1BD8A

Structure of cdk inhibitor p19ink4d
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
b'RAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19INK4D CDK4/6 INHIBITOR
publication title Structure of human cyclin-dependent kinase inhibitor p19INK4d: comparison to known ankyrin-repeat-containing structures and implications for the dysfunction of tumor suppressor p16INK4a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Tumor suppressor
total genus 46
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bd8A00
4HRMB 2F8XK 4YDWA 2F8YA 2QYJA 3KEAA 4LSZE 4U96D 3TWQA 3UI2A 3DEOA 5ENTD 4A63B 4HRNA 3JXIA 4K5AB 4K5CA 3Q9NC 5ENPD 3NOGD 3F6QA 2V5QC 1MYOA 3Q9UC 1BD8A 1MX6A 1YCSB 2XZTG 4F6RD 3C5RA 5EIBE 3SO8A 3TWUA 1IXVA 4U8YD 5KBAA 1DCQA 5KNGA 4J7WA 4HI8A 4O1PA 4U8VD 1YYHA 4TUMA 3AAAC 5CECB 2V4HC 5ENQD 3V79K 4U95D 2DZOA 2RFAA 4BERA 4N5QA 4O60A 3NBNB 3ZUVB 2XEHA 1BLXB 1UOHA 2KBXA 1BI8B 3B7BA 4QFVA 3HRAA 5CBOA 4LG6A 4DRXE 2AJAA 3TWSA 4OAVB 3EHRA 2B0OE 2J8SD 5AQAA 2MYOA 3B95A 4Z68A 2VGEA 4HLLA 3AJIA 1MJ0A 3ZU7B 3J5PA 4O1OA 4DX2A 3EU9A 2FO1E 4ZFHA 1K1BA 2BKGA 3JXJA 1WDYA 4HNAD 4HQDA 1K1AA 1N11A 4K5BA 5HRYA 2ZGDA 2JABA 4G8LA 4ATZD 2ZGGA 2RFMA 3UXGA 4BESA 2XENA 2A5EA 5CEDB 1IKND 1G3NB 5AQBA 3W9GA 3TWWA 5HKPA 4ZHBA 4QQIA 3V31A 5JA4D 2ETBA 4GPMA 5CBNA 3TWTA 2P2CP 1YMPA 3V2OA 1MX2A 4DX7D 2PNNA 2DVWA 1QYMA 2XEEA 4HB5A 5D66A 4GMRA 4NIKA 5EILA 1SVXA 5FINA 3T8KA 1MX4A 2XZDG 4HRLA 2BKKB 2QC9A 3TWXA 3V2XA 2Y1LE 4CZ2D 4YDYA 2DWZA 4BSZB 1OT8A 1IHBA 5BXUA 5CERB 5JMND 5AN8A 4BEPA 1BU9A 2DZNA 5AQ7A 4CYMD 4HI9A 3ZKJA 5ENRD 3LJNA 4G8KA 4HBDA 3V30A 1WG0A 1D9SA 2KXPC 1K3ZD 3T9KA 3TWRA 3TWVA 1NFIE 4LNUD 5HS0A 1SW6A 5AQ9A 3NOCD 4C48B 1N0QA 2HE0A 4DX5D 1N0RA 2ETCA 3J5QB 5EN5D 5AAOA 4DX6D 4RLYA 3HG0D 5EYLA 5KNHD 5KWDA 5ENSD 2F37A 2NYJA 4B93B 2Y0BG 1AWCB 1OY3D 4OAUC 1AP7A 3JUEA 3W9FA 1A5EA 4DUIA 4BETA 4UUCA 5AARA 5EIDA 5ITZF 1TR4A 2L6BA 5CEAA 5EYPF 2ETAA 4J8YA 5ENOD 5BXOA 5FIOA 4JB8P 1BI7B 4F1PA 3IXEA 3DEPA 4DX1A 1S70B 3EHQA 3UTMA 1DC2A 3D9HA 3ZNGA
chains in the Genus database with same CATH superfamily
3ESLA 2J09A 1XGWA 3MZLB 4WUYA 3AS5A 4GA0A 3CSFA 3DEOA 5DIZA 3ASHA 3QJZA 3SO8A 4U0SA 3EHNA 4O1PA 2VSNA 5G04C 2V4HC 2HYZA 3PDNA 1QBQA 1BLXB 1UOHA 3L17A 3UT7A 1L5JA 3ASOE 1JCQA 5CRVA 2AJAA 3S7FA 2WQ7A 1E90A 3LPZA 4HLLA 2I2OA 4JHJA 4GZDA 3ULQA 3FULA 5HRYA 3U66A 2ZGGA 4MBGA 3VTXA 3W9GA 3L82A 4EBAG 4QQIA 4DI3A 4H7XA 2UY1B 4IN3B 3T8KA 5FWQA 3TWXA 2DYSE 4GZCA 5KJNA 3S7DA 4IRUA 2DWZA 4CT0A 2XS1A 4UWHA 4RG6A 1N9AA 4N2SA 3NOCD 1OUVA 4I2ZA 2KZTA 3QC1A 4RLYA 1KZOA 2QZAA 3FFLA 3Q7AA 4CDMA 3FEXA 1HXIA 2R05A 4HLEA 2AWIA 1SQMA 2CG3A 4L2LA 4UUCA 5AARA 1DNPA 1PAQA 1KZPA 3FTWA 4DK5A 1BI7B 3JCKC 4JHRA 3PZ4A 4XKCA 4KVOA 1X5BA 3D9NA 1NI1A 3CVPA 3KAEA 3RIBA 3ASFA 4GU5A 4LEUA 1OXJA 2C0LA 2XPIA 3DSVA 2DZOA 4NRHB 2I9CA 2J4DA 2LSUA 4L2YA 2XEHA 4AY5A 3AS8A 3B7BA 4APOA 4XEIG 4Q96A 3ULYA 5FZQA 1MHQA 1OWPA 4GTRA 3PNTB 3ZEFA 1N95A 2LUHA 2X6JA 3HVEB 5BV0A 2GRNB 4G25A 1TJFA 1IQRA 2E0IA 2Y4TA 3SI5A 4GZ6A 3DRAA 1YMPA 2Y3AA 3BQOA 4DX7D 3PUJA 2AVPA 4GZ5A 3R9MA 1H6OA 1WY6A 4CZ2D 3CSTA 5AQ7A 3HXEA 4FC8A 3EUVA 5ARGA 2KC7A 2EIKE 4DJAA 1ELKA 3UKRG 4BT8A 2WXOA 1MQSA 3FUJA 2FEZA 3MKQA 4GPKA 2XGOA 4UI9K 2CHXA 3Q7FA 3CHPA 3D9IA 2A4ZA 2OOEA 4C0EA 4GYWA 2Y69E 3CVNA 2WXNA 5B3SE 3B13A 4JPSA 2OEVA 4KZ0A 1A17A 1NA3A 5KBAA 3FU5A 3LY7A 3RSEG 1UN8A 4O60A 3U3WA 1JCSA 5EX3A 4B94A 4JW1A 1BI8B 3DPYA 3HRAA 2VGXB 2B0OE 4I9EA 3CVYA 3AJIA 3DSWA 4M3OA 2FULA 1FT1A 3JXJA 2BTDA 2LXMA 2EIJE 4ANXA 3ESKA 3U4TA 5D0OD 2J49A 1UJKA 3IHYA 5T4YA 3UT8A 1SA5A 3S2AA 3E33A 3OAWA 4AM9A 1HZ4A 5BPPA 3UUXA 3O4ZA 4I6EA 4N3AA 5FQ4A 3Q4AB 2I1KA 4HRLA 3SFZA 2X6FA 1H2UA 2AXZA 4HS2A 4CRWA 1O1SA 3CEQA 3ISMC 4EPZA 3J5QB 2Y0BG 4E85A 4DUIA 3D9JA 3LY9A 5BXOA 4HORA 3JQ1A 3C98A 4ANWA 2X6HA 1FVFA 4YDWA 2UY1A 3QWPA 2VTBB 4XKBA 2L9BA 1U2VG 1IHGA 2RKKA 3JXIA 2WPVA 4GAAA 4U7EB 5A7DB 4AEZC 1NA0A 3MV3B 2V5FA 1YYHA 4UQYA 3Q15A 2GROB 4TXQA 4IULA 1Z5SC 2EINE 3CQCB 2FBNA 2J08A 3FHEA 4OAVB 4I6GA 3DSTA 4B0ZA 2MYOA 1EPUA 3I5PA 3CK7A 3ZU7B 4I43A 3Q79A 1ELWA 2OEWA 4YVOA 1KPSB 4G8LA 4ILGA 3BU8A 2A5EA 2R2LA 4F7AA 1INZA 2I1JA 4CGVA 4EZLA 1TJCA 4XZ4A 4BTAA 4A55A 2GRLA 4ZHBA 3V31A 1TNBA 2L0TB 4PS8A 4AJWA 3MV2B 2GGFA 3HDXA 1XNFA 4J8DA 3DSXA 3ML8A 4CYMD 2XRZA 4G2VA 1N4SA 1RW2A 3ZYQA 2C0MA 3D3MA 4KBQA 4CDRA 5KWDA 1TNUA 4MS6A 1OY3D 3T5XA 5HQ8A 1NZNA 3JUEA 3G2TA 3ZYKA 4BETA 2JEKA 4KMOA 2BF0X 4FA6A 3UM3A 4C0MA 3HVEA 4KT6B 1HF8A 4FLBA 4L1BA 3T5VA 4LSZE 4U96D 3RAUA 3CVXA 5G05J 1FT2A 4A63B 3CVVA 5JJ6A 5ENPD 3NOGD 1MYOA 1JCRA 1BD8A 5JJTA 4UI9J 1MX6A 2HR2A 2DCPA 4F3VA 1UG3A 2JLBA 1HU3A 4WWOA 4J0UA 2GRPB 3LVRE 5CCLA 3CVWA 1Z6TA 2NSZA 4BSXA 3G2WA 1OCZE 2VSYA 3ONKA 2WVIA 1EDUA 5AQAA 3B95A 2WXKA 4DI4A 4B8CB 4BT9A 3UINC 4AV7A 4ATZD 4WNEA 2GRQB 2VJ8A 2RFMA 2XENA 5E76A 5AQBA 3CGHA 4HB5A 3QK0A 2MHKA 1E8ZA 5BXUA 2BUGA 3FUKA 3PVLA 4GCNA 3TXNA 2DZNA 3JUIA 5ENRD 1D9SA 1NFIE 2WXMA 4GA1A 2XCBA 3ZW3A 5G05C 3BG0B 3FUEA 2QY7A 2VGXA 4UI9C 4KYOB 4LNGA 2B6CA 3LEWA 5EYPF 4I1MA 3PZ3A 4I1AA 3D9PA 4U63A 4U0UA 4WNFA 2QFCA 4EZJA 4W9RA 3EIQC 2VQ2A 3RO2A 4GTQA 4WAFA 3PZ1A 1ELRA 2F0YA 2H6IA 5D2MC 3LVQE 2LAHA 5AJLA 4GTSA 4PUCA 2WQ6A 4U95D 4UWLA 3CV0A 1O1RA 3L13A 3LS8A 2R02A 3GZ1A 3QNKA 2V0PA 4GCOA 3EHRA 4GTVA 4MRUA 3AU4A 3TXMA 1SZAA 4NACA 4RG9A 4UWKA 3NZSA 3KSLA 2FO7A 3OXGA 3FUDA 1G3NB 1W3BA 5FZRA 2V4LA 2WXIA 5HKPA 2OCCE 3BEEA 4OVUA 3C72A 2IFUA 4Y6WA 5C1DA 1QYMA 3QWVA 5BT1A 3QAQA 1MX4A 3X2QE 4ACLA 2IO3C 2KCVA 4YDYA 5JMND 2IF4A 3HXDA 1BU9A 5FJYA 2NXPA 4C48B 4WWPA 1N0QA 1N0RA 4TRQA 4HOSA 3HXBA 1H2TC 1TN6A 3SHFA 4TUUA 4OYSA 2J07A 3KEZA 1E8WA 2BEDA 3L22A 4J8FA 4JB8P 2E2EA 3R7RA 3FTSA 3ENEA 3ZNGA 2DBAA 3KEAA 3JYSA 3RRUA 5M72A 3SF4A 4HRNA 2LAIA 3LKUA 4UQXA 4FHKA 3ZYLA 4BWRA 4J7WA 3CVUA 5G55A 3V79K 4UQZA 2RFAA 3SD5A 4TV3A 3EHMA 2X6IA 3CK8A 3CVLA 3Q5MA 1H6KA 2EIME 3KD7A 5T3RA 4RVBA 4DRXE 2C2LA 3DSUA 5BW8C 4GMLA 2VGEA 4O1OA 3AG1E 5CHEE 5DBKA 3LDZA 3FTUA 4I1OB 3HXCA 5CEDB 1SZ9A 3TWTA 2WB2A 3RU0A 4JL0A 3ZRHA 3V2OA 1NL4A 2XZDG 2WXQA 5LX8A 3PNLB 1OT8A 1NP7A 3EU5A 4LCTA 3ZGQA 3ZKJA 2YHCA 1WG0A 2KXPC 2HE0A 4DX6D 3LXUX 4GMJA 4AIFA 3S7JA 3ZN3A 4HFGA 1OCOE 1ZU2A 4A1SA 2WM9A 3GW4A 4J8YA 5ENOD 3UIOC 3NQPA 4PS3A 5JHAA 3OTNA 1DC2A 2F8XK 5JJ7A 3CR3A 4K5CA 3MYVA 5E75A 4F6RD 2AXVA 3LJ3A 1DCQA 3ASGA 2FF4A 4U8VD 5FZSA 4BTBA 4N5QA 5KCMA 1JUQA 4HOQA 3FTXA 4Z68A 1E8YA 4XIFA 2ZU6B 3KSQA 3OXLA 1OWMA 1QZ2A 3ZFWA 3FUHA 2KCKA 5ANRA 3LYAA 2A5UA 2ETBA 3DSSA 3SZ7A 4GMRA 3S7BA 1SVXA 2ILRA 3RO3A 4XX5A 1H2VC 4U04A 1K3ZD 2LSVA 3DBSA 5JA4D 1S63A 2GW1A 3MEKA 4HVBA 5KNHD 2F37A 2NYJA 3DXKG 2R59A 3EHQA 3UTMA 4V3IA 3PEVB 1HG5A 1UJJA 3N71A 5B1AE 3PE4A 3ZXSA 2PM7A 3E32A 3FH8A 3WG7E 1LD8A 3EJNA 1HS6A 2XZTG 2GRRB 2WXPA 3TWUA 2XGSA 4TUMA 3FU3A 2H6HA 4BY6A 5KJKA 4ANVA 3PH0C 3RJVA 3ZHEB 1KT1A 3FTYA 2YINA 3D9MA 2XEVA 3TAXA 3HYMB 3CK9A 2FO1E 1TN8A 4HQDA 2WXRA 4G11A 3UM2A 5A23A 1V54E 4RSYA 3U64A 3TWWA 2X38A 5LP0A 3CVQA 2DIWA 1N94A 2MRIA 2X3MA 3OXFA 2X6KA 3CHMA 1HO8A 4UWFA 3MCXA 3V2XA 3CHQA 1QNFA 3SGHA 3QB2A 1IHBA 3AG4E 3UT4A 3HXFA 5AN8A 3Q49B 2KATA 3TJPA 3V30A 1E96B 5KJMA 3C3OA 2IEJA 3DPDA 2KCLA 2XQ0A 5EKQD 3UM1A 4EQFA 2WXLA 1A5EA 2HO1A 5ITZF 3G2UA 5KJLA 4XE0A 3IEGA 3PS6A 4DX1A 3D9KA 3FEYA 5EX0A 2VSXE 3BUAA 3L08A 3TL5A 4WNGA 4ILIA 3Q9UC 3PEUB 1LTXA 3UMVA 3ZXPA 3IV0A 2IQCA 1H19A 3AAAC 3FDHA 3FP3A 5AIJA 5AJDA 3VLEA 4BX9A 1N4RA 2KBXA 2P58C 1OWLA 1TN7A 4GYOA 4CGWA 3CIAA 1EYHA 4I2WA 3R9AB 4R7LA 3UX4A 2CHWA 3L9TA 2V8SE 4N3CA 2OV8A 3VLDA 4MKTA 3KS2A 3E37A 3UXGA 3ABKE 1H0AA 4XI9A 2ZISA 2WMNA 4JC8A 2ZXWE 4JD2G 1D8EA 2Y1LE 2PL2A 2J4BA 2M63A 1Z3XA 3LJNA 1LF8A 1KLXA 1TNZA 4I9CA 1SW6A 1O5MA 1E8XA 3IBEA 3CKCA 4OAUC 3SY2A 3RK6A 4WNDA 3MKRA 4ANUA 4L7TA 3APCA 1WAO1 4F53A 5FT9A 1Z3YA 4FP7A 1UW4B 5EDSA 4HRMB 3Q78A 5C2YA 2I6HA 2ONDA 3ULEG 4AVXA 4RQIA 1EF1C 3FUNA 3GZSA 2MOWA 3F6QA 2R03A 3IHVA 5T8IA 3I3NA 5LFAA 3B7SA 2YHEA 3FU0A 2XS8A 5A6CA 3FH7A 4JXTA 3ASDA 1YA0A 3I4GA 5CBOA 3QARA 3TWSA 5FQ8A 3GYZA 2IO2C 5ARFA 1FPPA 4GYYA 3AG3E 4HNAD 4A3VA 2AXUA 1HE8A 4P29A 2CFZA 4JEHA 3SFXA 3T8MA 1K8KG 4DLQA 1X81A 3ABLE 1MX2A 2PNNA 1VDYA 4NIKA 1FCHA 2IOLA 3LCAA 4ATGA 4FLHA 3B7TA 4UWGA 4TXPA 4M7CA 4HI9A 4HBDA 3TWVA 2VTBA 5HS0A 3ZHEA 4GZ3A 2PQNA 3VTYA 5EYLA 3FY4A 2AW6A 3AS4A 4HOUA 3W9FA 3RRNB 2NC9A 4AOFA 5FQ7A 4NQ0A 3CHSA 1TYQG 3QOUA 4L9PA 5BNWA 3MA5A 4J8SA 2PQRA 4L23A 3G2VA 1N52A 5LOZA 1BPOA 1TNYA 3ONLA 4G23A 5EIBE 3C5RA 3E30A 2XHEA 4WWNA 1IYGA 4GB9A 1PC2A 4CEMA 5ENQD 2EILE 4G24A 3ZUVB 1HFAA 2FI7A 4FULA 3ZVVA 4QFVA 4O6FA 4BX8A 4E6HA 4ME2A 1MJ0A 4G26A 5IY5E 4ZFHA 3B7UX 4IYPA 2IY0C 1S0PA 3FH5A 1E7UA 1OWOA 3SFYA 2H6GA 1JWFA 2P9PG 5BUZA 2WQHA 4G8KA 1FVHA 4N39A 1S64A 5CCMA 1WM5A 5CERB 2ETCA 5EN5D 2R5SA 2OVBA 2WXHA 4EZKA 4LUNU 1SA4A 4K03A 3ZPJA 5J90A 3O48A 3UM0A 2XRYA 3D9HA 2CFUA 3UKUG 5ENTD 2VGYA 3Q9NC 3EIJA 3APDA 3P1UA 3PREA 2YQ8A 2IONA 4U8YD 3SBSA 3R7QA 5LCWJ 5CECB 3CHRA 3JQ0A 3L16A 4J8EA 4A3TA 2WXJA 2CG2A 4EHMA 2ZIRA 4JEUA 4A1GA 4F1SA 5AENA 3G2SA 4HOTA 3PE3A 4FJZA 3NF1A 5HI7A 1H6PA 2BKGA 3CKBA 4K5BA 2ZGDA 1E7VA 2P9KG 3Q73A 3QKYA 4YDEA 3UIPC 4ILHB 2L0IA 4YDOA 3CLJA 5FQ6A 4GTMA 2Q7FA 4KXKB 4YNDA 1ZB1A 5CMWA 1KT0A 1U3CA 5FTPA 1V55E 2XCCA 3HHMA 4AXHA 1JPLA 1AWCB 1D8DA 4LERA 4B89A 3LY8A 5LCWC 1N54A 5CEAA 4JHKA 3PZ2A 4FHJA 3DXMG 2QYJA 4U07A 3TWQA 3UI2A 4GTTA 2CHZA 4I17A 3FWVA 2VYIA 1JWGA 2YNQA 1YCSB 2WXFA 4MLPA 3CHOA 3TGOA 5KNGA 2QYUA 3QDNA 1DCEA 3VLFA 4BERA 1HX8A 4CT4A 2PM6A 2XPZA 3P2BA 3Q47B 3ZYMA 4BFRA 1P5QA 4JVSA 1N4QA 2JABA 5J08A 2P9LG 2L6JA 4LRZA 3WXXA 4GA2A 1OCRE 5ENNA 3L54A 1HH8A 3RKVA 3FU6A 4G1TA 2P2CP 4PH4B 1TNOA 1UN9A 4CDNA 3UPVA 2RG8A 5D66A 2KM4A 1OWNA 4JA7A 3MJWA 1DVPA 1PY1A 4HXIA 1Y6IA 4NURA 4BSZB 3L6AA 3PRZA 5CRUA 3Q75A 4KVMA 2EQXA 3MGBA 5AQ9A 3K9IA 3B7RL 3I4RB 4B93B 2VSOE 3HIZA 4N3BA 5D0QD 3TG4A 5EIDA 2L6BA 2XPYA 4U8HA 5FIOA 3ML9A 3DEPA 1S70B 3FTZA 2DYRE 3NB2A 4C9BB 4K5AB 1LD7A 3IKOB 1IQUA 2V5QC 4K0RA 4LNBA 4KZCA 2H6FA 4B8AA 4J6IA 4I6JA 4Q69A 1TEZA 3FUFA 4OVVA 3GZ2A 4D10C 3ABME 3DWLG 1HG2A 3QWWA 2KZTB 3C3RA 4CCAA 2J8SD 2P9SG 3J5PA 3EU9A 2WXGA 1K1BA 1WDYA 1K1AA 1N11A 3U9WA 4PS7A 4EECA 3ASNE 3ZIMA 4GPMA 4PDXA 5CBNA 4YVQC 4GTPA 1ZBPA 2WMOA 3EDTB 5EILA 1N4PA 1O1TA 3NAWA 5JHBA 2R17C 3D9OA 3SNXA 4BEPA 4GTOA 2PZIA 4LNUD 3FUIA 2J9QA 5AAOA 4DLOA 5BV1A 5ENSD 4N2QA 3URZA 2LXLA 2Y4UA 3BG1B 1TR4A 3E4BA 2UWJG 4Q94A 3AU5A 2RD0A 4Y6CA 1MZCA 1OCCE 2LO6A 3FUMA 2F8YA 4DPRA 2P9IG 3RRMB 2XGMA 2HM8A 4TXRA 3NZUA 4JA9A 2P9UG 2LNIA 4H7YA 2OVFA 4U0ZA 1IXVA 4FU3A 3FTVA 4HI8A 3SBTB 1B89A 1Y8MA 2P9NG 2GRMA 3NBNB 3D9LA 1U3DA 4EBAA 4LG6A 5ANLA 4ACKA 4FADA 5B1BE 3C3QA 1RZ4A 5G2NA 4DX2A 3MKQB 4XI0A 4URKA 4AP2A 2IU1A 1Q2ZA 3SQVA 3TG5A 4BESA 3AG2E 1IKND 5G04J 4AY6A 3UQ3A 5CMYA 2DVWA 2XEEA 5FINA 3E34A 2BKKB 2QC9A 4JZYA 1GW6A 3CQGB 3APFA 5H7PA 4ABNA 2IOSA 3T9KA 3TWRA 4DX5D 5AYWD 3MX3A 3HG0D 4FJYA 3PUKA 1QQEA 1AP7A 4X8QA 2ETAA 4F1PA 3IXEA 2IJGX 4N5CA 4APFA 3PZDA
chains in the Genus database with same CATH topology
4HRMB 2F8XK 4YDWA 2F8YA 2QYJA 3KEAA 4LSZE 4U96D 3TWQA 3UI2A 3DEOA 5ENTD 4A63B 4HRNA 3JXIA 4K5AB 4K5CA 3Q9NC 5ENPD 3NOGD 3F6QA 2V5QC 1MYOA 3Q9UC 1BD8A 1MX6A 1YCSB 2XZTG 4F6RD 3C5RA 5EIBE 3SO8A 3TWUA 1IXVA 4U8YD 5KBAA 1DCQA 5KNGA 4J7WA 4HI8A 4O1PA 4U8VD 1YYHA 4TUMA 3AAAC 5CECB 2V4HC 5ENQD 3V79K 4U95D 2DZOA 2RFAA 4BERA 4N5QA 4O60A 3NBNB 3ZUVB 2XEHA 1BLXB 1UOHA 2KBXA 1BI8B 3B7BA 4QFVA 3HRAA 5CBOA 4LG6A 4DRXE 2AJAA 3TWSA 4OAVB 3EHRA 2B0OE 2J8SD 5AQAA 2MYOA 3B95A 4Z68A 2VGEA 4HLLA 3AJIA 1MJ0A 3ZU7B 3J5PA 4O1OA 4DX2A 3EU9A 2FO1E 4ZFHA 1K1BA 2BKGA 3JXJA 1WDYA 4HNAD 4HQDA 1K1AA 1N11A 4K5BA 5HRYA 2ZGDA 2JABA 4G8LA 4ATZD 2ZGGA 2RFMA 3UXGA 4BESA 2XENA 2A5EA 5CEDB 1IKND 1G3NB 5AQBA 3W9GA 3TWWA 5HKPA 4ZHBA 4QQIA 3V31A 5JA4D 2ETBA 4GPMA 5CBNA 3TWTA 2P2CP 1YMPA 3V2OA 1MX2A 4DX7D 2PNNA 2DVWA 1QYMA 2XEEA 4HB5A 5D66A 4GMRA 4NIKA 5EILA 1SVXA 5FINA 3T8KA 1MX4A 2XZDG 4HRLA 2BKKB 2QC9A 3TWXA 3V2XA 2Y1LE 4CZ2D 4YDYA 2DWZA 4BSZB 1OT8A 1IHBA 5BXUA 5CERB 5JMND 5AN8A 4BEPA 1BU9A 2DZNA 5AQ7A 4CYMD 4HI9A 3ZKJA 5ENRD 3LJNA 4G8KA 4HBDA 3V30A 1WG0A 1D9SA 2KXPC 1K3ZD 3T9KA 3TWRA 3TWVA 1NFIE 4LNUD 5HS0A 1SW6A 5AQ9A 3NOCD 4C48B 1N0QA 2HE0A 4DX5D 1N0RA 2ETCA 3J5QB 5EN5D 5AAOA 4DX6D 4RLYA 3HG0D 5EYLA 5KNHD 5KWDA 5ENSD 2F37A 2NYJA 4B93B 2Y0BG 1AWCB 1OY3D 4OAUC 1AP7A 3JUEA 3W9FA 1A5EA 4DUIA 4BETA 4UUCA 5AARA 5EIDA 5ITZF 1TR4A 2L6BA 5CEAA 5EYPF 2ETAA 4J8YA 5ENOD 5BXOA 5FIOA 4JB8P 1BI7B 4F1PA 3IXEA 3DEPA 4DX1A 1S70B 3EHQA 3UTMA 1DC2A 3D9HA 3ZNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRM B;  2F8X K;  4YDW A;  2F8Y A;  2QYJ A;  3KEA A;  4LSZ E;  4U96 D;  3TWQ A;  3UI2 A;  3DEO A;  5ENT D;  4A63 B;  4HRN A;  3JXI A;  4K5A B;  4K5C A;  3Q9N C;  5ENP D;  3NOG D;  3F6Q A;  2V5Q C;  1MYO A;  3Q9U C;  1BD8 A;  1MX6 A;  1YCS B;  2XZT G;  4F6R D;  3C5R A;  5EIB E;  3SO8 A;  3TWU A;  1IXV A;  4U8Y D;  5KBA A;  1DCQ A;  5KNG A;  4J7W A;  4HI8 A;  4O1P A;  4U8V D;  1YYH A;  4TUM A;  3AAA C;  5CEC B;  2V4H C;  5ENQ D;  3V79 K;  4U95 D;  2DZO A;  2RFA A;  4BER A;  4N5Q A;  4O60 A;  3NBN B;  3ZUV B;  2XEH A;  1BLX B;  1UOH A;  2KBX A;  1BI8 B;  3B7B A;  4QFV A;  3HRA A;  5CBO A;  4LG6 A;  4DRX E;  2AJA A;  3TWS A;  4OAV B;  3EHR A;  2B0O E;  2J8S D;  5AQA A;  2MYO A;  3B95 A;  4Z68 A;  2VGE A;  4HLL A;  3AJI A;  1MJ0 A;  3ZU7 B;  3J5P A;  4O1O A;  4DX2 A;  3EU9 A;  2FO1 E;  4ZFH A;  1K1B A;  2BKG A;  3JXJ A;  1WDY A;  4HNA D;  4HQD A;  1K1A A;  1N11 A;  4K5B A;  5HRY A;  2ZGD A;  2JAB A;  4G8L A;  4ATZ D;  2ZGG A;  2RFM A;  3UXG A;  4BES A;  2XEN A;  2A5E A;  5CED B;  1IKN D;  1G3N B;  5AQB A;  3W9G A;  3TWW A;  5HKP A;  4ZHB A;  4QQI A;  3V31 A;  5JA4 D;  2ETB A;  4GPM A;  5CBN A;  3TWT A;  2P2C P;  1YMP A;  3V2O A;  1MX2 A;  4DX7 D;  2PNN A;  2DVW A;  1QYM A;  2XEE A;  4HB5 A;  5D66 A;  4GMR A;  4NIK A;  5EIL A;  1SVX A;  5FIN A;  3T8K A;  1MX4 A;  2XZD G;  4HRL A;  2BKK B;  2QC9 A;  3TWX A;  3V2X A;  2Y1L E;  4CZ2 D;  4YDY A;  2DWZ A;  4BSZ B;  1OT8 A;  1IHB A;  5BXU A;  5CER B;  5JMN D;  5AN8 A;  4BEP A;  1BU9 A;  2DZN A;  5AQ7 A;  4CYM D;  4HI9 A;  3ZKJ A;  5ENR D;  3LJN A;  4G8K A;  4HBD A;  3V30 A;  1WG0 A;  1D9S A;  2KXP C;  1K3Z D;  3T9K A;  3TWR A;  3TWV A;  1NFI E;  4LNU D;  5HS0 A;  1SW6 A;  5AQ9 A;  3NOC D;  4C48 B;  1N0Q A;  2HE0 A;  4DX5 D;  1N0R A;  2ETC A;  3J5Q B;  5EN5 D;  5AAO A;  4DX6 D;  4RLY A;  3HG0 D;  5EYL A;  5KNH D;  5KWD A;  5ENS D;  2F37 A;  2NYJ A;  4B93 B;  2Y0B G;  1AWC B;  1OY3 D;  4OAU C;  1AP7 A;  3JUE A;  3W9F A;  1A5E A;  4DUI A;  4BET A;  4UUC A;  5AAR A;  5EID A;  5ITZ F;  1TR4 A;  2L6B A;  5CEA A;  5EYP F;  2ETA A;  4J8Y A;  5ENO D;  5BXO A;  5FIO A;  4JB8 P;  1BI7 B;  4F1P A;  3IXE A;  3DEP A;  4DX1 A;  1S70 B;  3EHQ A;  3UTM A;  1DC2 A;  3D9H A;  3ZNG A; 
#chains in the Genus database with same CATH topology
 3ESL A;  2J09 A;  1XGW A;  3MZL B;  4WUY A;  3AS5 A;  4GA0 A;  3CSF A;  3DEO A;  5DIZ A;  3ASH A;  3QJZ A;  3SO8 A;  4U0S A;  3EHN A;  4O1P A;  2VSN A;  5G04 C;  2V4H C;  2HYZ A;  3PDN A;  1QBQ A;  1BLX B;  1UOH A;  3L17 A;  3UT7 A;  1L5J A;  3ASO E;  1JCQ A;  5CRV A;  2AJA A;  3S7F A;  2WQ7 A;  1E90 A;  3LPZ A;  4HLL A;  2I2O A;  4JHJ A;  4GZD A;  3ULQ A;  3FUL A;  5HRY A;  3U66 A;  2ZGG A;  4MBG A;  3VTX A;  3W9G A;  3L82 A;  4EBA G;  4QQI A;  4DI3 A;  4H7X A;  2UY1 B;  4IN3 B;  3T8K A;  5FWQ A;  3TWX A;  2DYS E;  4GZC A;  5KJN A;  3S7D A;  4IRU A;  2DWZ A;  4CT0 A;  2XS1 A;  4UWH A;  4RG6 A;  1N9A A;  4N2S A;  3NOC D;  1OUV A;  4I2Z A;  2KZT A;  3QC1 A;  4RLY A;  1KZO A;  2QZA A;  3FFL A;  3Q7A A;  4CDM A;  3FEX A;  1HXI A;  2R05 A;  4HLE A;  2AWI A;  1SQM A;  2CG3 A;  4L2L A;  4UUC A;  5AAR A;  1DNP A;  1PAQ A;  1KZP A;  3FTW A;  4DK5 A;  1BI7 B;  3JCK C;  4JHR A;  3PZ4 A;  4XKC A;  4KVO A;  1X5B A;  3D9N A;  1NI1 A;  3CVP A;  3KAE A;  3RIB A;  3ASF A;  4GU5 A;  4LEU A;  1OXJ A;  2C0L A;  2XPI A;  3DSV A;  2DZO A;  4NRH B;  2I9C A;  2J4D A;  2LSU A;  4L2Y A;  2XEH A;  4AY5 A;  3AS8 A;  3B7B A;  4APO A;  4XEI G;  4Q96 A;  3ULY A;  5FZQ A;  1MHQ A;  1OWP A;  4GTR A;  3PNT B;  3ZEF A;  1N95 A;  2LUH A;  2X6J A;  3HVE B;  5BV0 A;  2GRN B;  4G25 A;  1TJF A;  1IQR A;  2E0I A;  2Y4T A;  3SI5 A;  4GZ6 A;  3DRA A;  1YMP A;  2Y3A A;  3BQO A;  4DX7 D;  3PUJ A;  2AVP A;  4GZ5 A;  3R9M A;  1H6O A;  1WY6 A;  4CZ2 D;  3CST A;  5AQ7 A;  3HXE A;  4FC8 A;  3EUV A;  5ARG A;  2KC7 A;  2EIK E;  4DJA A;  1ELK A;  3UKR G;  4BT8 A;  2WXO A;  1MQS A;  3FUJ A;  2FEZ A;  3MKQ A;  4GPK A;  2XGO A;  4UI9 K;  2CHX A;  3Q7F A;  3CHP A;  3D9I A;  2A4Z A;  2OOE A;  4C0E A;  4GYW A;  2Y69 E;  3CVN A;  2WXN A;  5B3S E;  3B13 A;  4JPS A;  2OEV A;  4KZ0 A;  1A17 A;  1NA3 A;  5KBA A;  3FU5 A;  3LY7 A;  3RSE G;  1UN8 A;  4O60 A;  3U3W A;  1JCS A;  5EX3 A;  4B94 A;  4JW1 A;  1BI8 B;  3DPY A;  3HRA A;  2VGX B;  2B0O E;  4I9E A;  3CVY A;  3AJI A;  3DSW A;  4M3O A;  2FUL A;  1FT1 A;  3JXJ A;  2BTD A;  2LXM A;  2EIJ E;  4ANX A;  3ESK A;  3U4T A;  5D0O D;  2J49 A;  1UJK A;  3IHY A;  5T4Y A;  3UT8 A;  1SA5 A;  3S2A A;  3E33 A;  3OAW A;  4AM9 A;  1HZ4 A;  5BPP A;  3UUX A;  3O4Z A;  4I6E A;  4N3A A;  5FQ4 A;  3Q4A B;  2I1K A;  4HRL A;  3SFZ A;  2X6F A;  1H2U A;  2AXZ A;  4HS2 A;  4CRW A;  1O1S A;  3CEQ A;  3ISM C;  4EPZ A;  3J5Q B;  2Y0B G;  4E85 A;  4DUI A;  3D9J A;  3LY9 A;  5BXO A;  4HOR A;  3JQ1 A;  3C98 A;  4ANW A;  2X6H A;  1FVF A;  4YDW A;  2UY1 A;  3QWP A;  2VTB B;  4XKB A;  2L9B A;  1U2V G;  1IHG A;  2RKK A;  3JXI A;  2WPV A;  4GAA A;  4U7E B;  5A7D B;  4AEZ C;  1NA0 A;  3MV3 B;  2V5F A;  1YYH A;  4UQY A;  3Q15 A;  2GRO B;  4TXQ A;  4IUL A;  1Z5S C;  2EIN E;  3CQC B;  2FBN A;  2J08 A;  3FHE A;  4OAV B;  4I6G A;  3DST A;  4B0Z A;  2MYO A;  1EPU A;  3I5P A;  3CK7 A;  3ZU7 B;  4I43 A;  3Q79 A;  1ELW A;  2OEW A;  4YVO A;  1KPS B;  4G8L A;  4ILG A;  3BU8 A;  2A5E A;  2R2L A;  4F7A A;  1INZ A;  2I1J A;  4CGV A;  4EZL A;  1TJC A;  4XZ4 A;  4BTA A;  4A55 A;  2GRL A;  4ZHB A;  3V31 A;  1TNB A;  2L0T B;  4PS8 A;  4AJW A;  3MV2 B;  2GGF A;  3HDX A;  1XNF A;  4J8D A;  3DSX A;  3ML8 A;  4CYM D;  2XRZ A;  4G2V A;  1N4S A;  1RW2 A;  3ZYQ A;  2C0M A;  3D3M A;  4KBQ A;  4CDR A;  5KWD A;  1TNU A;  4MS6 A;  1OY3 D;  3T5X A;  5HQ8 A;  1NZN A;  3JUE A;  3G2T A;  3ZYK A;  4BET A;  2JEK A;  4KMO A;  2BF0 X;  4FA6 A;  3UM3 A;  4C0M A;  3HVE A;  4KT6 B;  1HF8 A;  4FLB A;  4L1B A;  3T5V A;  4LSZ E;  4U96 D;  3RAU A;  3CVX A;  5G05 J;  1FT2 A;  4A63 B;  3CVV A;  5JJ6 A;  5ENP D;  3NOG D;  1MYO A;  1JCR A;  1BD8 A;  5JJT A;  4UI9 J;  1MX6 A;  2HR2 A;  2DCP A;  4F3V A;  1UG3 A;  2JLB A;  1HU3 A;  4WWO A;  4J0U A;  2GRP B;  3LVR E;  5CCL A;  3CVW A;  1Z6T A;  2NSZ A;  4BSX A;  3G2W A;  1OCZ E;  2VSY A;  3ONK A;  2WVI A;  1EDU A;  5AQA A;  3B95 A;  2WXK A;  4DI4 A;  4B8C B;  4BT9 A;  3UIN C;  4AV7 A;  4ATZ D;  4WNE A;  2GRQ B;  2VJ8 A;  2RFM A;  2XEN A;  5E76 A;  5AQB A;  3CGH A;  4HB5 A;  3QK0 A;  2MHK A;  1E8Z A;  5BXU A;  2BUG A;  3FUK A;  3PVL A;  4GCN A;  3TXN A;  2DZN A;  3JUI A;  5ENR D;  1D9S A;  1NFI E;  2WXM A;  4GA1 A;  2XCB A;  3ZW3 A;  5G05 C;  3BG0 B;  3FUE A;  2QY7 A;  2VGX A;  4UI9 C;  4KYO B;  4LNG A;  2B6C A;  3LEW A;  5EYP F;  4I1M A;  3PZ3 A;  4I1A A;  3D9P A;  4U63 A;  4U0U A;  4WNF A;  2QFC A;  4EZJ A;  4W9R A;  3EIQ C;  2VQ2 A;  3RO2 A;  4GTQ A;  4WAF A;  3PZ1 A;  1ELR A;  2F0Y A;  2H6I A;  5D2M C;  3LVQ E;  2LAH A;  5AJL A;  4GTS A;  4PUC A;  2WQ6 A;  4U95 D;  4UWL A;  3CV0 A;  1O1R A;  3L13 A;  3LS8 A;  2R02 A;  3GZ1 A;  3QNK A;  2V0P A;  4GCO A;  3EHR A;  4GTV A;  4MRU A;  3AU4 A;  3TXM A;  1SZA A;  4NAC A;  4RG9 A;  4UWK A;  3NZS A;  3KSL A;  2FO7 A;  3OXG A;  3FUD A;  1G3N B;  1W3B A;  5FZR A;  2V4L A;  2WXI A;  5HKP A;  2OCC E;  3BEE A;  4OVU A;  3C72 A;  2IFU A;  4Y6W A;  5C1D A;  1QYM A;  3QWV A;  5BT1 A;  3QAQ A;  1MX4 A;  3X2Q E;  4ACL A;  2IO3 C;  2KCV A;  4YDY A;  5JMN D;  2IF4 A;  3HXD A;  1BU9 A;  5FJY A;  2NXP A;  4C48 B;  4WWP A;  1N0Q A;  1N0R A;  4TRQ A;  4HOS A;  3HXB A;  1H2T C;  1TN6 A;  3SHF A;  4TUU A;  4OYS A;  2J07 A;  3KEZ A;  1E8W A;  2BED A;  3L22 A;  4J8F A;  4JB8 P;  2E2E A;  3R7R A;  3FTS A;  3ENE A;  3ZNG A;  2DBA A;  3KEA A;  3JYS A;  3RRU A;  5M72 A;  3SF4 A;  4HRN A;  2LAI A;  3LKU A;  4UQX A;  4FHK A;  3ZYL A;  4BWR A;  4J7W A;  3CVU A;  5G55 A;  3V79 K;  4UQZ A;  2RFA A;  3SD5 A;  4TV3 A;  3EHM A;  2X6I A;  3CK8 A;  3CVL A;  3Q5M A;  1H6K A;  2EIM E;  3KD7 A;  5T3R A;  4RVB A;  4DRX E;  2C2L A;  3DSU A;  5BW8 C;  4GML A;  2VGE A;  4O1O A;  3AG1 E;  5CHE E;  5DBK A;  3LDZ A;  3FTU A;  4I1O B;  3HXC A;  5CED B;  1SZ9 A;  3TWT A;  2WB2 A;  3RU0 A;  4JL0 A;  3ZRH A;  3V2O A;  1NL4 A;  2XZD G;  2WXQ A;  5LX8 A;  3PNL B;  1OT8 A;  1NP7 A;  3EU5 A;  4LCT A;  3ZGQ A;  3ZKJ A;  2YHC A;  1WG0 A;  2KXP C;  2HE0 A;  4DX6 D;  3LXU X;  4GMJ A;  4AIF A;  3S7J A;  3ZN3 A;  4HFG A;  1OCO E;  1ZU2 A;  4A1S A;  2WM9 A;  3GW4 A;  4J8Y A;  5ENO D;  3UIO C;  3NQP A;  4PS3 A;  5JHA A;  3OTN A;  1DC2 A;  2F8X K;  5JJ7 A;  3CR3 A;  4K5C A;  3MYV A;  5E75 A;  4F6R D;  2AXV A;  3LJ3 A;  1DCQ A;  3ASG A;  2FF4 A;  4U8V D;  5FZS A;  4BTB A;  4N5Q A;  5KCM A;  1JUQ A;  4HOQ A;  3FTX A;  4Z68 A;  1E8Y A;  4XIF A;  2ZU6 B;  3KSQ A;  3OXL A;  1OWM A;  1QZ2 A;  3ZFW A;  3FUH A;  2KCK A;  5ANR A;  3LYA A;  2A5U A;  2ETB A;  3DSS A;  3SZ7 A;  4GMR A;  3S7B A;  1SVX A;  2ILR A;  3RO3 A;  4XX5 A;  1H2V C;  4U04 A;  1K3Z D;  2LSV A;  3DBS A;  5JA4 D;  1S63 A;  2GW1 A;  3MEK A;  4HVB A;  5KNH D;  2F37 A;  2NYJ A;  3DXK G;  2R59 A;  3EHQ A;  3UTM A;  4V3I A;  3PEV B;  1HG5 A;  1UJJ A;  3N71 A;  5B1A E;  3PE4 A;  3ZXS A;  2PM7 A;  3E32 A;  3FH8 A;  3WG7 E;  1LD8 A;  3EJN A;  1HS6 A;  2XZT G;  2GRR B;  2WXP A;  3TWU A;  2XGS A;  4TUM A;  3FU3 A;  2H6H A;  4BY6 A;  5KJK A;  4ANV A;  3PH0 C;  3RJV A;  3ZHE B;  1KT1 A;  3FTY A;  2YIN A;  3D9M A;  2XEV A;  3TAX A;  3HYM B;  3CK9 A;  2FO1 E;  1TN8 A;  4HQD A;  2WXR A;  4G11 A;  3UM2 A;  5A23 A;  1V54 E;  4RSY A;  3U64 A;  3TWW A;  2X38 A;  5LP0 A;  3CVQ A;  2DIW A;  1N94 A;  2MRI A;  2X3M A;  3OXF A;  2X6K A;  3CHM A;  1HO8 A;  4UWF A;  3MCX A;  3V2X A;  3CHQ A;  1QNF A;  3SGH A;  3QB2 A;  1IHB A;  3AG4 E;  3UT4 A;  3HXF A;  5AN8 A;  3Q49 B;  2KAT A;  3TJP A;  3V30 A;  1E96 B;  5KJM A;  3C3O A;  2IEJ A;  3DPD A;  2KCL A;  2XQ0 A;  5EKQ D;  3UM1 A;  4EQF A;  2WXL A;  1A5E A;  2HO1 A;  5ITZ F;  3G2U A;  5KJL A;  4XE0 A;  3IEG A;  3PS6 A;  4DX1 A;  3D9K A;  3FEY A;  5EX0 A;  2VSX E;  3BUA A;  3L08 A;  3TL5 A;  4WNG A;  4ILI A;  3Q9U C;  3PEU B;  1LTX A;  3UMV A;  3ZXP A;  3IV0 A;  2IQC A;  1H19 A;  3AAA C;  3FDH A;  3FP3 A;  5AIJ A;  5AJD A;  3VLE A;  4BX9 A;  1N4R A;  2KBX A;  2P58 C;  1OWL A;  1TN7 A;  4GYO A;  4CGW A;  3CIA A;  1EYH A;  4I2W A;  3R9A B;  4R7L A;  3UX4 A;  2CHW A;  3L9T A;  2V8S E;  4N3C A;  2OV8 A;  3VLD A;  4MKT A;  3KS2 A;  3E37 A;  3UXG A;  3ABK E;  1H0A A;  4XI9 A;  2ZIS A;  2WMN A;  4JC8 A;  2ZXW E;  4JD2 G;  1D8E A;  2Y1L E;  2PL2 A;  2J4B A;  2M63 A;  1Z3X A;  3LJN A;  1LF8 A;  1KLX A;  1TNZ A;  4I9C A;  1SW6 A;  1O5M A;  1E8X A;  3IBE A;  3CKC A;  4OAU C;  3SY2 A;  3RK6 A;  4WND A;  3MKR A;  4ANU A;  4L7T A;  3APC A;  1WAO 1;  4F53 A;  5FT9 A;  1Z3Y A;  4FP7 A;  1UW4 B;  5EDS A;  4HRM B;  3Q78 A;  5C2Y A;  2I6H A;  2OND A;  3ULE G;  4AVX A;  4RQI A;  1EF1 C;  3FUN A;  3GZS A;  2MOW A;  3F6Q A;  2R03 A;  3IHV A;  5T8I A;  3I3N A;  5LFA A;  3B7S A;  2YHE A;  3FU0 A;  2XS8 A;  5A6C A;  3FH7 A;  4JXT A;  3ASD A;  1YA0 A;  3I4G A;  5CBO A;  3QAR A;  3TWS A;  5FQ8 A;  3GYZ A;  2IO2 C;  5ARF A;  1FPP A;  4GYY A;  3AG3 E;  4HNA D;  4A3V A;  2AXU A;  1HE8 A;  4P29 A;  2CFZ A;  4JEH A;  3SFX A;  3T8M A;  1K8K G;  4DLQ A;  1X81 A;  3ABL E;  1MX2 A;  2PNN A;  1VDY A;  4NIK A;  1FCH A;  2IOL A;  3LCA A;  4ATG A;  4FLH A;  3B7T A;  4UWG A;  4TXP A;  4M7C A;  4HI9 A;  4HBD A;  3TWV A;  2VTB A;  5HS0 A;  3ZHE A;  4GZ3 A;  2PQN A;  3VTY A;  5EYL A;  3FY4 A;  2AW6 A;  3AS4 A;  4HOU A;  3W9F A;  3RRN B;  2NC9 A;  4AOF A;  5FQ7 A;  4NQ0 A;  3CHS A;  1TYQ G;  3QOU A;  4L9P A;  5BNW A;  3MA5 A;  4J8S A;  2PQR A;  4L23 A;  3G2V A;  1N52 A;  5LOZ A;  1BPO A;  1TNY A;  3ONL A;  4G23 A;  5EIB E;  3C5R A;  3E30 A;  2XHE A;  4WWN A;  1IYG A;  4GB9 A;  1PC2 A;  4CEM A;  5ENQ D;  2EIL E;  4G24 A;  3ZUV B;  1HFA A;  2FI7 A;  4FUL A;  3ZVV A;  4QFV A;  4O6F A;  4BX8 A;  4E6H A;  4ME2 A;  1MJ0 A;  4G26 A;  5IY5 E;  4ZFH A;  3B7U X;  4IYP A;  2IY0 C;  1S0P A;  3FH5 A;  1E7U A;  1OWO A;  3SFY A;  2H6G A;  1JWF A;  2P9P G;  5BUZ A;  2WQH A;  4G8K A;  1FVH A;  4N39 A;  1S64 A;  5CCM A;  1WM5 A;  5CER B;  2ETC A;  5EN5 D;  2R5S A;  2OVB A;  2WXH A;  4EZK A;  4LUN U;  1SA4 A;  4K03 A;  3ZPJ A;  5J90 A;  3O48 A;  3UM0 A;  2XRY A;  3D9H A;  2CFU A;  3UKU G;  5ENT D;  2VGY A;  3Q9N C;  3EIJ A;  3APD A;  3P1U A;  3PRE A;  2YQ8 A;  2ION A;  4U8Y D;  3SBS A;  3R7Q A;  5LCW J;  5CEC B;  3CHR A;  3JQ0 A;  3L16 A;  4J8E A;  4A3T A;  2WXJ A;  2CG2 A;  4EHM A;  2ZIR A;  4JEU A;  4A1G A;  4F1S A;  5AEN A;  3G2S A;  4HOT A;  3PE3 A;  4FJZ A;  3NF1 A;  5HI7 A;  1H6P A;  2BKG A;  3CKB A;  4K5B A;  2ZGD A;  1E7V A;  2P9K G;  3Q73 A;  3QKY A;  4YDE A;  3UIP C;  4ILH B;  2L0I A;  4YDO A;  3CLJ A;  5FQ6 A;  4GTM A;  2Q7F A;  4KXK B;  4YND A;  1ZB1 A;  5CMW A;  1KT0 A;  1U3C A;  5FTP A;  1V55 E;  2XCC A;  3HHM A;  4AXH A;  1JPL A;  1AWC B;  1D8D A;  4LER A;  4B89 A;  3LY8 A;  5LCW C;  1N54 A;  5CEA A;  4JHK A;  3PZ2 A;  4FHJ A;  3DXM G;  2QYJ A;  4U07 A;  3TWQ A;  3UI2 A;  4GTT A;  2CHZ A;  4I17 A;  3FWV A;  2VYI A;  1JWG A;  2YNQ A;  1YCS B;  2WXF A;  4MLP A;  3CHO A;  3TGO A;  5KNG A;  2QYU A;  3QDN A;  1DCE A;  3VLF A;  4BER A;  1HX8 A;  4CT4 A;  2PM6 A;  2XPZ A;  3P2B A;  3Q47 B;  3ZYM A;  4BFR A;  1P5Q A;  4JVS A;  1N4Q A;  2JAB A;  5J08 A;  2P9L G;  2L6J A;  4LRZ A;  3WXX A;  4GA2 A;  1OCR E;  5ENN A;  3L54 A;  1HH8 A;  3RKV A;  3FU6 A;  4G1T A;  2P2C P;  4PH4 B;  1TNO A;  1UN9 A;  4CDN A;  3UPV A;  2RG8 A;  5D66 A;  2KM4 A;  1OWN A;  4JA7 A;  3MJW A;  1DVP A;  1PY1 A;  4HXI A;  1Y6I A;  4NUR A;  4BSZ B;  3L6A A;  3PRZ A;  5CRU A;  3Q75 A;  4KVM A;  2EQX A;  3MGB A;  5AQ9 A;  3K9I A;  3B7R L;  3I4R B;  4B93 B;  2VSO E;  3HIZ A;  4N3B A;  5D0Q D;  3TG4 A;  5EID A;  2L6B A;  2XPY A;  4U8H A;  5FIO A;  3ML9 A;  3DEP A;  1S70 B;  3FTZ A;  2DYR E;  3NB2 A;  4C9B B;  4K5A B;  1LD7 A;  3IKO B;  1IQU A;  2V5Q C;  4K0R A;  4LNB A;  4KZC A;  2H6F A;  4B8A A;  4J6I A;  4I6J A;  4Q69 A;  1TEZ A;  3FUF A;  4OVV A;  3GZ2 A;  4D10 C;  3ABM E;  3DWL G;  1HG2 A;  3QWW A;  2KZT B;  3C3R A;  4CCA A;  2J8S D;  2P9S G;  3J5P A;  3EU9 A;  2WXG A;  1K1B A;  1WDY A;  1K1A A;  1N11 A;  3U9W A;  4PS7 A;  4EEC A;  3ASN E;  3ZIM A;  4GPM A;  4PDX A;  5CBN A;  4YVQ C;  4GTP A;  1ZBP A;  2WMO A;  3EDT B;  5EIL A;  1N4P A;  1O1T A;  3NAW A;  5JHB A;  2R17 C;  3D9O A;  3SNX A;  4BEP A;  4GTO A;  2PZI A;  4LNU D;  3FUI A;  2J9Q A;  5AAO A;  4DLO A;  5BV1 A;  5ENS D;  4N2Q A;  3URZ A;  2LXL A;  2Y4U A;  3BG1 B;  1TR4 A;  3E4B A;  2UWJ G;  4Q94 A;  3AU5 A;  2RD0 A;  4Y6C A;  1MZC A;  1OCC E;  2LO6 A;  3FUM A;  2F8Y A;  4DPR A;  2P9I G;  3RRM B;  2XGM A;  2HM8 A;  4TXR A;  3NZU A;  4JA9 A;  2P9U G;  2LNI A;  4H7Y A;  2OVF A;  4U0Z A;  1IXV A;  4FU3 A;  3FTV A;  4HI8 A;  3SBT B;  1B89 A;  1Y8M A;  2P9N G;  2GRM A;  3NBN B;  3D9L A;  1U3D A;  4EBA A;  4LG6 A;  5ANL A;  4ACK A;  4FAD A;  5B1B E;  3C3Q A;  1RZ4 A;  5G2N A;  4DX2 A;  3MKQ B;  4XI0 A;  4URK A;  4AP2 A;  2IU1 A;  1Q2Z A;  3SQV A;  3TG5 A;  4BES A;  3AG2 E;  1IKN D;  5G04 J;  4AY6 A;  3UQ3 A;  5CMY A;  2DVW A;  2XEE A;  5FIN A;  3E34 A;  2BKK B;  2QC9 A;  4JZY A;  1GW6 A;  3CQG B;  3APF A;  5H7P A;  4ABN A;  2IOS A;  3T9K A;  3TWR A;  4DX5 D;  5AYW D;  3MX3 A;  3HG0 D;  4FJY A;  3PUK A;  1QQE A;  1AP7 A;  4X8Q A;  2ETA A;  4F1P A;  3IXE A;  2IJG X;  4N5C A;  4APF A;  3PZD A; 
#chains in the Genus database with same CATH homology
 4HRM B;  2F8X K;  4YDW A;  2F8Y A;  2QYJ A;  3KEA A;  4LSZ E;  4U96 D;  3TWQ A;  3UI2 A;  3DEO A;  5ENT D;  4A63 B;  4HRN A;  3JXI A;  4K5A B;  4K5C A;  3Q9N C;  5ENP D;  3NOG D;  3F6Q A;  2V5Q C;  1MYO A;  3Q9U C;  1BD8 A;  1MX6 A;  1YCS B;  2XZT G;  4F6R D;  3C5R A;  5EIB E;  3SO8 A;  3TWU A;  1IXV A;  4U8Y D;  5KBA A;  1DCQ A;  5KNG A;  4J7W A;  4HI8 A;  4O1P A;  4U8V D;  1YYH A;  4TUM A;  3AAA C;  5CEC B;  2V4H C;  5ENQ D;  3V79 K;  4U95 D;  2DZO A;  2RFA A;  4BER A;  4N5Q A;  4O60 A;  3NBN B;  3ZUV B;  2XEH A;  1BLX B;  1UOH A;  2KBX A;  1BI8 B;  3B7B A;  4QFV A;  3HRA A;  5CBO A;  4LG6 A;  4DRX E;  2AJA A;  3TWS A;  4OAV B;  3EHR A;  2B0O E;  2J8S D;  5AQA A;  2MYO A;  3B95 A;  4Z68 A;  2VGE A;  4HLL A;  3AJI A;  1MJ0 A;  3ZU7 B;  3J5P A;  4O1O A;  4DX2 A;  3EU9 A;  2FO1 E;  4ZFH A;  1K1B A;  2BKG A;  3JXJ A;  1WDY A;  4HNA D;  4HQD A;  1K1A A;  1N11 A;  4K5B A;  5HRY A;  2ZGD A;  2JAB A;  4G8L A;  4ATZ D;  2ZGG A;  2RFM A;  3UXG A;  4BES A;  2XEN A;  2A5E A;  5CED B;  1IKN D;  1G3N B;  5AQB A;  3W9G A;  3TWW A;  5HKP A;  4ZHB A;  4QQI A;  3V31 A;  5JA4 D;  2ETB A;  4GPM A;  5CBN A;  3TWT A;  2P2C P;  1YMP A;  3V2O A;  1MX2 A;  4DX7 D;  2PNN A;  2DVW A;  1QYM A;  2XEE A;  4HB5 A;  5D66 A;  4GMR A;  4NIK A;  5EIL A;  1SVX A;  5FIN A;  3T8K A;  1MX4 A;  2XZD G;  4HRL A;  2BKK B;  2QC9 A;  3TWX A;  3V2X A;  2Y1L E;  4CZ2 D;  4YDY A;  2DWZ A;  4BSZ B;  1OT8 A;  1IHB A;  5BXU A;  5CER B;  5JMN D;  5AN8 A;  4BEP A;  1BU9 A;  2DZN A;  5AQ7 A;  4CYM D;  4HI9 A;  3ZKJ A;  5ENR D;  3LJN A;  4G8K A;  4HBD A;  3V30 A;  1WG0 A;  1D9S A;  2KXP C;  1K3Z D;  3T9K A;  3TWR A;  3TWV A;  1NFI E;  4LNU D;  5HS0 A;  1SW6 A;  5AQ9 A;  3NOC D;  4C48 B;  1N0Q A;  2HE0 A;  4DX5 D;  1N0R A;  2ETC A;  3J5Q B;  5EN5 D;  5AAO A;  4DX6 D;  4RLY A;  3HG0 D;  5EYL A;  5KNH D;  5KWD A;  5ENS D;  2F37 A;  2NYJ A;  4B93 B;  2Y0B G;  1AWC B;  1OY3 D;  4OAU C;  1AP7 A;  3JUE A;  3W9F A;  1A5E A;  4DUI A;  4BET A;  4UUC A;  5AAR A;  5EID A;  5ITZ F;  1TR4 A;  2L6B A;  5CEA A;  5EYP F;  2ETA A;  4J8Y A;  5ENO D;  5BXO A;  5FIO A;  4JB8 P;  1BI7 B;  4F1P A;  3IXE A;  3DEP A;  4DX1 A;  1S70 B;  3EHQ A;  3UTM A;  1DC2 A;  3D9H A;  3ZNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...