A 3R8CA 5CNKA 1JKMA 1E1RA 3R5FA 1V8OA 2R65A 3SK0A 5F1PA 5AM2A 4LZOA 4P34A 1KGDA 2QRLA 3NOXA 2NTYC 1KNXA 4PLPA 3ZU4A 1IWOA 4EL5A 1CR0A 1EFHA 1NN3A 3CM0A 3TZEA 4BFWA 4YAGA 1ESEA 1IN8A 1R1DA 2H48A 2IGTA 2IW3A 2YWEA 5DF1A 3DMFA 3NKLA 1GNQA 1HEYA 1NVEA 1Z29A 2IU0A 5LLTA 2YIDA 4BLVA 1O9GA 1Z8HA 2P5TB 4X00A 2PZEA 2VT6A 3FKQA 4EY3A 3OAAA 1RBYA 2D00A 2DFNA 1NLYA 4DS3A 4LGVA 1RYDA 1WXWA 3AOEA 3B6MA 3U4HA 2FUG6 4FGSA 2V3CC 2ZJ1A 3D59A 4JI1B 5AUPB 1IY1A 5E7MA 1SK9A 3TE6A 1XPRA 1YZVA 1OE0A 5GINE 2XHEA 4LISA 4OKNA 1OWNA 2BMAA 1U3DA 2JGNA 3E27A 3HUUA 4G5OA 1F1BA 1JHZA 1XFAA 4KMRA 5CB4B 3AY6A 4DQLA 4TT3A 1MC4A 4O4LB 4RZUA 2O8CA 4M88A 3TI9A 2EBFX 3C24A 2AD5A 1KU0A 4NQRA 3IVXA 4AYTA 3JAMA 2XZLA 4Q3KA 4YJ3A 3CW8X 5SICE 3KJFA 1XTKA 1RYFA 3AHFA 4MYUA 1DC8A 4WAUA 1ZI9A 5F3DA 1E6LA 4X61A 3AV3A 3SBXA 2P4SA 2HBRA 5EUCA 3S1AB 2D1TA 3O2NA 4W5JA 3K70C 5DCWA 3E2IA 3PQ4A 1PYGA 4BAGA 3GEDA 3WIBA 1L3CA 1YJCA 4HX9A 5DGHA 3SMVA 3QKTA 1AMNA 1HF3A 2PXHA 5HILA 1KAEA 4A82A 1U8UA 4AY6A 2ID7A 3RCBA 5LYJB 3IYLW 1MP0A 3LQKA 1L7QA 1ITZA 3G8CA 2ZU6A 2QZ9A 2WMOB 2X14A 5CA1A 5ECDA 2E0IA 4GR5A 2AYXA 1QVWA 3DEYX 3SZ3A 1BWQA 3O4VA 4KEAA 2RB5A 4REMA 1C8LA 1DAIA 4F6CA 1NBMD 1SOMA 4QATA 4WOPA 4CLOB 1ID8A 5BSTA 2Z9BA 3FNIA 4JHLA 4RLSA 3SM9A 4EYKA 1N5LA 1ATZA 1SK8A 1U2GA 2WDPA 1E79D 2KM1A 5A5FA 4HVLA 5LC1A 1KKMA 2VPIA 2JGEA 3AR8A 2P3LA 2NTNA 3EX7C 4EFKA 2W9XA 1UEIA 1WEKA 1T1IA 2O1WA 2V6MA 3OPQA 1BYUA 1KY5A 3EF0A 2I4MA 2ERYA 2NQ2C 4QBHA 3G23A 3O1JC 5C1DA 1QGED 1Z45A 3FRJA 5B3KA 3FETA 2G83A 4I50F 4KX5A 1JR3E 1IN6A 1PZXA 2QL7A 2YJ5A 2QMOA 3BTVA 4RAOA 2OSBA 4S3MA 2ON6A 1G6HA 2PUBA 3M1AA 2EIHA 5IT4A 1KH1A 5BWMA 3CCBA 3OU6A 1XAIA 4CM7A 2PMFA 1ID1A 1NFRA 2QNRA 4BO5A 4P0QB 1H8EA 3AW9A 4REOA 3SE7A 3G6KA 1FVOA 2PLNA 4MCAA 4RACA 2QT9A 4X7RA 5SZKB 3VOTA 4D0GA 3EDQA 3KEFA 3PIDA 8LDHA 1YUNA 4KR9A 1XMSA 1IRIA 2BFCA 2IBMA 3ROKA 4LJ5A 2OGUA 3A2KA 2G0TA 3FUXA 1YE3A 1G291 4KPFC 1NLMA 5F3RA 1INLA 1WUIS 2FPGA 5CG2A 2F8TA 3TNJA 3NHKA 4DLPA 4TZ6A 1P1HA 1R0XA 1ZWKA 3ZJUA 1PJZA 4GPZA 5KVQA 2W42A 1WB5A 1EJ0A 2UUPA 3A9VA 4HPXB 1JFVA 4OJYA 7AT1A 2W90A 3PJRA 2VDRB 4Q6BA 3Q3CA 1K86A 3SHOA 1N4AA 2DQKA 2O2YA 3TLKA 4MUXA 5HZMA 2VDMB 3Q7EA 4MPDA 2YXPX 1ZGCA 2ZCUA 4G2NA 2VP0A 1PQPA 2JFWA 1EP9A 1IIRA 4NZOA 4IV0A 2HLDD 1ISPA 4XLZA 5D7NA 2VP9A 3RW9A 5ESRA 1I2AA 2FHSA 5KVSA 1KI8A 3OQNA 2VDVE 2ACKA 4CI0B 3CVWA 4EJFA 1RJWA 2C20A 2EBUA 2VJQA 2WJ4A 5KTTA 2QMUA 1ZNZA 3U48A 1KGSA 5ETJA 3A4YA 1Y3FE 2OBXA 2PYZA 2QVGA 2WAAA 2XXAB 2ACEA 4GE3A 1P61B 2ISSD 5ES3A 4JL5A 4AVYA 1B41A 4AMUA 3F6YA 2BFFB 1J90A 5KYYA 1S2GA 1YB7A 3WSWA 5L7TA 3GF4A 4FWTA 2GZMA 4DLSA 3E7DA 1N36B 1H2YA 3I2JA 3WISA 3MGGA 2PRSA 3GD5A 1X2BA 2J7KA 1NNI1 3UTCA 4V1CB 4KO1S 2CJYA 5LPNA 3K9LA 2OZEA 1A95A 3DEZA 3L8EA 1DE0A 4HAVA 5FUBA 3RTAA 4MVJH 3VR4H 2PTHA 1T8PA 3BM5A 3LLVA 3PENA 3Q5DA 4OJNA 4TKZA 4X6LA 2P9ZA 3B20A 5KREA 1FLAA 4UAGA 4UXHA 4DNPA 2R5WA 3SHFA 5JBQA 4X94A 5HKKA 2FSVA 2Z98A 3MN1A 3QE4A 1PR0A 2GEFA 1QOQB 3UGJA 1NJGA 3IKLA 1FMJA 4QAJA 3ETCA 4TTTS 4RZIA 5KQMA 4YGYA 3JYQA 3RYTC 1QG4A 4TGLA 4CTKA 2OVBA 4AT1A 3DZIA 5K3OA 1TAQA 3ZK9A 1CQJB 1R27A 1YFZA 3QXGA 3ZDBA 1E62A 2QU8A 3LM8A 2Y1EA 3OPYB 4JVMA 1GUBA 2X3FA 4YALA 1L5OA 3TTSA 2R60A 4KWEA 3I6MA 5DBOA 2CL5A 1LWOA 1QK4A 2Q5JA 4FU0A 3WLHA 4ZZ0A 1YFLA 1ZZGA 1QO0A 1MOSA 3IP1A 4ARZB 3GLFB 2CLEB 1QAOA 3U7QB 5KNDD 3NMUF 2YS6A 2PO5A 3QEOA 3SJ7A 4KQ9A 3TIXB 4E2FA 3BGVA 3F3YA 3M6LA 5G0WA 3CG0A 1CS4C 4ECEA 1XTJA 3CW2A 5LOVB 3IUPA 3QNUA 1YRWA 1CQIA 5KOJA 2OE2A 3BRSA 3ENKA 4PCVA 4RTNA 3A6EA 1G0NA 1NUQA 3R5JA 3PI7A 1BMTA 3EGXB 5IAEA 1V8ZA 3WGNA 1Z7WA 4D0RA 1YZGA 4XM1A 3RODA 3ORYA 3W05A 4J8PA 5IKEA 5E0KB 1Z74A 1PKXA 1P4RA 1Q11A 3NBMA 3C3MA 4U8GA 1AGPA 5GONB 2NP6A 1OI7A 2Q3JA 4BLUA 2WZDA 1DIOB 1I2DA 5EHNA 4L9WA 1I4DD 2VJMB 1G5HA 3BH7A 3HWSA 4MLPA 3QBVA 3K3PA 3RU2A 2PBRA 1JZSA 1PT9A 1YAJA 4CCSA 2EZ4A 4BNIA 1EB9A 3AFHA 2DUWA 1QIJA 1TT5A 1HL3A 1UPCA 3DB2A 2VHYA 5D1HA 3UOWA 2WM3A 4WCFC 5L8VA 5EJFA 2HZ7A 1CXZA 4AWXA 5YASA 4JBXA 4G65A 4YMVA 1YU6A 1W4LA 2XUIA 1KDOA 3WFZA 4MV9A 4QIHA 4EELA 1UDXA 2B78A 2IYVA 2ZR0A 4QDKA 1JYFA 1R3UA 1ZU5A 3LE8A 2FWRA 5AI5A 2I33A 3HDYA 3TYXA 2XZDA 4NABA 2HB6A 2F9FA 3H1TA 2PRYA 3CONA 3LCMA 1VLHA 3IBGA 4UBMA 2QL6A 1O0SA 5ICFA 2CVOA 3WKCA 4E22A 5IX8A 1CVIA 1DRKA 4BRWA 3LRPA 1E2PA 2J0SA 4UQOA 2P6PA 3IUSA 1XD2A 3KSBC 5CYFA 4GI2A 3CB4A 4O2BF 1DJNA 4GPIB 3OOJA 4H6XA 3T38A 4LHSA 1WVGA 4CQLB 2XAAA 3VDXA 5L45A 4GW3A 3TH5A 3EZ2A 4TKUB 5CLJA 2QRPA 3EVNA 4C0LA 1JR6A 1IIBA 1L4LA 2GEJA 1DC5A 4EMUA 4RPKA 2F00A 2EBHX 3LCUA 4Q7LA 2CJWB 2NUPB 3EWIA 3EFHA 2Z83A 5CNJA 1NT2A 2FQWA 3H84A 4IIFA 5DN6D 3RVMA 4F1KA 4QU8A 3ZZUA 1J1ZA 1NW6A 1KYVA 3DUFA 3FTQA 5TE9A 2C94A 4ER5A 1ACMA 1C80A 1POXA 3KDSE 5ALIA 1PU2A 4XVCA 3AI2A 1AU9A 1ZUNB 3FHTA 1D7OA 3K8ZA 4A03A 4EGQA 5AVYA 1IBRA 5FNVF 3V1NA 1M7GA 1VI5A 2YZGA 1T1JA 5KPDA 3K70D 2EZ8A 4IX9A 3A9RA 4ALJA 4XWOA 4DPKA 1T3GA 1VA4A 4QLOA 4LDQA 1ZOLA 2RHGB 3CURA 1KP9A 2B8JA 3E3AA 4FNMA 4FT4A 4JEHA 4Q3EA 1WIWA 2B1IA 3WTCA 1NP6A 4NBTA 4M8NE 5EXEA 1OCEA 4C1NA 5KWEA 2AC4A 3FRHA 3U26A 3ZTYA 2J3LA 3F97A 4HNVA 1A9RA 2JIZA 1FDSA 2Q41A 4LQLA 1AH2A 1RRFA 4NJEA 1F8UA 2RGYA 2YUTA 2MSKA 3M9WA 2QW8A 1CY6A 1CQWA 4FIZA 1WPRA 4WXPA 2WF9A 2V1XA 1J6UA 3DHWC 1GQRA 4B2LA 2PWYA 5WRFA 3I58A 5IS2A 2CXXA 5U9CA 2YW9A 3BRCA 3EVBA 2QAGC 2JAWA 3EZ9A 4DV0B 1RC8A 4PO1A 3LY7A 4MI3A 3HNOA 4KYVA 1G21A 3FTCA 4XGQA 3WGJA 1ILEA 4ASUA 1UJ5A 3I3OA 4FSXA 1UBLS 1YOVB 3DSRA 3WADA 2AWOA 2V1UA 2IYRA 4HEHA 2O8CB 1NJ6A 4ARBA 3RS7A 1F48A 4CMHA 4YV2A 4YJ3B 3OLCX 1BFKA 1YR3A 1GQOA 4ND5A 1OU4A 2GFIA 3Q10A 2HN9A 3BUSA 2DY0A 4PX3A 1EGVB 4OI4A 2JLVA 3MBOA 3IQIX 1ZL0A 1C3OA 4J1NA 1W9MA 1JIVA 3FNBA 2FEOA 3ND5A 3INTA 3S4YA 2JARA 3EGVA 2H9YA 4K9NA 4AN1A 4DV2B 3HXPA 5F51A 4RE5A 5E2BA 2HXYA 1QUEA 1V9CA 2AZDA 3FJYA 5GJCA 1P80A 4LY0A 1NVTA 3EWNA 1RDFA 3I2IA 3SFZA 3AZOA 4HH1A 3DTVD 3FWHA 4FZ3A 1E2BA 5CA1B 2IIVA 1USGA 4HXYA 4FFVA 4XPIB 3O4JA 1J97A 1DX9A 2ZIGA 3D9QX 2JPDA 3MJSA 4G67A 4MTCA 1L8QA 3ESCA 4OA8A 2O6LA 3LOQA 4L78A 5DSTA 3ZW8A 5C18A 2F4VB 4B6PA 3PXEA 2IOFA 2Z2IA 2F8LA 3QFFA 2X1MA 3IUJA 1CUCA 4KUHA 4YRZA 3A05A 4EB0A 4ZGWA 3ZNPA 1RLTA 4LSWA 1NYQA 4OHWA 2D2VA 4FJ0A 3IEPA 4TS3A 3TN7A 2NSYA 2EKLA 5F9MA 4DCMA 2ASEA 4B6GA 2IYNA 1AS2A 4UUMA 3MHPA 3WYBA 5FUMA 2IBTA 5B6PA 4Z4GA 2EVWX 3NIDB 3FGOA 1ARZA 4UTRA 3JQFA 3T3OA 3JS5A 4II2A 5K9ZA 5BQXA 5CVUA 1L5RA 4ZQFA 2ZITA 1JEDA 4WXMA 4UC0A 4UVHA 3K9NA 3DA8A 4URXR 2ZRJA 1C8BA 1DIRA 4YT4A 1E6KA 4OLBA 1T5DX 4J16C 5EXSA 2B7LA 3USZA 3OKPA 1SXIA 3I53A 4F3CA 1TIKA 3LT2A 1OXVA 2BFCB 2MU1A 3EMVA 3I61A 1SJ9A 5BNTA 3HN6A 2P4UA 1ZM9A 1NURA 2FPGB 3QY0A 3WL8A 1TMKA 2QXTA 2AG8A 5DCLA 2AUTA 1AKQA 2CLOB 3ZOKA 2JCSA 4DGSA 4MS4B 5B1HA 1N1MA 3UZUA 2I6QA 4NZZA 5K5EA 3AF0A 2ZJ6A 3GDFA 4TTAA 2EEZA 3QF4A 4CN8A 3I62A 1XZNA 3FUUA 2HMSA 1FPMA 1WP9A 3EFEA 5FTLA 5HPYB 1B6GA 4TUYA 3SQDA 1EFDN 2FZ4A 5K1ZA 3FUCA 4AROA 4QDTA 2HWXA 2DY1A 3HB5X 2V7VA 1EK0A 3VR6D 1GPUA 2DB3A 3PE6A 4K6HA 3BWMA 1B8PA 2FEXA 4DCCA 3U5ZB 4BXOB 1SUCA 1SOAA 4Y6PA 5ECWA 4A10A 4ESOA 1U1GA 3TRKA 3GJTA 3I34X 3Q7IA 4PQFA 3VZPA 3PX2A 5KYYB 3L41A 3M4XA 1ZCJA 5IH7A 2GXAA 5G2OA 3SMQA 5SV2A 4A0RA 5GGYA 3EULA 3ZW9A 3MF4A 1F7UA 1CLUA 4OHUA 2PTGA 3IP6A 4XUEA 1S9DA 1W5EA 2JGRA 1E9EA 3JALA 1DINA 5C37A 5FFFA 4CEJB 2HGSA 2UZ0A 5ESWA 1NZDA 2LR0A 1K68A 3WDSA 5THKA 4OJKA 2LUOA 5B53A 3RABA 2DKFA 721PA 5G4LA 4EEZA 2I1LA 3NJ8A 3Q1LA 2OBMA 3FTNA 1GOTA 2ZYHA 3GCGA 3ND9A 1KFKB 4IKPA 1ZGZA 4KI7A 5AOCA 2JD1A 3OT1B 4IDFA 4UBJA 4P4LA 4RPGA 4KITB 4BOYA 2FCRA 2YY5A 5IPFA 1YRLA 4CLDA 1H69A 2NOAA 5CDTA 1B1CA 1SUPA 5B2FA 4Y0AA 1XZAA 1XZLA 4CYMA 1U0JA 1CFJA 4AJLA 3PDWA 2WICA 3PT9A 4BCCA 4JOSA 1ADFA 2CVQA 2UVQA 2A14A 1E3SA 2I62A 3P5BA 4X65B 2W8BB 3PQ8A 4EPRA 2BF7A 3U3JA 4I6JA 4LOLA 1GTRA 1Q7BA 1C0PA 4Z1MD 2XDYA 2LD4A 5I7RA 1L5QA 1T8RA 3PXXA 5AR1A 4F3YA 3CB2A 3SVTA 3ER8A 1CQIB 5KOJB 2P30A 3K0FB 3L8ZA 1Q3TA 2CNDA 3ZDAA 1IATA 5KTNA 2W22A 1YIAA 1HETA 4AY3A 4P1ZA 3H8VA 3WDKA 3CVUA 4DLUA 3FB4A 1N1DA 1E18A 3BB3A 3E03A 3I64A 4FCWA 4M87A 4TWRA 3C5VA 5ENZA 3RK0A 4YUVA 1YR9A 4LJ9A 1FFBA 1CUYA 2VLBA 3OZXA 4QOIA 3PCXA 5B1SA 5JFTA 4D25A 4QFDA 3W3AH 2WU0A 3H1EA 4KIJA 3VUEA 4PZAA 1P4GA 2I8CA 3I5AA 3NWJA 2FKNA 1S8OA 2XNJA 1H4VB 3OO0A 2HC9A 1SVMA 3LX8A 4LJYA 2ZJ4A 3C43A 2HJVA 4U2EA 4HSEA 1P6QA 3PCTA 4CUJA 1TT5B 4XGIA 1GCUA 4HO1X 4AUEA 2FW1A 4RSRA 2Z6QA 5CYPA 1DTSA 1QHSA 1OYWA 1IULA 2ETXA 1U0EA 3FWZA 3U1VA 4F21A 5BSHA 1YS2X 4GBMA 4U7DA 3IB6A 4XD2A 5IDXA 1N5KA 3RKRA 3I9V1 1CEQA 4RFVA 2K2WA 3CH5A 5FI5A 4C0XA 1A8QA 1LCIA 5EXPA 2UYGA 4OJTA 1XF1A 4AUKA 1FX0A 4FOPA 4B4UA 2CE2X 1WXXA 4K9LA 5F76A 1DS6A 1O3YA 4C4AA 1DO2A 5AK0A 3E7WA 4JLWA 5DX0A 5IW8A 2NLOA 4LF8B 4G86A 3Q0TA 5C34B 3V1KA 1OWPA 3L8GA 4AJPA 1M5TA 2C2GA 4D5EA 5CLQA 4G8JA 4Y18A 2BFEA 4YCNA 1H5NA 4C7KA 3C0KA 4HMPA 1XXHE 1X15A 4TLCA 3ADCA 3KUUA 1TVMA 2G5TA 1Z6TA 4DMRA 1J9EA 1JPUA 1DL5A 2GBGA 2X8JA 2CXUA 1X1DA 3FPEA 4WK4B 3EZYA 1DARA 4ZU1X 3NWEA 3FLAA 3NYRA 4BN0A 4CLHA 3UAVA 1AA6A 3E0XA 4PSUA 3FCXA 1N6OA 5ICMA 4ZU3A 1S2MA 3AIOA 3EVEA 3IR6A 2QN3A 1JAYA 2YZKA 2QEQA 3DUFB 4MRVA 5F7XA 1FF9A 1FP2A 4JDPA 4LSMA 2HK6A 2OKCA 5F21A 4ZT2A 2KPOA 1ZLYA 1G59A 1K6EA 4CIBA 1QB7A 4EG5A 2M2IA 4ZIRA 5IM4F 2A84A 1F6DA 1APBA 3FHJA 3U44B 2QTCA 1Z7YA 2R8BA 5EN4A 3TJZA 1U6KA 2ZSIA 3DVQX 5DLYA 1J7JA 1JLLA 2R96A 1DC7A 4LJLA 2WPDD 4NBVA 5FL3A 2GD6A 1FMCA 4OK3A 4YRJA 1NBMA 4O1HA 2IRWA 3CV3A 3JYNA 1FFXA 1KIMA 3HZRA 2WYVA 4PYIA 3ZWQA 5B1EA 3A1SA 3LSYA 3HXQA 3IMFA 2WRZA 3FFAA 1P0MA 1SXJA 1WXIA 1E79A 4I8XA 1GZUA 3FSRA 1U2RA 3Q3GE 4O5OA 4BDTA 1RZRD 1VMEA 2WABA 1Z5VA 2WE7A 3A26A 4H7HA 4NJEB 3Q98A 2OK8A 3PEYA 3DZCA 1BWRA 2II6A 1D1PA 1ODJA 3H0KA 2OXTA 3JZFA 4HRAA 3ZCVA 2BM0A 5CT9A 5DE3A 5L4SA 3KQTA 2SNIE 3O4IA 1M5RA 3ERCA 4KIUA 3AL2A 4Y1RB 2PCLA 3A2NA 3FBGA 5KOYA 2AIRA 4RZXA 3JR7A 1U0LA 5GJWC 1HMYA 1Z37A 1V5IA 3PJFA 1CLEA 1JQKA 2HQOA 2A0WA 2JATA 3KKEA 4RHEA 3ZXYA 5IC4A 3NHAA 2W7TA 4JGIA 4MQUA 1QRAA 5B1YA 1ISFA 4JMLA 3KOXA 3DCIA 4BQIA 3OEYA 4G0MA 3C48A 1UKYA 5BV1A 5A5EA 3ZWDA 1ZCAA 2QAIA 4I50B 3SQNA 3WHPA 4US0R 1C3OB 4I4IA 1NY6A 3HB4X 3FVRA 2P0EA 4J7AA 4P7BA 4DXAA 5M34A 1F2VA 1R00A 4N6NA 5FBRB 2NP7A 4QTXA 2LW7A 3LT0A 3T4XA 1NXVA 3PVCA 3VR3D 1OFUX 1UT6A 3EEQA 2AEMA 1A9OA 4GO1A 2HCRA 3GJSA 3M4NA 3RU3A 3KQYA 5BV2P 2QSJA 3O75A 4N6GA 2HWKA 2P2GA 4OFWA 5JNRA 1HGXA 3AIMA 4Q01A 4I3GA 5TNXA 4ZK2A 4TWZA 2P27A 2EKQA 2QP4A 1H2AS 4JLJA 3G5AA 3I9MA 5J1SB 4A36A 2W11A 1EX6A 5B3LA 5I45A 4BQSA 1GL7A 1IUPA 1IZ0A 1XVAA 2BKEA 3EXIA 3T3GA 1U81A 5CVJA 3K1YA 1GKLA 2Y27A 3IELA 3IAFA 4N54A 1LTHR 3N2GA 5FPYA 4RH0A 1CPYA 3TLGA 3WYEA 1FCJA 1LDEA 3BICA 4LY3A 1H22A 2MSNA 2VH2A 2XNDA 3K4HA 4Q24A 3BSFA 2GLTA 1JH9A 2J9XB 1X39A 1Q2XA 1ZS9A 2ZJ7A 2R85A 5CFOA 2AQHA 4Z4CA 2CL0X 2Z08A 4CL0A 3UMGA 3FPBA 5LJLA 1PKEA 4TYQA 3WRYC 3QFCA 3S8YA 1H2EA 4H35A 2ZRCA 2ID8A 1VP9A 2EG9A 4JKIA 4PY2A 4RA9A 1PS8A 4XPZA 3JWPA 1FDUA 1WDKA 1TTPB 4PYNA 5FWNA 4RJLA 3VBEA 5K2MA 4BVHA 2AQ8A 3B3JA 2QMZA 5IZCC 2CLHB 3I1FA 2D1QA 3VR5D 4UE3S 2JH3A 4LDRA 1QP0A 4KAJA 2B2NA 3JWEA 4DL9A 3OWXA 1N32B 4F7DA 2VSYA 4GRIA 1GFZA 3H42B 3TM4A 4EB6A 2CK3D 3GRVA 2VDWB 4TTJA 4MIYA 4RETA 2WF6A 3L6BA 3C8MA 4U9HS 4JUDX 1UBCA 1CHDA 3BA1A 4OSOA 1YTLA 5DM60 2HMUA 3GRCA 1VZ2A 4A73A 4NFSA 4I1SA 4EVQA 4CV2A 1PL8A 2YHUA 2ZSDA 3KD3A 5BV0A 4BE7B 4LXTA 1T25A 4O59O 5LQRA 4ALLA 4UHHA 4RU1A 3T5BA 4XKJA 1Q0UA 1VSVA 3QF4B 3IDSA 5G40A 4OFXA 1X1QA 1T35A 4LRXA 4DQVA 5L3ZA 5KNDA 4Q21A 3RTCA 4TUYB 4F45A 4YPVA 1J2TA 1SHUX 5EIFA 1PFKA 2XUKA 3M9LA 4HD8A 2ZR8A 3NO4A 4HWOA 1DO0A 4TTQA 4C4PA 1IH8A 4UBKA 2HJRA 4Q37A 3U3MA 4GP6A 1NVVR 2NTEA 4B48A 5HZKA 3LDFA 3D6MA 4TWIA 3R5XA 2UVPA 4P33A 5FLKA 4OMCA 2GCOA 4GUAA 3AETA 7MHTA 4K1LA 3DAOA 4NU0A 5IWAB 1R5BA 2L82A 1DRJA 2BFBB 1HLGA 2DBQA 1SVUA 2XQIA 5ALDA 5E1OA 5HR5A 3V46A 4UNRA 1HBJA 4M1QA 2WNHA 2ORIA 3IEUA 421PA 1BCRB 3DHNA 3ES9A 5A5VA 1ISRA 3JWJA 2RCYA 1KKLA 3LAWA 4ATNA 3TKLA 4IILA 2PQ2A 4CDRA 4E33A 3I8SA 3N07A 3JALB 4D8WA 3KIPA 2QLMA 4E70A 3RASA 4F4DA 2AN3A 4BX0A 4B79A 3IAHA 1SHTX 2VHEA 4B6SA 3E7XA 5G3ZA 1VIDA 1NXPA 4Q7EA 1E4EA 1GG9A 1M0WA 2CL7X 2O2HA 2SECE 3AEKA 5BSKA 2NVBA 3KEOA 3NC0C 4ICIA 5COQA 5EG5A 4IOKA 5EKDA 4FFBB 5HKOA 2WWVD 3ZDFA 4Z3OA 1X9GA 1QQAA 4Z51A 4MDEA 1ZMXA 5HS6A 4IXNA 2XI4A 4HDKB 2XWBF 3F71A 4R51A 1Y5MA 5J63A 2OYCA 2CFSA 3WJAA 1VKJA 1QTNA 4LZNA 2ZAYA 1HKUA 9ABPA 2VPWA 1H2FA 4F4UA 3CRQA 4M9RA 1DRUA 2R8RA 1Q14A 1C2YA 1QK3A 2GGSA 3HADA 4GR4A 1UOQA 1EM8B 1FC0A 4NONA 1ISMA 4UZEA 2ZBGA 1V3TA 3KU4A 4N7RA 5K8CA 2WSSD 3H7IA 2XTAA 2GBCA 1SKYE 1QR6A 1RKVA 3GUYA 1VFPA 4UU1A 4GWLA 4AN0A 5ABPA 3SHQA 3TW0A 4LFBB 5AM5A 1VLMA 2XE7A 5DMXA 3EIEA 1I3KA 1KQPA 1TC1A 1YV9A 3WLEA 3FUWA 4MUJA 2NSLA 2V0GA 3M82A 1BEUB 3FOEC 5B37A 3KTOA 1AN0A 3KZMA 2ONZA 5CFRA 3GEMA 1AJEA 5BSFA 4LV5B 3OC6A 3GG9A 5IFKA 1K3TA 4LX0A 3MJTA 3U2QA 4Z7OB 821PA 5JSZB 3R77A 2ZS8A 4D44A 1X0XA 3B9PA 3EUFA 4Q3AA 1SQ5A 3RFCA 1ZOOA 3BEDA 1T9GR 1YHNA 3CMMA 2OPBA 3CKYA 4O2BB 1PJSA 2C1XA 2EWMA 4WLEA 3TI7A 1A27A 4Q4DA 1BWSA 3A70A 1NI4A 3C3BA 1RLUA 4E4TA 4JXJA 4ZV9A 3BCRA 3D8HA 4GLJA 3QE9Y 4MROA 3ZXSA 4PU0A 1JR4A 4FK8A 1RI2A 3WB1A 4LJRA 1LK5A 3EEBA 4E5UA 5ARBA 4P32A 4O02B 2E2WA 1GVHA 1H94A 1TD9A 2Z57A 1Z6PA 3IR5A 5ERYA 3W5HA 4F2WA 3FPHA 1X7YB 1Z82A 4R01A 4U7PB 1CFZA 2YMMA 3A0UA 4HATA 1GPAA 2Q8QA 1JR3D 4WDRA 4YMSA 2O1EA 5AMXA 3ROMA 3RROA 2Q50A 4FXPA 2I4RA 3N0VA 4RKRA 4YR7A 4EQ6A 5BVHB 4KR0A 3MUNA 5ITSA 4H59A 5E4YA 3AUSA 1Y34E 4R71A 1K88A 2C77A 1CRLA 1N2CA 4GBJA 4IVQA 4YROA 2HHHB 4F91B 1M2FA 1MKYA 2EEPA 3MXTA 1XLVA 2VNKA 3IB3A 4TL6A 4WGGA 4K6OA 4Q4LA 2TS1A 5LA6A 4DSZA 1KYTA 2CN1A 4OI1A 5INTA 4TL7A 3OZUA 4WL0A 2NUTA 3NS7A 2ZANA 2VSQA 4PG6A 1JIXA 2PA0A 2WP0A 5HG0A 5KCMA 3WLFA 3WZMA 3ZVRA 3QVLA 1KQGA 3TECE 1Q84A 1W94A 3QBJA 4TYYA 2YV5A 3I2GA 4B3GA 3GFFA 4F3KA 2F6RA 1G41A 2WA2A 4RBNA 2X8JB 3WNBA 4BJ1A 3L1IA 4QO7A 4NBUA 4IIVA 4QJ4A 2WLTA 1MQSA 1V1RB 4MWTA 1L7AA 2PJRA 1C0KA 3JYPA 5HW0A 2BELA 2QVBA 4ARAA 1W34A 1WULS 4HDAA 3ICVA 1ADJA 1N0UA 3AONB 3O8BA 5A9TA 3HWWA 2FDXA 2R00C 1AXGA 5HUJA 1DAEA 5JXWA 3OJEA 2CLCX 4NULA 3BF7A 3I39X 3HXTA 1TMYA 5TEWA 3IDQA 2O8EA 3RHFA 3GQBB 4B7UA 2WKQA 3BVPA 4Y6GB 3TXAA 1IBCA 1DI0A 4RV9A 2JAPA 1T8SA 2XYVA 3BHNA 3DTVA 3KFVA 1A9TA 2GZ3A 4QA9A 4WECA 3ZYZA 1U0HC 3NC1C 1J06A 4WY2A 1JLLB 1M76A 4D3ZA 2JGJA 1D07A 3NYWA 4QASA 3IO5A 2C5FA 3OPNA 1IN5A 4C4SA 4M2LA 1XQVA 1KYZA 7REQB 4UQPA 4BATA 4DB2A 3QKSB 1NUUA 2BH2A 1JHMA 1JQEA 3S2EA 4V0OA 1Z63A 4QJIA 5ALZA 1SXJB 5CK4A 2FVYA 5UKDA 3H5OA 2A1UB 1Z0SA 1ZGHA 2HU7A 4XFJA 1Q7CA 2ZYIA 5EGNA 2PT6A 3VZRA 1ZH0A 2PSJA 1DAKA 1IVNA 3P4UA 3CX7A 5E7QA 1TJYA 4LHYA 3BBLA 3AIKA 1ECPA 2O0JA 4KHZA 2NPFA 4ZYVA 5KQGA 1BZYA 2RGGA 4HQNA 6REQA 3VYTB 2QRMA 2Z8XA 3UMMA 3OA2A 4H1WA 1E58A 2EFJA 1U7DA 2IU6A 4YGXB 1ZUIA 4FE3A 1QGDA 4ZALA 4I2VA 3BGIA 4Z5XA 3QLTA 3CUYA 4DE5A 3KYCB 3Q7PA 2I99A 4PXYA 5AK3A 1OZFA 1UT5A 2FZEA 2EX4A 4FKMA 3FBTA 3TAXA 3OLVA 3QMPA 4O4HA 1LI4A 1IDN1 2QUIA 2QE6A 3E58A 3NP9A 2OV4A 1J5EB 3T34A 4RHYA 2FWIA 1PJLA 2R8OA 4F46A 1V7ZA 2CFOA 4HAZA 4LMAA 5KWJA 2LDBA 1WW2A 4E51A 4P98A 3C3DA 4E2ZA 1DKQA 3IJPA 1L8OA 5JD5A 1XR3A 3MYYA 1N6RA 4XWAA 4JVOA 2WC1A 2JFGA 4S12A 2MMCA 3NDIA 3EGEA 4KXMA 1SBIA 3LUHA 2WIDA 2HOQA 3EXIB 4GQAA 5DNAA 5ILOA 4YMGA 5FA8A 1GT91 1Q20A 1T0IA 4FI3C 5AHOA 3VR6A 2OVFA 3TLGB 3GZNA 4YH1A 4BVJA 3AKZA 3GVXA 5B12A 1C41A 5EP3A 3B5IA 3FFTA 5D85A 1GHTA 4IHAA 2ZRDA 1DWPA 1VRVA 1ADYA 1H85A 3ETEA 4WI1A 2EU8A 4LY9A 1EH5A 4BMVA 1R0RE 3K5IA 1M1NB 1MIOA 2WM8A 5JSFA 3NRJA 3DMGA 3CWCA 2IYAA 2BKAA 1JLSA 1KJWA 2G71A 1Q6YA 1GPYA 3C14C 2OV2A 3WC4A 4WNIA 2H1OA 5E8JA 2W2VA 3DR3A 4DV3B 1N3YA 4WK6A 1CRQA 3MVEA 4MVXA 4INAA 3MW8A 3EG5A 4S0XA 3TJRA 2FNAA 5A1TA 1GFWA 2Z5GA 2G67A 1RZVA 2C4HA 3GDOA 2VWQA 2BFMA 5D3QA 5BXYA 4PLHA 1DCMA 1J9ZA 1EVKA 1QH1A 1V3UA 1C9MA 3CVOA 4Z86A 4A1FA 3O8RA 1M34B 1DLIA 1WMDA 4HXFB 1DTWA 2J3HA 2YBDA 4PGFA 4RPIA 5ALPA 1OLXA 4EB6B 3ZJ4A 1Q6ZA 1XQWA 4V0NA 3V8BA 1D0IA 1VLVA 1MU0A 1EDZA 1YKGA 2GAOA 4S1WA 1E92A 2OCKA 3PUKA 1PWYE 2HNKA 1AS3A 2XW6A 2PUCA 1XX6A 4MUFA 4O2LA 1CETA 5ALEA 3JQ7A 2JIRA 4E15A 5K6RA 4C5BA 1N2GA 4LXHA 2ZE8A 3H3JA 2IP4A 3RJMA 1W4BA 1A04A 1VM6A 3SJCA 1PQUA 1ZA1A 4IVPA 3Q3EA 1GZHB 1XU9A 4IDEA 2IYZA 3AR5A 1GRCA 2OOSA 3M89A 4L7VA 2JLBA 2V4ZA 3UK1A 2O2EA 4E5MA 2C7RA 2O5RA 4EK9A 2AFVA 4KODA 4NH4A 4HFRA 2ZB8A 3PQ5A 4Z1MA 4LF7B 2EKPA 3PD7A 3AF5A 4MKRA 4F86A 4OI0A 1Y9ZA 2HHJA 2E6UX 2MMGA 1P44A 3B1VA 2Q7DA 3IV9A 1EU1A 1FFCA 5LFAA 1XN1A 2DQZA 2E5FA 3EMKA 3KRTA 1B8UA 3NUGA 4MYCA 3EODA 4GVXA 2GCOB 4B76A 3N8IA 1ZK3A 4OMFG 5LKRA 5IXJA 4DUZB 4KI0A 2PN1A 1Z4NA 3U3ZA 1FYDA 1YT5A 3DLTA 1W0KD 1UPUA 1MZVA 3HKDA 4WNAA 4E07A 1L7OA 1BQ3A 1WJGA 2ZIXB 1HT1E 5E3IA 4ZT3A 2JFNA 2J09A 2IUSA 1AZWA 3GAZA 4RVOA 1SU7A 5BN3A 2WHYA 4CMGA 4F5YA 2AMFA 2P2ZA 4TXHA 2FRVA 2QGNA 1EZZA 1DAOA 1E4EB 1YR1A 4GVPA 3AEKB 1VQ1A 4NOKA 5H9VA 1RXCA 3L07A 3EH1A 2NPIA 4PGAA 5HQ3B 5FJIA 3VAYA 3AVQA 1KMMA 4EBBA 3RWOA 3WKBA 3KYJB 4JEIA 3RD5A 3DHVA 5IANA 4KVFA 3ZHRA 1FTWA 3KBBA 4XVUA 1JT9A 2E18A 3D2AA 1ZI8A 4DSAA 3O2QB 2QW1A 1RAHA 5L3SB 3AESA 1OFTA 2YWBA 3WAKA 3EZLA 2Z2KA 1B6SA 2B8TA 1U8YA 1CDEA 1T4CB 1UKAA 2V59A 4B6QA 5TQ2A 4FOSA 4ZYZA 2NN3C 2PV0A 5F98A 4DDTA 1G8AA 5L51A 3GPIA 5DNUA 5D6OA 2QMHA 1F51E 4TVBA 1KZ4A 5DHQA 3LY5A 3TAHA 2QAGA 4B3HA 5JFGA 1RPZA 4NE7A 3EBPA 1KI1A 4AX8A 1KJ8A 4B45A 4IKEA 4EW6A 3V80A 3MS4A 5IAJA 5FOVA 2PHZA 2Y0EA 3LXRA 5D00A 4G9BA 1RXYA 4NR0A 3PNLA 5C8ZA 4KO8A 3ZTTA 2J5QA 1TADA 3GV0A 5H83A 1N0WA 2VWHA 3T5TA 5FFMA 4AJOA 1UXOA 2QIOA 4D82A 2P62A 1SC6A 2BFAA 1P81A 3SSNA 4H3HB 3O4HA 2G08A 1DXYA 2GLUA 4R05A 3LUAA 1Q1ZA 2G7MC 2HO4A 1GSHA 2W37A 4HGZA 4ABTA 3SBEA 1JSCA 2H4FA 4PQGA 5EL0A 3NYIA 4R5MA 3T7CA 1NWHA 2ONJA 2WPDA 3RS2A 5IARA 3FYUC 4OYRA 3SGLA 1Q0TA 4IRMA 1L4HA 3I4LA 3KAJA 5K45A 4KWCA 2CCKA 4ZOCA 5EWLB 3ZBTA 3KB8A 1W29A 4O0LA 4Q02A 3QNWA 2WSYB 3UJ3X 1XTTA 2Q5FA 5EKTA 2GPJA 5TIIA 3HYRA 1FRNA 1TU4A 5DT9A 1E2QA 3Q8KA 1N2CB 1RZRA 1ENYA 3QYPA 4N01A 4PHGA 4ERNA 4MVCA 4GPD1 3VNAA 2LDXA 2XOXA 2J9RA 3O9VA 2PZ8A 4H3SA 5LA6B 4F5DA 1QQBA 1I3LA 2OORC 3F7TA 4PZPA 4BN5A 2O8DA 1CQZA 2J9FB 1RWNA 4LJ7A 5I9MA 1C3VA 1RADA 3AR2A 1BE6A 1QF9A 2DOKA 1NMYA 5AJUA 5JANA 3KHSA 1BMQA 1UDBA 5DCUA 2BP7A 4MQLA 4QPJC 4YLYA 2AZXA 1K6MA 2YWDA 3WWZA 2H18A 2TECE 1MO6A 2XSZD 3NP7A 4WKBA 3QW2A 5AKXA 5KCZA 3OEED 1CT9A 1FS6A 2C8KA 3QUBA 4DLXA 5TR9A 1H2HA 4NJOA 5LP1A 2DYKA 3ICQB 4M1KA 2VDQB 2HJSA 2XIJA 3KCQA 4DLZA 4BJHB 3P52A 1RNLA 2OXFA 5L3QA 4U5XA 4UPEA 3FPSA 3D8UA 2G6BA 3EXFA 3B13B 1U8CB 4ZCPA 1B0PA 2DLDA 4J16A 3UMVA 4D4IA 1IVSA 2FR0A 4EATA 3RFVA 4YY3B 3UT0A 4QUGA 1HNWB 2O8EB 2JASA 3HKBA 4ESEA 3BRWA 3JQ6A 1FZQA 4R6WA 4LYDA 4DCJA 1TDJA 4YUXA 4BO6A 1E59A 4ZEMA 3NHUA 5AK5A 3DFUA 4KPEC 2FN3A 4A6DA 4TVOA 5TF4A 4IINA 4HLNA 2VYVD 1LVUA 2XQKA 3NAQA 3F8TA 2CUZA 4X3PA 1LBSA 1O77A 3LQ1A 5C7IO 4ARIA 2RDMA 3B8EA 3QMMA 5JRZA 1U7XA 1REQA 2HF8A 3HA5A 1TJ5A 4IXTA 4L57A 4PFQA 5C8YF 2VO1A 2BV3A 2XVZA 2ZJAA 3U17A 4MV6A 3EXG2 2J3MA 1KMQA 1P5RA 1QDUA 2W98A 3PV0A 1KZ1A 2ZRQA 2ZWPA 3I42A 1C7FA 3LBFA 5K3FA 5C1IA 5DHUA 1LJ8A 1F4VA 3H6GA 5EPEA 1L5GB 2EZUA 3H2SA 3SZUA 5A9SB 1FU8A 3LKBA 1EJBA 2AQIA 5KVAA 1GNVA 1NPDA 2FOLA 3M7IA 4L0MA 2Y9MB 2D62A 5FR2A 3KTDA 1T2UA 5HM8A 3WYDA 4ZV7A 3V8EA 1J8YF 1E8DA 1M75A 4WOBA 1V16B 3GCZA 4MQFA 4E14A 2EL9A 3ZCUA 1NXTA 5AW3A 2RHTA 1YJXA 3AVVA 4HDOB 3VR5A 4DM7A 3W04A 1D04A 3FUTA 5CCDA 3V2GA 1XRJA 3TTTA 1R8QA 2RIRA 3A6JA 4UW9A 1VJ0A 4ENVA 1I4LD 4UAJA 2CK3A 1QIIA 1VPLA 4YEDA 1G9TA 2WMNB 4O4HB 1L0BA 2JCGA 3ROXA 5A4MS 4UU7A 1WUYA 4PG4A 2NVUA 1VMKA 1G8SA 3S28A 5IH3A 2H06A 1FNCA 1SZCA 4MGHA 5DPMA 2WA1A 1PNQA 5AM1A 2EZ9A 1YZKA 3WIDA 4OB6A 4TM7A 4KOEC 4BQEA 1ZCFA 1ZJZA 3ISJA 4X1KA 4H18A 1WB6A 4G5RA 1WEHA 4KX3A 4OHMA 4TSKA 4XIYA 1XJ0A 1L8LA 3H5TA 4TZKA 3LUJA 1JPVA 1P72A 1J8MF 1E9RA 1N6HA 4BLRA 4LZAA 3RVJA 4QICA 3HRHA 1EQAA 3QY9A 3BWYA 4JUIA 1TRKA 1UJNA 2DHRA 1COWA 3Q85A 3WGTA 5E6RA 1C0IA 2I4OA 4C3VA 4KR3A 3A9SA 5DTRA 2FQYA 5K01A 2A9QA 1IOLA 3S5UA 1SBNE 3GZNB 3IBCA 3QG1A 2A5JA 1IJKA 4DCVA 2E4XA 3IURA 1KK1A 5FWYA 4TRMA 1P1IA 3OZDA 1FYWA 1XRMA 3VX4A 4D9MA 1A5SB 1AQ6A 2D3TA 1JIJA 1F9AA 3TSCA 4DLTA 2PL5A 1UKCA 5KU7A 1DKOA 3K16A 4L22A 4GWGA 2B37A 1MIOB 3EC7A 5AVWA 4ZAGA 5BSWA 3MC1A 4PBTA 2Q5LA 3BCSA 5U4XA 4ZQGA 3BGOS 2NPOA 3MT8A 2QLFA 2VRCD 4KRYA 1DEHA 1I4OA 3Q8WA 2OB2A 3EFBA 3HI4A 4RENA 4UE2A 5ALQA 1W2GA 1CUXA 4BKRA 4HAWA 1P9WA 1NI5A 3WTBA 2O23A 4L3OA 4P84A 1I1OA 2NGRA 2OY0A 3AXSA 3EDMA 3OLXA 1JJFA 5FUQA 3KBOA 2VHTA 4URUR 5FI3A 3D8TA 1GPLA 3P9SA 3EZGA 4J49A 1GG8A 2AFHA 3F8SA 4BFTA 5ALGA 2Z9CA 5HSGA 1MTZA 3DD1A 4JC5A 4IFIA 3QRWA 3WS7A 3IV7A 1UDCA 1IBLB 2X0FA 3FRIA 3WGIA 4J9UE 3CR8A 2Q21A 2JCVA 5IRCD 3JARB 1ONNA 2ZRLA 3E2PA 3JQ7B 3SJUA 5BSGA 1P2BA 1QHXA 2ATEA 4LV8B 3FCUB 4ARUA 3TNFA 2ZIEA 2WSSA 5CM2Z 1FDIA 3NATA 1QQ5A 4Q03A 4YJGB 4KFTA 1XLWA 3Q5EA 5FV7A 1Z35A 2IYQA 4FFPA 1QYDA 4R5HA 1SULA 4QC2A 3MCUA 4RH1A 2GVDC 4R2HA 2R87A 2PGAA 3JWHA 4WTOA 2ADFA 1B6RA 2ZYRA 5G41A 1K1EA 2WDZA 1KR5A 2ETVA 1EQ2A 2GN8A 2JVJA 1TNDA 2ONYA 4X64B 3IOEA 3PC8C 4WBNB 5K7SA 4IJVA 4HEA1 4E03A 3OD5A 1OAKA 4OQDA 2XTZA 3LPMA 1UWLA 2CXTA 2YFQA 4DR7B 1YU9A 1E2IA 5TDHA 1E1KA 4BYGA 3HR8A 4YP1A 1JEQA 2OXIA 4LWPA 1PEDA 2OCLA 1Y42X 4WNAB 1G1MA 4F1JA 1ORVA 3A4LA 1ZIXA 4RY9A 2BD0A 5CW2A 3DMYA 4C7JA 1WY7A 2Q4EA 3QMVA 5C5DA 1DQRA 4J1SA 1D4ZA 3T3HA 5BN3B 4RTSA 1O96A 3IC5A 4EWLA 1N6NA 1QHFA 1UBOS 3EZNA 1CTQA 3ESRA 4X44A 3UT6A 2QYOA 4QAQA 5TPZD 1JR3A 1Y5RA 1U3WA 3JZMA 4LRTB 4MW6A 3IT1A 2WYIA 4LY6A 4Y9UA 2BHTA 1XQ1A 2JI7A 2HW8A 1LDBA 1MX9A 4M7WA 1NSFA 2GN9A 5LNK1 2RK3A 4P4TA 3AC0A 2OXEA 3K1AB 3KLOA 1LTQA 2V7EA 2VZ8A 3O1HB 1MXFA 2AX3A 5KYUB 3SNKA 3G8BA 4BX3A 1D2CA 4DADA 4DYHA 4LOKA 3EEOA 1JF8A 3CUKA 3AGQA 3GJYA 3I9JA 3RE1A 1JG6A 2Q29A 5IXYA 3U80A 5IKOA 4MJLA 3S3TA 3OIGA 1E3EA 2FPSA 2TMGA 4TN1A 2CT8A 5F52A 4QDUA 3R9IA 4BNZA 3OG9A 3OTHA 1RLIA 3FROA 2PCJA 1WVMA 2D2XA 2QAGB 1KBQA 5FADA 3BXZA 3C16C 4PNEA 1DG9A 3D8RA 3BXPA 3NIGB 5CYOA 2OZVA 4FX5A 4AUMA 5DSXA 1YCHA 3WA7A 4GGMX 5CRIA 4P92A 4KQWA 1ONOA 3Q3HA 5KZMB 3R7DA 3UA4A 5JC8A 4OQLA 1KAOA 2G9QA 1DEXA 4IDBA 2X76A 4L7QA 1GA6A 1C30A 1TT7A 4YRRA 4XB1A 2P1RA 3C87A 4NATA 4PLVA 3AY0A 2IXTA 2WTNA 3CXUA 2W2LD 3C6ZA 3ROZA 3I2FA 4GLFA 3ZCTA 1A7KA 1OPRA 3BHMA 4C30A 3IDOA 1HT2E 4HDSA 5I9TA 4AJJA 4BZWA 1L4MA 1DV2A 3BDAA 1KYXA 1EDOA 4YRPA 3DEKA 9LDTA 2WMYA 3IVRA 1JMKC 4C0QC 3NDBB 1JIIA 1Q57A 4TTIA 1Z0KA 2GPSA 3IDAA 1W36B 2VTVA 4FFLA 1FUKA 1XEXB 2OXRA 3FR8A 4BO9A 3AHEA 1E4YA 4PM4A 2ENUA 1D5CA 2J32A 1U6JA 1VXOA 2B4KA 3EARA 4DSTA 1JW9B 3AUAA 1AKWA 1MO5A 5C3MA 2X6TA 3QX9A 4FGZA 2O8DB 2FPKA 3OEWA 1BHO1 1JE1A 1Z07A 2EHDA 3UTDA 3ZUPA 4YI3A 1XWFA 4L9AA 3J81A 1QQTA 3G8DA 2OM2A 5KSOA 2D1SA 4QQFA 3WRYA 3S8EA 3S5JA 4MSUA 4Y0VA 1U02A 3TPZA 1WCV1 1ZJ6A 4PSAA 1IEXA 2FUEA 4IHKA 2PSDA 3L7IA 1SXHA 5L7YA 3HB7A 4EY5A 4ZJPA 1HQYE 1ULTA 1HA3A 5KSYA 1NF3A 2Q4RA 5IZCA 1BFUA 3ITKA 5L3QB 5FBVB 2UV8A 1PGQA 3B2QA 3IQDB 1UWCA 3EXFB 4GKAA 1F8XA 3FVVA 1HKHA 2CMKA 1N2EA 1XZFA 1MB3A 2E4AA 4M0CA 1E3MA 2FOIA 1BCSA 2GWRA 5B58T 1P0CA 1JSXA 3R23A 4XI9A 3DFFA 1NJ5A 3CPSA 1SCJA 5B55A 2K7FA 3EE6A 2A7XA 2B83A 5JD3A 3CTMA 1RMQA 1ESCA 1CJMA 1FNNA 2J6BA 3OJ0A 3L8YA 1QE3A 1C9NA 4XASA 1REQB 4BIIA 1TZCA 4NCNA 1Y6JA 5FBLB 2BI7A 3OFND 1L5YA 2Q9BA 3K5PA 5EUQB 1ODSA 2D5AA 4Q9DA 3W8NA 4FMBB 1W76A 2ODPA 2Z09A 5THQA 3HACA 3LG2A 4F8JA 3CUTA 2OG2A 2PSFA 4G09A 4W1PA 1KZ9A 4O4JF 1YO6A 3MFYA 2VJAA 2ZUSA 2BIFA 3T99A 4HEA6 2VF4X 5TGDA 2P35A 2FGKA 3FI9A 3GLQA 1HFEL 1Q0LA 2YNMC 3GJ6A 2DFTA 2WIFA 4KQIA 3ZTWA 1YDWA 1V26A 2IHTA 4B4OA 4F4HA 4L3WA 1R5NA 4HEJA 1DPFA 2QD1A 1IRXA 4M8SA 3IERA 1FSGA 1AIPA 4CDGA 5FI0B 2RKWA 4RJTA 3NHRA 1WY5A 1RPTA 4Y1EA 4CKXA 1FFYA 4R1PA 4A92A 2DERA 1UKVY 2X86A 3EOAI 4L75A 3RK1A 1L5KA 3I28A 2RBEA 2PD6A 3B53X 4KRFA 3H2YA 4FQ5A 3QLJA 4J75A 4HRXA 4KE9A 2J4CA 4D8XA 4UFPA 5BUCA 1CUZA 3WNQA 1LNSA 1RR6A 1KE1A 1X3SA 3FTEA 1FTQA 3ZIDA 3SLGA 1LVHA 2D13A 4I4LA 4ME6A 5EPUA 4TL9A 3T0IA 5DW0A 4BE4A 3OFJA 4RZ3A 2ZJZA 1AMUA 2QHXA 4ZI5A 1Y1LA 2G4CA 2CY0A 3CRNA 4W6QA 2V6FA 1N78A 1XBTA 4ZVOA 2FEWB 3B51X 3CZMA 2R62A 3D6FA 3O8LA 4KN6A 4MQ6A 5FRDA 3ZDQA 5IHXA 3V1TC 4KXYA 4C43A 5SZIA 5KKCA 2VBGA 2VJLA 4MR7A 3OBBA 3CNQS 3LLUA 1T2VA 3ENWA 4LVNA 4WZAE 3S70A 2X4DA 5IF9A 3PP8A 1UH5A 3RAEC 2ZBEA 3DBVO 4YUYA 5JXHA 2DKNA 3LBIA 5F2OA 2VNAA 3TTUA 2V6GA 4BAZA 4DMFA 4C29A 5L4NA 5FWYB 4GZ5A 5FBWB 1BJKA 1I0LA 5FEUA 3R9XB 1N6KA 5C51B 4D97A 4MIOA 3STTA 1AUQA 1QU3A 1Y89A 1CNMA 2DE0X 4IM7A 1TGVA 1W0KA 2O8FA 1RWWA 3M9XA 2NO9A 1UJ4A 3RYHA 4AJ9A 5GOTA 3LCRA 4RHFA 4X0EA 1KRWA 1UZUA 2ZB2A 4PFSA 1IY2A 1S96A 4C0SA 2M32A 4QXQA 2LCQA 2OCPA 4PZEA 2BR3A 1CRPA 1KO7A 2AJDA 4L4RA 2BBWA 1CY4A 2ZT7A 3E1GA 5KAPA 1DC3A 1T24A 5B5SA 1IBKB 3LF2A 3AEYA 1Y6RA 4AZ3B 4O33A 1PL6A 3R6LA 4DXDA 4F3TA 2XNSA 1VPTA 3EOZA 1NL3A 2NACA 2HADA 1KEPA 3H5AA 1EVJA 2XD4A 2WUGA 3ND6A 3OUZA 4FR0A 1RWPA 2NV2B 1F8YA 2H9IA 3UHAA 3I09A 1PFGA 1ENZA 3HL4A 3EA4A 4M4SA 4UNQA 1KZ6A 2OHFA 3Q6MA 5FBZA 3TVYA 2FEMA 3VNUA 5KO2A 3L7BA 4II7A 5BOSB 4C4XA 5AI6A 1P2SA 4RGVA 1MAVA 1KPIA 3DBHA 3H86A 2X40A 2YCLA 3IPRA 5DKFA 5EZ5A 1T13A 3PF9A 1KQ3A 1KORA 1GTL1 1SU4A 1YQ9A 2D59A 3WHKA 2PMKA 3N0RA 3DV0A 4A23A 3CT4A 3STHA 4FGUA 5MN4A 1NKVA 4GE0A 5AVUA 2W2QA 2X7JA 2Q27A 2JHCA 1OBVA 5D01A 3G2NA 1DRWA 3CCFA 4X54A 4KN5A 5IC6A 4E1AA 5BMVA 1WU8A 4GL4A 5EJMA 1S6YA 2HQSA 3BFVA 3NI2A 3LW7A 4CGZA 3MS2A 4BRSA 2JAXA 4L4UA 2W6OA 3HYNA 4MP3A 4MS1A 5JQGA 1XXLA 2BFWA 4UMEA 4Y67A 4KFCA 2HSDA 1HZZC 3I9OA 3O8QB 3M3PA 1EXVA 1JLRA 2E49A 2QORA 2XR1A 1M8FA 1F8GA 3A1EA 4KP7A 4DJEC 5LD2C 2FJPA 1U5AA 2GI4A 4LECA 2ICAA 3DONA 5CLLA 4PVCA 5GZ6A 3JAKA 4Q3BA 2ALJA 3ZLBA 1O96B 4LSZA 3I1IA 1MPXA 3LRXA 3D7KA 4NZMA 2CBGA 5JCJA 1XTZA 2QZPA 4EPXA 3W2TA 2DCUA 3VTAA 4E4YA 3LX5A 4HH4A 1T5HX 1YL5A 3C1AA 1WNFA 2AMYA 2WKWA 3GO4A 5JLAA 2E4UA 4I5DA 2FR8C 3ONNA 2X77A 1KHTA 3HDGA 5TMPA 3ZHQA 3PE3A 1GO2A 1GPH1 1L9KA 2BC9A 4IDQA 1QHEA 4JVSB 2OCBA 3ZQ4A 1Y4DE 4JA0A 1ZBQA 1YCFA 4UVEA 1V8PA 2QQGA 4IH4A 5CD9A 1WM1A 3T7AA 2NG1A 2PA3A 4E5SA 2JIMA 3BSWA 1KRXA 3A25A 4HVAA 3KEQA 5AVSA 3QBEA 4E5NA 1L4GA 3KQPA 4Y7DA 3E22A 4YV7A 1F2TB 4KFSA 4L8GA 2P2YA 3OEEA 1QFJA 4LNUA 3TBHA 3CJTA 1GGKA 2W71A 3FW1A 3SSOA 4M9SA 3KZXA 4L50A 2NO1A 4NS1A 2W2KA 3GIDA 3FZYA 4WADA 5LCXA 4PGMA 1Y4AE 4FSDA 3D6VA 1SPXA 4MXDA 3AHIA 1ZMBA 1XJCA 1RQGA 2IZ6A 2YBEA 1T9GS 2XAUA 3QTBA 4G41A 1P9LA 1QV6A 2WT9A 2JKVA 1JHOA 2R4TA 2X0KA 5J5CA 5FAKA 1MX3A 1NDQA 3QPAA 3DEJA 4DAEA 1ILWA 1LWNA 2J0UA 5DP1A 4CMCA 2F3TA 5L95A 4J1QA 2FLWA 3D2CA 3ZHUA 3BD8A 3DV2A 4FOLA 2VYVA 3IJ5A 3NIWA 3O31A 1MXHA 4FDUA 2VF7A 3DM9B 1M0EA 2JA1A 2F1HA 4ZANA 3NTQA 4FHGA 3CEMA 1YI8A 3VR2D 1ZJWA 3RLFA 1H1LA 1QO7A 3JASA 1WZIA 4R0VA 3NHZA 1KSFX 3K9HA 5EIOA 5TEVA 3U7IA 1LC0A 3RIHA 3H9UA 4LC1A 2YXLA 4H7DA 2BZGA 1ULAA 1KJ9A 4LDPA 4JV5B 2QL5A 3R24A 3I8XA 3PR3A 1UODA 4MI9A 4JITA 2VKQA 4BBPA 4OBBA 3SX4A 1PW5A 1DWQA 3E1KA 3OCVA 3LHKA 4K26A 2JHGA 5K0ZA 4PCAA 1GN8A 4TT8A 4V02A 4JQOA 4MVJP 4Q9HA 3W5SA 8ADHA 5JPDA 3Q8LA 2W48A 5CPFA 4QWWA 1P74A 3JTEA 1W2HA 2DC1A 1Z0UA 1G66A 1Z2DA 3HCWA 1T9KA 3IRUA 4MV8A 4IMRA 1ESMA 1GRNA 1L7DA 5DBEX 2QVZX 3ONFA 5AKZA 4D80A 2YNMD 1R4NA 3QUQA 3PDHA 1A4RA 1W4ZA 3LMKA 2JCBA 4OBWA 3RGWS 3TPFA 5BQFA 2F7SA 4K6KA 3LUPA 5DO9A 1GGFA 3LGXA 3TOZA 4U9IS 4JLVA 4X1OA 4YDQA 2WAXA 2ARKA 1IUOA 1XUOA 2IPOA 3ZI4A 4BO3A 5DYYA 4LOJA 4F12A 1LBQA 1GZ5A 5FPHA 3MPUA 3UWMA 5HRAA 1YQWA 5EJ8A 4F5WA 1BCSB 1SEVA 2HUNA 2HY7A 2JI4A 4XW2A 3WWOA 1NFFA 1SBTA 2QB5A 4E7PA 1KOFA 1JALA 4HVTA 1LPSA 2G9NA 3RC7A 4FNGA 1YA4A 1E1QD 3G02A 5HQJA 1N1GA 5IJWA 3LOUA 3F8WA 1OXMA 3PNBA 3P2MA 3WRXA 3IESA 3W79A 1RBQA 2FK7A 3KL2A 1CSEE 2OKGA 2QX7A 3PT5A 3PS9A 4LJ8A 3QEMA 4QOEA 4RELA 2GZ1A 4JXZA 4MICA 3KYDA 3KL4A 3MJVA 3FSGA 4B9AA 1Z5OA 3F6RA 2KI5A 3LIPA 3P4XA 5MHTA 1YD7A 3FNGA 1EX7A 2ANCA 1OWMA 2OM6A 3BJRA 3F9RA 1UQUA 2ZI7A 3KQLA 1KEVA 4RIIA 2OO7A 1PYOA 4K9SA 1NRXA 4NJMA 3PA6A 4RWZA 1G2PA 4YCBA 3OPVA 4P80A 5ICEA 2Q28A 1IOZA 2XMZA 1ECGA 3A8TA 2XZTA 4E4RA 2VRCA 4JXKA 1MC5A 4RTQA 2QBYB 4F71A 1C0EA 1TZBA 3VBCA 3KB1A 1PHRA 3PEFA 4G3XA 2FDCA 4DJJA 3N75A 4Q48A 5MDHA 2RARA 1U0NA 1DDOA 3EIWA 3VXKA 3UXYA 4YCSA 2NO5A 2CVZA 4OQPA 1USWA 4K28A 1X13A 1CZUA 2CNWD 2C8VA 3HUEA 2GAAA 4X1IA 3TM5A 1NX9A 3GNQA 3HCDA 2ODBA 2QVYX 1MB2A 1XN4A 2P8SA 4X8MA 5LBUA 1W75A 2EJUA 2WZBA 2EFGA 4UARA 4N8EA 5T64A 5KDOA 3HJNA 4B3RB 5KU1A 2ZUCA 1KK3A 4QE3A 3D8SA 5LBIA 1VA5A 3N2IA 4M36A 4OSEA 1N9GB 3SZGA 3IT3A 2YWXA 2GFQA 4UM8B 1T4GA 5CM9C 4BQPA 1ZMOA 1PUXA 1EWYA 2H31A 1IOWA 1DQSA 1IHDA 1O6BA 1V37A 2WQ6A 2DR3A 1NXSA 2J59A 1HL7A 1NRWA 3EG9A 4Z3KA 2IDMA 4MR7B 1U5CA 3AP2A 4X92A 1LFDB 1UR5A 1U9CA 1ZFNA 3ET5A 5I7OA 2YJGA 4JSYA 3BWVA 2D7CA 4C3OB 1DJLA 2HL6A 2ZVDA 1ADCA 3KJQA 3LJKA 2O4UX 2AVNA 2KLBA 1T9CA 3MD0A 4PZ9A 4UZFA 4YA6A 1NZJA 2L18A 2O8VA 5EJAA 4JVLA 2NU8A 4KO3S 2YHIA 3KQSA 5ALLA 1MDFA 1R0YA 2JGMA 1U2PA 4OUDA 4QUDA 2UKDA 2XLBA 1IJFA 4QDXA 4YB8A 2TYSB 4U0JA 3T1QA 2JLSA 3KVRA 1BROA 1CUEA 1NQOA 2G9RA 4TMYA 5AW6A 4XR4A 3HYCA 2B25A 1YVPA 1JFRA 1JVNA 3L7AA 4R41A 3UPDA 1DPGA 3BE8A 3K31A 4OQNA 1RAFA 3AH8A 3IDZA 2PJZA 1OC2A 4AM8A 4MV7A 2CNOA 3AV0B 3O3OB 3GN1A 1V47A 3W0LB 4TSFD 5HKBA 3CEAA 5TPZA 3W2HA 4AJHA 4DJTA 4M8KA 2XT6A 3NV7A 3VNBA 1FQOA 3A1VA 3ZCQA 1R9MA 4HQRA 3CPHA 2I8AA 4PHCA 3EXHB 1KARA 2PRKA 5KHOC 4F85A 4V0LA 1H4TA 1PR6A 3GJ3A 4RZQA 3ZWOA 3ND8A 1MX1A 4DUGD 3OECA 2PWZA 2DUUA 3A11A 1ZK1A 2MJLA 5AT1A 1P5ZB 1R18A 3OZGA 4B44A 4BMZA 2OQ2A 2XKAA 2PR2A 1FB5A 1GPBA 3KUXA 3R5TA 3X1MA 4EFDA 4EITA 4P2BA 3X1KA 5F2NA 4I1UA 4Y2UA 5HKAA 1M0TA 1JT2A 1MQAA 1NMXA 2C92A 1IZ7A 2J0VA 3BQ9A 3G85A 3OCYA 5HCNA 2JAOA 3TUIC 1VIYA 4CT4B 2MSDB 4U2BA 3S81A 2PVCA 3HUFA 1E60A 4LW8A 1ZRSA 3UVEA 5KSZA 3A1TA 1EX9A 4CG0A 1OV6A 3C7DB 3DV0B 4OLHA 3AHCA 1K98A 4IIJF 5IHPA 2I22A 4DQKA 1NNEA 1KHHA 3DT6A 3B36A 1VYVA 3DEHA 1ZY2A 3ZN2A 4DNXA 1MUUA 4AULA 2NSDA 4KXLA 1JL3A 5BOVA 3ILHA 4GD3Q 3MSXA 1C3JA 3QELB 2BRUA 4M3NA 2WW8A 3MTQA 4BTEA 1JEEA 2ADMA 3F7NA 3UF0A 3ZCSA 1KZGB 1TMGE 3HR7A 2CB9A 2A92A 4G0YA 4OH7A 4TYMA 3CZPA 4MS1B 1YGPA 5JQGB 1AQNA 4MV5A 2ODQA 4UEWA 5EJ9A 1YI1A 2J5XA 4RW0A 4DIDA 4UHKA 1VLLA 2OCXA 5ANRB 1CYDA 6YASA 2JJMA 2X6RA 4CJXA 1EFRD 2W2LA 3GROA 3NOQA 4TKVA 3DZKA 2WQZA 4LZLA 4BBZA 4NK4A 3CZRA 3R0VA 3JAKB 2HU8A 4TLEA 4FX2A 4TMZA 1PNVA 2YDYA 1TVCA 3M6UA 2JVKA 3OMLA 4B4KA 1KOGA 2AYZA 4FEAA 5FOXA 3RSCA 1WG8A 4XX0A 1EFTA 4KNWA 3GEEA 4NS4A 3PPXA 1NP3A 4C4YA 3WFJA 4WINA 5DI3B 2BGWA 5HCIA 1NT4A 3NNSA 3WB0A 4G6ZA 1WDTA 5D3ZA 1L7MA 1UM9A 4DEVA 3KSAC 2AG0A 1CDDA 1R0BA 3RC3A 4QOJA 2Z8ZA 1WDMA 2AK2A 3DBLB 4UHCA 4JBLA 3E61A 4KK3A 1JEAA 4DIEA 5JC1A 4A8JC 1ORTA 3L4EA 4W8GA 4ZA2A 1FTNA 4XUCA 4IDPA 4BBAA 1DBPA 1WAMA 3NVDA 4IMPA 1EXDA 1N3IA 1NNUA 2ZJ2A 1D2NA 3U0BA 1AKNA 3U7EB 4LE2A 2HCTA 5I4CA 1FW6A 2Q1SA 4OMUA 5COAA 2V45A 2QVCA 3E22B 4ZZ1A 4ID3A 4JB8A 4LNUB 3W1WA 5AIBA 1OPXA 5HP4A 5JDIA 5HCUA 1QPBA 1RRCA 5IAOA 5M5BA 1JEYA 1VPVA 1GG5A 4BUZA 2VP2A 2NV6A 2AMJA 3ZLUA 1FDOA 1Z18A 4QUKA 1G9XA 4U63A 1SFRA 5U4QA 5FBHA 2D5IA 3VZCA 4G8DA 4BECA 3BK1A 4JU9A 1A9PA 3NTLA 1L1FA 1DX6A 1QGUB 1DXHA 1IB6A 1K75A 3PX3A 3NKFA 3WGHA 4JK3A 1B74A 2HLPA 2J0UB 3UM9A 3NBZC 3OETA 4MUBA 3R7WA 1NBAA 4HB2A 4EB3A 1K7EB 1OXTA 2J8ZA 3JY6A 1HDZA 3LBAA 3MB5A 3UC9A 2F2TA 2G76A 3CLTC 2I55A 4I9UA 4N3BA 2P40A 4QPZA 4R0NA 3T4UA 4MVJG 4QUAA 3MTIA 4C4OA 2AOUA 5KTYA 4UVGA 1MFPA 5A2QA 5LMZA 2FUNB 1I3OA 1XTRA 4PIPA 4DAOA 4KB5A 4CL8A 1GUDA 5LXTA 1XFDA 3N2YA 1OXSC 1ZJJA 2P7HA 2VPXA 3OFNA 4R9RA 2O3RA 3TCKA 3R6WA 4BO8A 1ZR2A 4H4DA 3DMTC 1BXRA 2PEYA 3SOPA 1BYIA 3C8UA 4NARA 1M83A 4ZAFA 4CE6A 2P5SA 1JA1A 3RF7A 5A0TA 3KB2A 4DLRA 2NZWA 1B8VA 2I2AA 3FXAA 3GNTA 3E0QA 1ZXXA 4E12A 2G0NA 1IM2A 2IY8A 3JATA 3SKYA 5A04A 2HNAA 1WZNA 3FHCB 4H4EA 4A0GA 5A0FA 1R37A 1ZM7A 4R2IA 4C5CA 1PWHA 2Z04A 3V32A 4KH1A 2GKOA 2PMEA 4N41A 1M1YE 2YZNA 3B6KA 3QOYA 5D7BA 4G5YA 4FN5A 1C3XA 3DPIA 4GGOA 4H16A 4PCUA 5IBRA 2JH8A 1CV2A 4NOJA 3HK2A 4I81A 1R4NB 1E2NA 3E82A 3PPWA 1T1GA 2DFVA 4R3WA 4PAGA 4KN9S 4MTLA 4BNNA 1XNRB 2HJWA 4NH0A 1QYWA 1ND5A 3LFUA 4DXHA 1LH0A 2EW2A 1I6LA 3FSJX 3WV5A 3PSAA 3OIDA 2WTAA 1LSUA 3G7UA 4RTRA 4C7BA 1SHKA 3AG5A 3I23A 2O52A 3LWZA 2XCIA 4HLCA 4K05A 3UW3A 2WSIA 1RT9A 4D41A 3HV2A 5F1OA 2Y99A 1JVSA 4AK9A 3I76A 2QL9A 3RS5A 3IEIA 5JJ5A 5D1NA 4MO2A 4CDMA 3T5DA 2AN9A 4OREX 3R76A 3PNKA 3RFUA 2QVLA 3LY8A 4LK2A 5IJ9B 2NYVA 4DDHA 3C85A 2ZP1A 4LGMA 5JAIA 4W9MC 1L1EA 4M1OA 3FNHA 1BE1A 1W85B 1YNSA 2H7XA 2GM9A 2R6HA 2ZI4A 3G5TA 3LL7A 3PJGA 4FFDA 1R6UA 3FPLA 2X0NA 4MEAA 4PEVA 5EYPA 2XIQA 3VUFA 1ZQ9A 4L8WB 2P6NA 2QSUA 4ITRC 1E1YA 3QEMB 1PIWA 3PDUA 4JUFA 4NSNA 3TRHA 4A91A 1VFNA 4I14A 3KYDB 5DLPA 4MS3B 2GN6A 2WIBA 5KQRA 1GZ3A 3GAMA 4TS1A 5JU6A 3TW4A 3LNCA 1F6WA 1W19A 5HEKA 1E2EA 3PC8A 2QG6A 3IAXA 1TCVA 3P9KA 1ZGAA 1SZDA 3D1JA 3QKWA 4FILA 4KQKA 1UDWA 1NDUA 4NJMB 1RI4A 1G7SA 4XQCA 5FBKA 4BGVA 1V6SA 5EE0A 5JNUA 1NPYA 3NYQA 1JA9A 1OY1A 4QQRA 4UREA 4U2DA 5DTMA 3PU6A 4CUKA 4DLVA 1UM8A 2GB4A 1EDBA 5DGXA 2D1RA 2VUTA 3MJHA 1LS1A 3QIVA 1FLDA 3IVMA 3W5VA 3FHLA 4Q4JA 3NPMA 1GSAA 2OHVA 3EZ7A 2VJYA 1JBKA 4EKDA 3N58A 3S44A 3T7RA 1RWBA 2AXNA 2OEPA 2IK8A 4X1IB 3ADPA 2GMWA 1E3WA 2PR7A 5CXXA 4DT1A 5DT2A 2IWHA 3WRWA 4QOSA 2RG7A 2OCYC 1PF7E 3ZHBA 2X5KO 1XKLA 3HJCA 2BJHA 4I5FA 4RDHA 3F96A 1V8FA 3KOYA 4RZHA 4B71A 2JI8A 2UYHA 4H15A 4IMJB 5KJ6A 3E3OA 3U31A 4FFNA 2IHVA 2RH4A 3E5HA 3HHEA 3NFYA 1RU3A 1I5RA 3GA0A 3IAM1 3UFXA 3ZV6A 2XECA 2FZCA 1WZUA 4IQGA 5LQSA 1X7HA 4GZMA 4BNUA 1JILA 1CR4A 2IXEA 4H4CA 4Y9RA 2FRDC 4QUBA 5D87A 3Q7QA 4CM9A 1V35A 4PLCA 3FR7A 3BB1A 4U7TB 1P39A 1I1NA 4H3VA 3ZBQA 2RFLA 1U31A 2CUTA 3D3KA 3UT5A 4CT0A 2VLIA 1I7PA 2FHPA 2GK4A 2QXYA 1C1HA 2WHEA 1NF9A 4GBGA 4I4TA 1XMJA 2HT1A 3QYFA 1CB7A 3VC7A 1U2TA 1OBOA 1CJUC 4BVLA 5H3HA 1EUQA 1SC3A 3DLAA 3GUVA 5EP1A 2ZJFA 1RE0A 2O3TA 4OUDB 3MGKA 4PQRA 4YONB 3ZHTA 3K1TA 2IZOA 4DJDC 3DOOA 1T5IA 5HRUA 1CNEA 4FUTA 2CDRA 5BNFA 1JAIA 3W1EA 3IEVA 1RS0A 1U1FA 2BI4A 2ZS9A 2DPMA 3FDZB 3FI0A 3A2LA 4HDQB 4KFRA 3SKXA 2QUJA 4ENRA 4G5HA 1PDOA 1XA0A 1V41E 4HZGA 4H7EA 5K09A 3ORQA 5SY9A 1NE7A 3ZNNA 2J4DA 3RVDA 4H1HA 3T8YA 3OOEA 4K1XA 2CVFA 3L1UA 4RM2A 5KUTA 1ONBA 1S9HA 1UBGA 1SCKA 4O2RA 3ABZA 2KYRA 1XDZA 4D9FA 4H6VA 1O9HA 2PWAA 5DVZA 1DAMA 4OX9B 5DHPA 3U19A 3QPDA 2PZLA 5J4KA 1QAMA 4FW9A 2O1XA 1MR3F 1ODLA 1RVV1 3D8NA 3Q2OA 1X7WB 4C0BA 4EY8A 4DR6B 1KYIA 3TQOA 1E9FA 1Q44A 2A9OA 3KPJA 4LWQA 4KQ2A 5AJWA 4CHGA 4DLBA 4Z7JA 5A3RA 4CIYA 5J23A 1TCUA 3WO0A 4W5WA 2X41A 3CGGA 4IWNA 1WZ2A 3LDAA 1UMCA 4M8IA 4GP9A 4YP5A 3TNYA 1T5TA 1NVGA 4LC0A 2P6UA 2G25A 2JK0A 2DECA 3FCEA 2DQYA 4O2AF