1BD8A

Structure of cdk inhibitor p19ink4d
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
RAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19INK4D CDK4/6 INHIBITOR
publication title Structure of human cyclin-dependent kinase inhibitor p19INK4d: comparison to known ankyrin-repeat-containing structures and implications for the dysfunction of tumor suppressor p16INK4a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Tumor suppressor
total genus 46
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1998-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bd8A00
5ENRD 3F6QA 4UUCA 3V79K 5AAOA 2J8SD 2XENA 2DZOA 4HRNA 5BXUA 2BKKB 2NYJA 3HG0D 1YCSB 3D9HA 4K5AB 3ZKJA 4LNUD 1N0QA 5ITZF 1UOHA 4K5BA 5KNHD 2F8YA 4O1PA 3ZNGA 5AN8A 4F6RD 1YYHA 2ETBA 1NFIE 1OY3D 1G3NB 3EU9A 3NBNB 4HI9A 3T9KA 3C5RA 3NOGD 1MJ0A 4ATZD 2ZGDA 1SW6A 3HRAA 5JA4D 4OAVB 4NIKA 4DUIA 1BI8B 1MX6A 3J5QB 5EIDA 2DWZA 3T8KA 3Q9UC 4A63B 1S70B 2QYJA 5HRYA 5CERB 4YDYA 1BLXB 5HS0A 2XEHA 5AQAA 4HB5A 2A5EA 4BEPA 3EHRA 4DX1A 5CBNA 1D9SA 4HRLA 1AWCB 4C48B 3B95A 2F37A 4BERA 3JXJA 4DX2A 3TWVA 4ZFHA 1K3ZD 2AJAA 4U96D 5D66A 4HRMB 1DC2A 1BU9A 1WDYA 3TWUA 1YMPA 4O60A 3NOCD 2Y1LE 1QYMA 3TWRA 3TWTA 2MYOA 4CYMD 2QC9A 2P2CP 5FINA 5ENQD 1K1BA 3UXGA 3AJIA 2ETAA 4G8LA 4GMRA 4RLYA 4U95D 5BXOA 1N0RA 3SO8A 2V4HC 3V31A 1MX4A 2BKGA 5AARA 3V30A 1IXVA 3UI2A 5CEAA 3DEOA 3ZUVB 4N5QA 5KWDA 1MX2A 1TR4A 5HKPA 4U8VD 2XZTG 3TWWA 4JB8P 3KEAA 2DZNA 2RFAA 5EYLA 1AP7A 1WG0A 5CEDB 4OAUC 2ZGGA 3UTMA 1MYOA 4K5CA 3EHQA 2KBXA 5AQ9A 4DX5D 3JUEA 5ENTD 5EN5D 5EIBE 2PNNA 4J7WA 3J5PA 1SVXA 2B0OE 2XEEA 1K1AA 5KBAA 2F8XK 3JXIA 1A5EA 4J8YA 4LSZE 4HQDA 4QFVA 5JMND 2XZDG 1BD8A 1DCQA 4HLLA 5EILA 3DEPA 4F1PA 4YDWA 5KNGA 5EYPF 3TWQA 3TWXA 3IXEA 3V2OA 4DX7D 5CECB 3ZU7B 5ENSD 2L6BA 4GPMA 4HI8A 4BESA 4CZ2D 5AQ7A 4ZHBA 2HE0A 4Z68A 3TWSA 4DRXE 2KXPC 2FO1E 2Y0BG 3W9FA 4B93B 3LJNA 4HBDA 4U8YD 2ETCA 1N11A 4HNAD 4BETA 1IHBA 4G8KA 3AAAC 5ENPD 5CBOA 1OT8A 3W9GA 4DX6D 1IKND 4LG6A 2JABA 5AQBA 5FIOA 4BSZB 2VGEA 3B7BA 5ENOD 3V2XA 4O1OA 4QQIA 2RFMA 2V5QC 3Q9NC 1BI7B 4TUMA 2DVWA
chains in the Genus database with same CATH superfamily
4XKBA 3WXXA 2JEKA 4BT8A 3CV0A 1YCSB 3ZKJA 3I4RB 2FO7A 3T9KA 3DWLG 3HRAA 4XE0A 4YNDA 2LXLA 3UM0A 2BF0X 3P2BA 4ANUA 4E85A 2IU1A 2RD0A 2L9BA 2XGOA 4TXRA 3ULEG 4CYMD 3GYZA 3NB2A 4GYYA 1BPOA 1N0RA 3ML9A 4B8CB 1MX4A 4MKTA 2BKGA 2DBAA 2H6HA 3Q15A 1S0PA 4JB8P 1O5MA 3S7JA 2XPZA 1MYOA 4BY6A 1E7VA 4APOA 2XCBA 4HOUA 5JMND 2FI7A 2ONDA 1W3BA 5CECB 2WXFA 3TWSA 4CRWA 1N4RA 3IHYA 3LJ3A 5AYWD 4J8SA 1N4QA 4JZYA 4BETA 2GGFA 3BQOA 3BG1B 1NI1A 1IKND 3B7BA 4IULA 3KSQA 3Q49B 2NSZA 2ZIRA 2BKKB 5E76A 2L6JA 3HG0D 2WXNA 4B8AA 5AN8A 5C2YA 3NBNB 3LPZA 3D9OA 4OAVB 3T8KA 2NXPA 1Q2ZA 3QK0A 2QYJA 3FTVA 3UKRG 2P9PG 4FU3A 5AQAA 2FBNA 3RRMB 4DX1A 2Y4TA 3G2UA 1WDYA 3PUJA 1ZU2A 5FT9A 4UQXA 4N5CA 3HXBA 4GMRA 5BXOA 3UT8A 3D9JA 3L13A 3QAQA 3B7SA 4OAUC 4N2QA 1XNFA 2YINA 3OAWA 3Q7AA 1SQMA 3CIAA 2LSUA 4ANVA 4KXKB 3Q79A 2DIWA 5FZQA 4HLLA 5G05J 2RG8A 2VYIA 5LP0A 1OCZE 5ENSD 1H19A 2LO6A 2HR2A 3ASDA 1QNFA 4G24A 1E7UA 3W9FA 4B93B 5KJKA 2OCCE 4HBDA 4BTAA 3RKVA 3NZSA 5KJLA 4MS6A 3T5VA 4Q69A 3EUVA 2GRNB 4U0UA 2DZOA 4HRNA 5BXUA 2AXZA 2LSVA 4DK5A 2X6IA 3RAUA 4F3VA 2QY7A 4AY5A 3CKBA 3C5RA 3NQPA 4WAFA 3Q78A 3D9MA 4ATZD 3FH5A 3FUIA 5JA4D 3E37A 4KZCA 1S70B 5CERB 3LCAA 4HB5A 1H6OA 3ZYLA 4C48B 2F37A 1SA5A 3CEQA 1H6PA 5G2NA 4GCOA 4GTRA 4JEUA 1KZPA 2GRLA 1TNYA 3NAWA 3CHMA 4J0UA 4FJZA 3D9PA 2XS1A 5IY5E 5CEAA 5KWDA 3RO2A 1QQEA 4EZLA 3TG5A 2DYRE 2KZTB 3TGOA 3RU0A 4YDOA 3AG1E 4JA7A 2R59A 2QZAA 2VSXE 3ZHEB 4A1GA 2XZDG 2VSNA 3FDHA 3UM1A 5J90A 3FTXA 4XZ4A 4ZHBA 4I17A 2VGXA 2WQ7A 3N71A 4GA2A 4U07A 2WMOA 3NF1A 4HNAD 4KMOA 3ESLA 4LG6A 3GW4A 1NA3A 3CSTA 4O1OA 5AJDA 3F6QA 3SF4A 1KLXA 3ZYQA 1H2UA 3L6AA 3EHNA 2F8YA 3FUDA 1YYHA 4HI9A 3NOGD 4I1MA 1SW6A 4AEZC 1N4PA 1MX6A 1OCCE 4GA0A 4XIFA 4GCNA 4WWOA 3DSSA 1EDUA 2EQXA 4KT6B 4J6IA 3D9NA 5AENA 3SNXA 1LTXA 4M7CA 3KS2A 3SFZA 3CK9A 4CEMA 4UWKA 5KJMA 3SO8A 3KD7A 4AY6A 4NACA 4L7TA 2OEVA 3CHOA 4OVUA 2CG2A 2CHXA 1TR4A 4RG6A 2RFAA 1N9AA 4EQFA 4TV3A 2ZGGA 3MKQB 1FT1A 3ZVVA 3QKYA 4L1BA 1O1SA 1RW2A 5CRVA 1A5EA 4QFVA 4CDNA 2E0IA 4G23A 5KNGA 1Y6IA 1QZ2A 5BUZA 2J4DA 2IY0C 2JLBA 2KXPC 4XX5A 3FH7A 1WAO1 3AS4A 2EINE 4BSZB 3HYMB 4JHJA 3FU5A 4Y6WA 4W9RA 1DCEA 2DVWA 1Z3YA 2AVPA 2XS8A 4I6JA 2C0MA 3AU5A 2GRPB 2ILRA 3PZDA 4K5BA 4GZDA 3ZEFA 2Q7FA 1DNPA 2A5UA 2J49A 4GTMA 4F7AA 4JD2G 4O6FA 5CHEE 3UT4A 3PNLB 3FY4A 4FADA 1D9SA 2WPVA 3C3QA 3QWWA 1ELWA 3TWVA 3ZYMA 2PQRA 1BU9A 3TWUA 4EECA 4G11A 5D2MC 2R05A 2VSYA 2UWJG 2PQNA 2WXJA 3AG4E 3FTSA 4CGWA 3IBEA 3ZPJA 5B1BE 2FEZA 5HKPA 1TNUA 3ASHA 1X5BA 1H0AA 2GRQB 4RQIA 4GYOA 3EHQA 5AQ9A 4WWPA 2VTBA 4U04A 5ANLA 4GZ5A 4A3VA 1Y8MA 3VTYA 5EILA 3DBSA 4FJYA 1JCSA 5G55A 1HFAA 2YNQA 3CK8A 2GRRB 1HS6A 3Q47B 3HVEA 4BT9A 1Z6TA 5CBOA 2WXKA 2XRZA 1JCQA 5CMYA 5KJNA 3Q9NC 2R5SA 4V3IA 2J8SD 4BX9A 4UWLA 4J8FA 3KSLA 3ZNGA 4I9CA 1O1TA 3RO3A 4GTVA 1XGWA 4NIKA 4G1TA 4JPSA 2BEDA 1K8KG 1OWLA 3CK7A 5HS0A 4UWHA 2HM8A 2R02A 5CBNA 3B7UX 4U63A 2C2LA 1WM5A 3EIQC 4ZFHA 4U96D 4HRMB 1HU3A 1Z3XA 4KZ0A 3L54A 3OXGA 4C0EA 2ZU6B 4B94A 3EIJA 4RLYA 2IONA 3LYAA 2V4HC 2ZISA 4OYSA 2WXHA 3DSVA 3P1UA 3S7FA 4LRZA 5FQ4A 3S2AA 3QJZA 4WNEA 5EYLA 1AP7A 5CEDB 2VGYA 3MJWA 1H2VC 1SVXA 4GB9A 1N94A 4LERA 3EHMA 1DCQA 3PZ4A 3KEZA 3FUEA 3FUHA 1E8ZA 2WXIA 5J08A 4FHKA 2YHCA 2BUGA 3OXFA 1N11A 3ABKE 1NL4A 4DX6D 2RKKA 4MBGA 3CVLA 3SBSA 4JVSA 4AM9A 5FQ6A 2V4LA 4WUYA 3IKOB 2PL2A 3L16A 4K5AB 3UINC 2X6JA 5A23A 4BSXA 1UW4B 3FWVA 3PVLA 2I9CA 4NRHB 4B0ZA 4PS8A 4KVOA 5HRYA 4WNGA 3G2TA 2AXVA 3G2VA 2J4BA 2EIKE 4GPKA 2R17C 1HG2A 3CVNA 4I2ZA 5CCMA 3PE3A 1NP7A 2P9SG 3APDA 3FUKA 1UJJA 2IO2C 1IXVA 3TL5A 2XGSA 3ONKA 3VTXA 3SI5A 4CDMA 4CT0A 3TXMA 3CQGB 5EIBE 3APFA 3ZYKA 4J7WA 3FUFA 2WXGA 3ENEA 5B3SE 4ME2A 1HE8A 3TWQA 2XCCA 3DRAA 2R2LA 4I6GA 4CT4A 3G2WA 2KCKA 3ASNE 2R03A 3O4ZA 4AJWA 2YHEA 5FZSA 2XHEA 3L82A 4NURA 2V5QC 5E75A 4WNDA 3MX3A 5AAOA 1EF1C 5ENNA 3QDNA 3E33A 4N3BA 4LNUD 4GAAA 1OY3D 4C9BB 4DUIA 4A63B 1BLXB 3ULQA 2CG3A 3ONLA 3B95A 1FVFA 3MCXA 3BU8A 3JUIA 3E34A 3UMVA 3SGHA 3PDNA 2EILE 2IQCA 4JA9A 1NZNA 3S7DA 3QWVA 1UG3A 3AU4A 3KAEA 4DLQA 3OTNA 3I5PA 3UI2A 5LCWJ 4Q96A 4U8VD 3B7RL 2XZTG 4B89A 3CKCA 4JXTA 2L0TB 5KBAA 3IEGA 3B7TA 4DI4A 2OV8A 1E8XA 1JWFA 4A1SA 5BPPA 5EYPF 2IO3C 1D8EA 2HE0A 3APCA 4HXIA 4ATGA 3RIBA 1UN9A 4FA6A 1OCRE 2L0IA 4JHRA 3UM2A 1U3DA 1X81A 2KZTA 1P5QA 4OVVA 3UM3A 1IYGA 4PDXA 1VDYA 2WQHA 3AG2E 3ZHEA 4K03A 4DPRA 1IQUA 5KNHD 2PM7A 3EU9A 4UI9C 3EJNA 4LNGA 4J8DA 3CVVA 4RSYA 5AJLA 5FZRA 4ILGA 1H6KA 1FPPA 2WXOA 3EU5A 2YQ8A 3VLDA 4DJAA 2P9NG 4FP7A 5FQ7A 1TNBA 5ANRA 3UPVA 3D3MA 5AIJA 1YA0A 2PM6A 2XRYA 4N5QA 5DIZA 3TAXA 3KEAA 2DZNA 4DI3A 4KVMA 4RVBA 2KATA 4H7XA 4JL0A 3R7RA 1N52A 3DPDA 4N2SA 4BX8A 4L9PA 3FUNA 3HXFA 2ZXWE 2L6BA 1PAQA 2IOSA 5AQ7A 1MQSA 3MZLB 2Y0BG 4G2VA 4IN3B 4U8YD 2J08A 3LVRE 3FP3A 3LEWA 3FEXA 2JABA 5H7PA 5BV0A 3UT7A 3MKQA 1SZ9A 3V2XA 2RFMA 4GU5A 4U8HA 2WXLA 3HXDA 1TN7A 2XENA 1E90A 5JHAA 2XPYA 5BNWA 1Z5SC 1SA4A 4PUCA 3K9IA 1OWPA 3FU0A 3E30A 1BI8B 3SZ7A 3U66A 3PUKA 4YDYA 3ML8A 3EHRA 4GMLA 1TNZA 4LEUA 4ILIA 4BERA 3VLFA 4KBQA 2KM4A 5D66A 4XI0A 2Y3AA 1QYMA 2LAIA 5JJ6A 2AW6A 3RJVA 5FINA 3FTUA 4GMJA 4U95D 5LCWC 5EX3A 1QBQA 5G04C 2Y4UA 4CGVA 3UIPC 2OOEA 4IYPA 3ASGA 4TXQA 3MA5A 3C3OA 4N39A 3UTMA 2KBXA 4EZKA 5EDSA 2B0OE 3JXIA 1V54E 4HQDA 2X6FA 1FVHA 4EHMA 1OWMA 3CVXA 3HDXA 4GPMA 4CZ2D 2UY1B 4GTQA 3ABME 2I6HA 2MOWA 1GW6A 1FCHA 3PEUB 2WVIA 1KZOA 5JJ7A 1TN8A 2MRIA 4GTSA 5ENRD 4UUCA 1IHGA 3FUMA 2P9UG 1JWGA 4JC8A 2X6KA 4EBAG 4UQYA 4AVXA 2KC7A 1G3NB 5D0OD 5CRUA 4ANXA 3QC1A 2E2EA 3ASOE 1TYQG 1IQRA 1HG5A 3GZ2A 1HH8A 4DX2A 1S64A 3TWRA 2Y1LE 2M63A 3HIZA 1JPLA 3U9WA 2P2CP 1K1BA 2WB2A 3AS5A 3DSUA 3CHPA 4UQZA 5AARA 1WY6A 1S63A 4URKA 4K5CA 4GYWA 3VLEA 4EZJA 3JUEA 5ENTD 4I9EA 2H6FA 3UX4A 2A4ZA 3LVQE 4U0SA 3MYVA 3RSEG 4C0MA 4JW1A 2EIJE 4HOQA 4BESA 1D8DA 4Z68A 4BWRA 3MV3B 3RRNB 2GROB 3ZFWA 3DPYA 4N3AA 2V0PA 2HO1A 5ENPD 2KCLA 3HXEA 2I1JA 4HORA 1N54A 2VSOE 3CVWA 3QOUA 1KT1A 4YDEA 2I1KA 4PS3A 1O1RA 1TEZA 3ZN3A 2XPIA 3DSTA 4HLEA 4AXHA 2P9LG 3ZXPA 2DWZA 3GZ1A 1MZCA 3LDZA 2AWIA 5D0QD 3SHFA 5FWQA 4BEPA 1UJKA 2KCVA 1DC2A 2J9QA 5EX0A 1HF8A 3LS8A 1V55E 2GRMA 5ENQD 3PH0C 1OXJA 2DCPA 4WWNA 4UI9J 3ZW3A 1B89A 3TXNA 1H2TC 3CR3A 4ABNA 3JQ1A 2H6IA 3C98A 3UKUG 5EKQD 3PZ1A 5FQ8A 4GTOA 1N95A 1K1AA 3L9TA 4D10C 2P9KG 2OVBA 2B6CA 5JHBA 3ZRHA 4EPZA 4JHKA 4F1PA 3PEVB 4YDWA 2AXUA 3IXEA 4TXPA 4AIFA 4I2WA 3QWPA 2WXRA 4APFA 5BT1A 3JYSA 3C3RA 4J8EA 3I3NA 3O48A 4BTBA 4U7EB 4A3TA 2WM9A 4BFRA 3CQCB 3E4BA 3D9IA 3ZIMA 2F0YA 4I1OB 4HVBA 2WMNA 3FU6A 4Q94A 4FHJA 3R9AB 2NYJA 1A17A 4KYOB 1ELKA 3RK6A 2XGMA 5BV1A 2ETBA 3X2QE 5A7DB 2VJ8A 5EIDA 4GZ6A 3SBTB 2GW1A 3GZSA 5BW8C 3D9LA 1L5JA 2QFCA 4PH4B 3FUJA 2CFZA 3S7BA 4YVOA 3JXJA 1OWOA 1PC2A 2Y69E 1U3CA 2IOLA 2MYOA 3JCKC 3UXGA 2IEJA 3ULYA 2XQ0A 2ETAA 2H6GA 4F1SA 1ELRA 4HFGA 5LFAA 3DEOA 3ZUVB 4ILHB 3PZ2A 1U2VG 5B1AE 1SZAA 1FT2A 4LNBA 4CCAA 3IHVA 3MV2B 3DSWA 3T8MA 4I6EA 2CFUA 3DEPA 4HOSA 3DXKG 1MHQA 3MGBA 4I43A 1TNOA 2WQ6A 2FF4A 5G04J 4DRXE 2FO1E 3LY9A 1E8YA 2ETCA 5M72A 4HOTA 1E96B 1DVPA 1IHBA 3BEEA 4NQ0A 5AQBA 2VGEA 5ENOD 2FULA 5T3RA 4A55A 3CGHA 2X6HA 4GZ3A 4ANWA 2C0LA 4TUMA 4EBAA 1RZ4A 4N3CA 3WG7E 3CVUA 5HI7A 3TJPA 5ITZF 4F6RD 3FU3A 1MJ0A 3ASFA 2IJGX 3R9MA 3J5QB 2BTDA 4GZCA 3Q9UC 2J07A 2XEHA 3Q73A 5LOZA 3ZGQA 4I1AA 3BG0B 1AWCB 3U3WA 2CHZA 4FLHA 3FULA 2AJAA 3SFYA 4DLOA 1YMPA 4O60A 3NOCD 2LUHA 3TWTA 5LX8A 3UUXA 4AP2A 2VGXB 4G8LA 4R7LA 4GA1A 2PZIA 1MX2A 3TWWA 1HO8A 3HHMA 2CHWA 2HYZA 2DYSE 3R7QA 2PNNA 3J5PA 2LNIA 2F8XK 4JEHA 2NC9A 3Q75A 4J8YA 1LF8A 2IF4A 1BD8A 4LCTA 5FJYA 2I2OA 2QYUA 4U0ZA 2V5FA 1HX8A 3FFLA 3ZU7B 3HXCA 3SY2A 3FTYA 1E8WA 3DXMG 2XEVA 3CSFA 4UI9K 1HZ4A 1OWNA 1KT0A 3PE4A 4G8KA 3DSXA 3OXLA 5CCLA 4TUUA 4UWFA 3IV0A 4L23A 5FIOA 3PNTB 3L17A 2IFUA 3CHQA 4ACLA 2V8SE 3FTZA 3NZUA 4FC8A 3T5XA 1N0QA 3FHEA 4MRUA 2OVFA 1NFIE 2MHKA 2ZGDA 4Y6CA 1ZB1A 3ZXSA 4XI9A 3Q7FA 2P58C 2A5EA 3CHSA 1OCOE 3FH8A 3CVPA 3MEKA 4IRUA 4K0RA 2VQ2A 3JQ0A 3FEYA 1UN8A 3LY7A 4CDRA 5G05C 2QC9A 4AOFA 3AJIA 2WXMA 3TG4A 1LD7A 4ACKA 3MKRA 1EPUA 1KPSB 1TJCA 2LAHA 3PS6A 5KCMA 4AV7A 3PRZA 4DX5D 2P9IG 5EN5D 3U4TA 2J09A 4LSZE 3BUAA 3ESKA 4F53A 4WNFA 3V2OA 3TWXA 4DX7D 3AG3E 3C72A 4HI8A 3AS8A 4E6HA 3LJNA 3L08A 5T8IA 1OT8A 1HXIA 3W9GA 1OUVA 1NA0A 4FULA 3CHRA 3CVQA 1ZBPA 2WXPA 4FLBA 3UIOC 4QQIA 4YVQC 3SD5A 1BI7B 3V79K 5ARGA 3Q4AB 3D9HA 1INZA 1JUQA 5DBKA 4TRQA 1UOHA 4O1PA 3QARA 3B13A 3L22A 2UY1A 1LD8A 4M3OA 4P29A 3I4GA 2X38A 4LUNU 3CVYA 2EIME 3Q5MA 2OEWA 4HRLA 4PS7A 4G25A 4XKCA 2VTBB 1K3ZD 4L2LA 3LY8A 3ISMC 2LXMA 4HS2A 1JCRA 4H7YA 1N4SA 2X3MA 4XEIG 4X8QA 3PREA 5ARFA 5CMWA 4UWGA 5FTPA 3V31A 3UQ3A 3ABLE 5HQ8A 3V30A 3E32A 3HVEB 3SQVA 5A6CA 1PY1A 3RRUA 1WG0A 3QB2A 3D9KA 4RG9A 3CLJA 3LXUX 3G2SA 2XEEA 4GTPA 1EYHA 5JJTA 3QNKA 4GTTA 4L2YA 3URZA 3FTWA 4MLPA 3U64A 5C1DA 3PZ3A 5T4YA 1TJFA 1TN6A 3AAAC 3SFXA 3EDTB 2WXQA 3LKUA 4G26A
chains in the Genus database with same CATH topology
5ENRD 3F6QA 4UUCA 3V79K 5AAOA 2J8SD 2XENA 2DZOA 4HRNA 5BXUA 2BKKB 2NYJA 3HG0D 1YCSB 3D9HA 4K5AB 3ZKJA 4LNUD 1N0QA 5ITZF 1UOHA 4K5BA 5KNHD 2F8YA 4O1PA 3ZNGA 5AN8A 4F6RD 1YYHA 2ETBA 1NFIE 1OY3D 1G3NB 3EU9A 3NBNB 4HI9A 3T9KA 3C5RA 3NOGD 1MJ0A 4ATZD 2ZGDA 1SW6A 3HRAA 5JA4D 4OAVB 4NIKA 4DUIA 1BI8B 1MX6A 3J5QB 5EIDA 2DWZA 3T8KA 3Q9UC 4A63B 1S70B 2QYJA 5HRYA 5CERB 4YDYA 1BLXB 5HS0A 2XEHA 5AQAA 4HB5A 2A5EA 4BEPA 3EHRA 4DX1A 5CBNA 1D9SA 4HRLA 1AWCB 4C48B 3B95A 2F37A 4BERA 3JXJA 4DX2A 3TWVA 4ZFHA 1K3ZD 2AJAA 4U96D 5D66A 4HRMB 1DC2A 1BU9A 1WDYA 3TWUA 1YMPA 4O60A 3NOCD 2Y1LE 1QYMA 3TWRA 3TWTA 2MYOA 4CYMD 2QC9A 2P2CP 5FINA 5ENQD 1K1BA 3UXGA 3AJIA 2ETAA 4G8LA 4GMRA 4RLYA 4U95D 5BXOA 1N0RA 3SO8A 2V4HC 3V31A 1MX4A 2BKGA 5AARA 3V30A 1IXVA 3UI2A 5CEAA 3DEOA 3ZUVB 4N5QA 5KWDA 1MX2A 1TR4A 5HKPA 4U8VD 2XZTG 3TWWA 4JB8P 3KEAA 2DZNA 2RFAA 5EYLA 1AP7A 1WG0A 5CEDB 4OAUC 2ZGGA 3UTMA 1MYOA 4K5CA 3EHQA 2KBXA 5AQ9A 4DX5D 3JUEA 5ENTD 5EN5D 5EIBE 2PNNA 4J7WA 3J5PA 1SVXA 2B0OE 2XEEA 1K1AA 5KBAA 2F8XK 3JXIA 1A5EA 4J8YA 4LSZE 4HQDA 4QFVA 5JMND 2XZDG 1BD8A 1DCQA 4HLLA 5EILA 3DEPA 4F1PA 4YDWA 5KNGA 5EYPF 3TWQA 3TWXA 3IXEA 3V2OA 4DX7D 5CECB 3ZU7B 5ENSD 2L6BA 4GPMA 4HI8A 4BESA 4CZ2D 5AQ7A 4ZHBA 2HE0A 4Z68A 3TWSA 4DRXE 2KXPC 2FO1E 2Y0BG 3W9FA 4B93B 3LJNA 4HBDA 4U8YD 2ETCA 1N11A 4HNAD 4BETA 1IHBA 4G8KA 3AAAC 5ENPD 5CBOA 1OT8A 3W9GA 4DX6D 1IKND 4LG6A 2JABA 5AQBA 5FIOA 4BSZB 2VGEA 3B7BA 5ENOD 3V2XA 4O1OA 4QQIA 2RFMA 2V5QC 3Q9NC 1BI7B 4TUMA 2DVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ENR D;  3F6Q A;  4UUC A;  3V79 K;  5AAO A;  2J8S D;  2XEN A;  2DZO A;  4HRN A;  5BXU A;  2BKK B;  2NYJ A;  3HG0 D;  1YCS B;  3D9H A;  4K5A B;  3ZKJ A;  4LNU D;  1N0Q A;  5ITZ F;  1UOH A;  4K5B A;  5KNH D;  2F8Y A;  4O1P A;  3ZNG A;  5AN8 A;  4F6R D;  1YYH A;  2ETB A;  1NFI E;  1OY3 D;  1G3N B;  3EU9 A;  3NBN B;  4HI9 A;  3T9K A;  3C5R A;  3NOG D;  1MJ0 A;  4ATZ D;  2ZGD A;  1SW6 A;  3HRA A;  5JA4 D;  4OAV B;  4NIK A;  4DUI A;  1BI8 B;  1MX6 A;  3J5Q B;  5EID A;  2DWZ A;  3T8K A;  3Q9U C;  4A63 B;  1S70 B;  2QYJ A;  5HRY A;  5CER B;  4YDY A;  1BLX B;  5HS0 A;  2XEH A;  5AQA A;  4HB5 A;  2A5E A;  4BEP A;  3EHR A;  4DX1 A;  5CBN A;  1D9S A;  4HRL A;  1AWC B;  4C48 B;  3B95 A;  2F37 A;  4BER A;  3JXJ A;  4DX2 A;  3TWV A;  4ZFH A;  1K3Z D;  2AJA A;  4U96 D;  5D66 A;  4HRM B;  1DC2 A;  1BU9 A;  1WDY A;  3TWU A;  1YMP A;  4O60 A;  3NOC D;  2Y1L E;  1QYM A;  3TWR A;  3TWT A;  2MYO A;  4CYM D;  2QC9 A;  2P2C P;  5FIN A;  5ENQ D;  1K1B A;  3UXG A;  3AJI A;  2ETA A;  4G8L A;  4GMR A;  4RLY A;  4U95 D;  5BXO A;  1N0R A;  3SO8 A;  2V4H C;  3V31 A;  1MX4 A;  2BKG A;  5AAR A;  3V30 A;  1IXV A;  3UI2 A;  5CEA A;  3DEO A;  3ZUV B;  4N5Q A;  5KWD A;  1MX2 A;  1TR4 A;  5HKP A;  4U8V D;  2XZT G;  3TWW A;  4JB8 P;  3KEA A;  2DZN A;  2RFA A;  5EYL A;  1AP7 A;  1WG0 A;  5CED B;  4OAU C;  2ZGG A;  3UTM A;  1MYO A;  4K5C A;  3EHQ A;  2KBX A;  5AQ9 A;  4DX5 D;  3JUE A;  5ENT D;  5EN5 D;  5EIB E;  2PNN A;  4J7W A;  3J5P A;  1SVX A;  2B0O E;  2XEE A;  1K1A A;  5KBA A;  2F8X K;  3JXI A;  1A5E A;  4J8Y A;  4LSZ E;  4HQD A;  4QFV A;  5JMN D;  2XZD G;  1BD8 A;  1DCQ A;  4HLL A;  5EIL A;  3DEP A;  4F1P A;  4YDW A;  5KNG A;  5EYP F;  3TWQ A;  3TWX A;  3IXE A;  3V2O A;  4DX7 D;  5CEC B;  3ZU7 B;  5ENS D;  2L6B A;  4GPM A;  4HI8 A;  4BES A;  4CZ2 D;  5AQ7 A;  4ZHB A;  2HE0 A;  4Z68 A;  3TWS A;  4DRX E;  2KXP C;  2FO1 E;  2Y0B G;  3W9F A;  4B93 B;  3LJN A;  4HBD A;  4U8Y D;  2ETC A;  1N11 A;  4HNA D;  4BET A;  1IHB A;  4G8K A;  3AAA C;  5ENP D;  5CBO A;  1OT8 A;  3W9G A;  4DX6 D;  1IKN D;  4LG6 A;  2JAB A;  5AQB A;  5FIO A;  4BSZ B;  2VGE A;  3B7B A;  5ENO D;  3V2X A;  4O1O A;  4QQI A;  2RFM A;  2V5Q C;  3Q9N C;  1BI7 B;  4TUM A;  2DVW A; 
#chains in the Genus database with same CATH topology
 4XKB A;  3WXX A;  2JEK A;  4BT8 A;  3CV0 A;  1YCS B;  3ZKJ A;  3I4R B;  2FO7 A;  3T9K A;  3DWL G;  3HRA A;  4XE0 A;  4YND A;  2LXL A;  3UM0 A;  2BF0 X;  3P2B A;  4ANU A;  4E85 A;  2IU1 A;  2RD0 A;  2L9B A;  2XGO A;  4TXR A;  3ULE G;  4CYM D;  3GYZ A;  3NB2 A;  4GYY A;  1BPO A;  1N0R A;  3ML9 A;  4B8C B;  1MX4 A;  4MKT A;  2BKG A;  2DBA A;  2H6H A;  3Q15 A;  1S0P A;  4JB8 P;  1O5M A;  3S7J A;  2XPZ A;  1MYO A;  4BY6 A;  1E7V A;  4APO A;  2XCB A;  4HOU A;  5JMN D;  2FI7 A;  2OND A;  1W3B A;  5CEC B;  2WXF A;  3TWS A;  4CRW A;  1N4R A;  3IHY A;  3LJ3 A;  5AYW D;  4J8S A;  1N4Q A;  4JZY A;  4BET A;  2GGF A;  3BQO A;  3BG1 B;  1NI1 A;  1IKN D;  3B7B A;  4IUL A;  3KSQ A;  3Q49 B;  2NSZ A;  2ZIR A;  2BKK B;  5E76 A;  2L6J A;  3HG0 D;  2WXN A;  4B8A A;  5AN8 A;  5C2Y A;  3NBN B;  3LPZ A;  3D9O A;  4OAV B;  3T8K A;  2NXP A;  1Q2Z A;  3QK0 A;  2QYJ A;  3FTV A;  3UKR G;  2P9P G;  4FU3 A;  5AQA A;  2FBN A;  3RRM B;  4DX1 A;  2Y4T A;  3G2U A;  1WDY A;  3PUJ A;  1ZU2 A;  5FT9 A;  4UQX A;  4N5C A;  3HXB A;  4GMR A;  5BXO A;  3UT8 A;  3D9J A;  3L13 A;  3QAQ A;  3B7S A;  4OAU C;  4N2Q A;  1XNF A;  2YIN A;  3OAW A;  3Q7A A;  1SQM A;  3CIA A;  2LSU A;  4ANV A;  4KXK B;  3Q79 A;  2DIW A;  5FZQ A;  4HLL A;  5G05 J;  2RG8 A;  2VYI A;  5LP0 A;  1OCZ E;  5ENS D;  1H19 A;  2LO6 A;  2HR2 A;  3ASD A;  1QNF A;  4G24 A;  1E7U A;  3W9F A;  4B93 B;  5KJK A;  2OCC E;  4HBD A;  4BTA A;  3RKV A;  3NZS A;  5KJL A;  4MS6 A;  3T5V A;  4Q69 A;  3EUV A;  2GRN B;  4U0U A;  2DZO A;  4HRN A;  5BXU A;  2AXZ A;  2LSV A;  4DK5 A;  2X6I A;  3RAU A;  4F3V A;  2QY7 A;  4AY5 A;  3CKB A;  3C5R A;  3NQP A;  4WAF A;  3Q78 A;  3D9M A;  4ATZ D;  3FH5 A;  3FUI A;  5JA4 D;  3E37 A;  4KZC A;  1S70 B;  5CER B;  3LCA A;  4HB5 A;  1H6O A;  3ZYL A;  4C48 B;  2F37 A;  1SA5 A;  3CEQ A;  1H6P A;  5G2N A;  4GCO A;  4GTR A;  4JEU A;  1KZP A;  2GRL A;  1TNY A;  3NAW A;  3CHM A;  4J0U A;  4FJZ A;  3D9P A;  2XS1 A;  5IY5 E;  5CEA A;  5KWD A;  3RO2 A;  1QQE A;  4EZL A;  3TG5 A;  2DYR E;  2KZT B;  3TGO A;  3RU0 A;  4YDO A;  3AG1 E;  4JA7 A;  2R59 A;  2QZA A;  2VSX E;  3ZHE B;  4A1G A;  2XZD G;  2VSN A;  3FDH A;  3UM1 A;  5J90 A;  3FTX A;  4XZ4 A;  4ZHB A;  4I17 A;  2VGX A;  2WQ7 A;  3N71 A;  4GA2 A;  4U07 A;  2WMO A;  3NF1 A;  4HNA D;  4KMO A;  3ESL A;  4LG6 A;  3GW4 A;  1NA3 A;  3CST A;  4O1O A;  5AJD A;  3F6Q A;  3SF4 A;  1KLX A;  3ZYQ A;  1H2U A;  3L6A A;  3EHN A;  2F8Y A;  3FUD A;  1YYH A;  4HI9 A;  3NOG D;  4I1M A;  1SW6 A;  4AEZ C;  1N4P A;  1MX6 A;  1OCC E;  4GA0 A;  4XIF A;  4GCN A;  4WWO A;  3DSS A;  1EDU A;  2EQX A;  4KT6 B;  4J6I A;  3D9N A;  5AEN A;  3SNX A;  1LTX A;  4M7C A;  3KS2 A;  3SFZ A;  3CK9 A;  4CEM A;  4UWK A;  5KJM A;  3SO8 A;  3KD7 A;  4AY6 A;  4NAC A;  4L7T A;  2OEV A;  3CHO A;  4OVU A;  2CG2 A;  2CHX A;  1TR4 A;  4RG6 A;  2RFA A;  1N9A A;  4EQF A;  4TV3 A;  2ZGG A;  3MKQ B;  1FT1 A;  3ZVV A;  3QKY A;  4L1B A;  1O1S A;  1RW2 A;  5CRV A;  1A5E A;  4QFV A;  4CDN A;  2E0I A;  4G23 A;  5KNG A;  1Y6I A;  1QZ2 A;  5BUZ A;  2J4D A;  2IY0 C;  2JLB A;  2KXP C;  4XX5 A;  3FH7 A;  1WAO 1;  3AS4 A;  2EIN E;  4BSZ B;  3HYM B;  4JHJ A;  3FU5 A;  4Y6W A;  4W9R A;  1DCE A;  2DVW A;  1Z3Y A;  2AVP A;  2XS8 A;  4I6J A;  2C0M A;  3AU5 A;  2GRP B;  2ILR A;  3PZD A;  4K5B A;  4GZD A;  3ZEF A;  2Q7F A;  1DNP A;  2A5U A;  2J49 A;  4GTM A;  4F7A A;  4JD2 G;  4O6F A;  5CHE E;  3UT4 A;  3PNL B;  3FY4 A;  4FAD A;  1D9S A;  2WPV A;  3C3Q A;  3QWW A;  1ELW A;  3TWV A;  3ZYM A;  2PQR A;  1BU9 A;  3TWU A;  4EEC A;  4G11 A;  5D2M C;  2R05 A;  2VSY A;  2UWJ G;  2PQN A;  2WXJ A;  3AG4 E;  3FTS A;  4CGW A;  3IBE A;  3ZPJ A;  5B1B E;  2FEZ A;  5HKP A;  1TNU A;  3ASH A;  1X5B A;  1H0A A;  2GRQ B;  4RQI A;  4GYO A;  3EHQ A;  5AQ9 A;  4WWP A;  2VTB A;  4U04 A;  5ANL A;  4GZ5 A;  4A3V A;  1Y8M A;  3VTY A;  5EIL A;  3DBS A;  4FJY A;  1JCS A;  5G55 A;  1HFA A;  2YNQ A;  3CK8 A;  2GRR B;  1HS6 A;  3Q47 B;  3HVE A;  4BT9 A;  1Z6T A;  5CBO A;  2WXK A;  2XRZ A;  1JCQ A;  5CMY A;  5KJN A;  3Q9N C;  2R5S A;  4V3I A;  2J8S D;  4BX9 A;  4UWL A;  4J8F A;  3KSL A;  3ZNG A;  4I9C A;  1O1T A;  3RO3 A;  4GTV A;  1XGW A;  4NIK A;  4G1T A;  4JPS A;  2BED A;  1K8K G;  1OWL A;  3CK7 A;  5HS0 A;  4UWH A;  2HM8 A;  2R02 A;  5CBN A;  3B7U X;  4U63 A;  2C2L A;  1WM5 A;  3EIQ C;  4ZFH A;  4U96 D;  4HRM B;  1HU3 A;  1Z3X A;  4KZ0 A;  3L54 A;  3OXG A;  4C0E A;  2ZU6 B;  4B94 A;  3EIJ A;  4RLY A;  2ION A;  3LYA A;  2V4H C;  2ZIS A;  4OYS A;  2WXH A;  3DSV A;  3P1U A;  3S7F A;  4LRZ A;  5FQ4 A;  3S2A A;  3QJZ A;  4WNE A;  5EYL A;  1AP7 A;  5CED B;  2VGY A;  3MJW A;  1H2V C;  1SVX A;  4GB9 A;  1N94 A;  4LER A;  3EHM A;  1DCQ A;  3PZ4 A;  3KEZ A;  3FUE A;  3FUH A;  1E8Z A;  2WXI A;  5J08 A;  4FHK A;  2YHC A;  2BUG A;  3OXF A;  1N11 A;  3ABK E;  1NL4 A;  4DX6 D;  2RKK A;  4MBG A;  3CVL A;  3SBS A;  4JVS A;  4AM9 A;  5FQ6 A;  2V4L A;  4WUY A;  3IKO B;  2PL2 A;  3L16 A;  4K5A B;  3UIN C;  2X6J A;  5A23 A;  4BSX A;  1UW4 B;  3FWV A;  3PVL A;  2I9C A;  4NRH B;  4B0Z A;  4PS8 A;  4KVO A;  5HRY A;  4WNG A;  3G2T A;  2AXV A;  3G2V A;  2J4B A;  2EIK E;  4GPK A;  2R17 C;  1HG2 A;  3CVN A;  4I2Z A;  5CCM A;  3PE3 A;  1NP7 A;  2P9S G;  3APD A;  3FUK A;  1UJJ A;  2IO2 C;  1IXV A;  3TL5 A;  2XGS A;  3ONK A;  3VTX A;  3SI5 A;  4CDM A;  4CT0 A;  3TXM A;  3CQG B;  5EIB E;  3APF A;  3ZYK A;  4J7W A;  3FUF A;  2WXG A;  3ENE A;  5B3S E;  4ME2 A;  1HE8 A;  3TWQ A;  2XCC A;  3DRA A;  2R2L A;  4I6G A;  4CT4 A;  3G2W A;  2KCK A;  3ASN E;  2R03 A;  3O4Z A;  4AJW A;  2YHE A;  5FZS A;  2XHE A;  3L82 A;  4NUR A;  2V5Q C;  5E75 A;  4WND A;  3MX3 A;  5AAO A;  1EF1 C;  5ENN A;  3QDN A;  3E33 A;  4N3B A;  4LNU D;  4GAA A;  1OY3 D;  4C9B B;  4DUI A;  4A63 B;  1BLX B;  3ULQ A;  2CG3 A;  3ONL A;  3B95 A;  1FVF A;  3MCX A;  3BU8 A;  3JUI A;  3E34 A;  3UMV A;  3SGH A;  3PDN A;  2EIL E;  2IQC A;  4JA9 A;  1NZN A;  3S7D A;  3QWV A;  1UG3 A;  3AU4 A;  3KAE A;  4DLQ A;  3OTN A;  3I5P A;  3UI2 A;  5LCW J;  4Q96 A;  4U8V D;  3B7R L;  2XZT G;  4B89 A;  3CKC A;  4JXT A;  2L0T B;  5KBA A;  3IEG A;  3B7T A;  4DI4 A;  2OV8 A;  1E8X A;  1JWF A;  4A1S A;  5BPP A;  5EYP F;  2IO3 C;  1D8E A;  2HE0 A;  3APC A;  4HXI A;  4ATG A;  3RIB A;  1UN9 A;  4FA6 A;  1OCR E;  2L0I A;  4JHR A;  3UM2 A;  1U3D A;  1X81 A;  2KZT A;  1P5Q A;  4OVV A;  3UM3 A;  1IYG A;  4PDX A;  1VDY A;  2WQH A;  3AG2 E;  3ZHE A;  4K03 A;  4DPR A;  1IQU A;  5KNH D;  2PM7 A;  3EU9 A;  4UI9 C;  3EJN A;  4LNG A;  4J8D A;  3CVV A;  4RSY A;  5AJL A;  5FZR A;  4ILG A;  1H6K A;  1FPP A;  2WXO A;  3EU5 A;  2YQ8 A;  3VLD A;  4DJA A;  2P9N G;  4FP7 A;  5FQ7 A;  1TNB A;  5ANR A;  3UPV A;  3D3M A;  5AIJ A;  1YA0 A;  2PM6 A;  2XRY A;  4N5Q A;  5DIZ A;  3TAX A;  3KEA A;  2DZN A;  4DI3 A;  4KVM A;  4RVB A;  2KAT A;  4H7X A;  4JL0 A;  3R7R A;  1N52 A;  3DPD A;  4N2S A;  4BX8 A;  4L9P A;  3FUN A;  3HXF A;  2ZXW E;  2L6B A;  1PAQ A;  2IOS A;  5AQ7 A;  1MQS A;  3MZL B;  2Y0B G;  4G2V A;  4IN3 B;  4U8Y D;  2J08 A;  3LVR E;  3FP3 A;  3LEW A;  3FEX A;  2JAB A;  5H7P A;  5BV0 A;  3UT7 A;  3MKQ A;  1SZ9 A;  3V2X A;  2RFM A;  4GU5 A;  4U8H A;  2WXL A;  3HXD A;  1TN7 A;  2XEN A;  1E90 A;  5JHA A;  2XPY A;  5BNW A;  1Z5S C;  1SA4 A;  4PUC A;  3K9I A;  1OWP A;  3FU0 A;  3E30 A;  1BI8 B;  3SZ7 A;  3U66 A;  3PUK A;  4YDY A;  3ML8 A;  3EHR A;  4GML A;  1TNZ A;  4LEU A;  4ILI A;  4BER A;  3VLF A;  4KBQ A;  2KM4 A;  5D66 A;  4XI0 A;  2Y3A A;  1QYM A;  2LAI A;  5JJ6 A;  2AW6 A;  3RJV A;  5FIN A;  3FTU A;  4GMJ A;  4U95 D;  5LCW C;  5EX3 A;  1QBQ A;  5G04 C;  2Y4U A;  4CGV A;  3UIP C;  2OOE A;  4IYP A;  3ASG A;  4TXQ A;  3MA5 A;  3C3O A;  4N39 A;  3UTM A;  2KBX A;  4EZK A;  5EDS A;  2B0O E;  3JXI A;  1V54 E;  4HQD A;  2X6F A;  1FVH A;  4EHM A;  1OWM A;  3CVX A;  3HDX A;  4GPM A;  4CZ2 D;  2UY1 B;  4GTQ A;  3ABM E;  2I6H A;  2MOW A;  1GW6 A;  1FCH A;  3PEU B;  2WVI A;  1KZO A;  5JJ7 A;  1TN8 A;  2MRI A;  4GTS A;  5ENR D;  4UUC A;  1IHG A;  3FUM A;  2P9U G;  1JWG A;  4JC8 A;  2X6K A;  4EBA G;  4UQY A;  4AVX A;  2KC7 A;  1G3N B;  5D0O D;  5CRU A;  4ANX A;  3QC1 A;  2E2E A;  3ASO E;  1TYQ G;  1IQR A;  1HG5 A;  3GZ2 A;  1HH8 A;  4DX2 A;  1S64 A;  3TWR A;  2Y1L E;  2M63 A;  3HIZ A;  1JPL A;  3U9W A;  2P2C P;  1K1B A;  2WB2 A;  3AS5 A;  3DSU A;  3CHP A;  4UQZ A;  5AAR A;  1WY6 A;  1S63 A;  4URK A;  4K5C A;  4GYW A;  3VLE A;  4EZJ A;  3JUE A;  5ENT D;  4I9E A;  2H6F A;  3UX4 A;  2A4Z A;  3LVQ E;  4U0S A;  3MYV A;  3RSE G;  4C0M A;  4JW1 A;  2EIJ E;  4HOQ A;  4BES A;  1D8D A;  4Z68 A;  4BWR A;  3MV3 B;  3RRN B;  2GRO B;  3ZFW A;  3DPY A;  4N3A A;  2V0P A;  2HO1 A;  5ENP D;  2KCL A;  3HXE A;  2I1J A;  4HOR A;  1N54 A;  2VSO E;  3CVW A;  3QOU A;  1KT1 A;  4YDE A;  2I1K A;  4PS3 A;  1O1R A;  1TEZ A;  3ZN3 A;  2XPI A;  3DST A;  4HLE A;  4AXH A;  2P9L G;  3ZXP A;  2DWZ A;  3GZ1 A;  1MZC A;  3LDZ A;  2AWI A;  5D0Q D;  3SHF A;  5FWQ A;  4BEP A;  1UJK A;  2KCV A;  1DC2 A;  2J9Q A;  5EX0 A;  1HF8 A;  3LS8 A;  1V55 E;  2GRM A;  5ENQ D;  3PH0 C;  1OXJ A;  2DCP A;  4WWN A;  4UI9 J;  3ZW3 A;  1B89 A;  3TXN A;  1H2T C;  3CR3 A;  4ABN A;  3JQ1 A;  2H6I A;  3C98 A;  3UKU G;  5EKQ D;  3PZ1 A;  5FQ8 A;  4GTO A;  1N95 A;  1K1A A;  3L9T A;  4D10 C;  2P9K G;  2OVB A;  2B6C A;  5JHB A;  3ZRH A;  4EPZ A;  4JHK A;  4F1P A;  3PEV B;  4YDW A;  2AXU A;  3IXE A;  4TXP A;  4AIF A;  4I2W A;  3QWP A;  2WXR A;  4APF A;  5BT1 A;  3JYS A;  3C3R A;  4J8E A;  3I3N A;  3O48 A;  4BTB A;  4U7E B;  4A3T A;  2WM9 A;  4BFR A;  3CQC B;  3E4B A;  3D9I A;  3ZIM A;  2F0Y A;  4I1O B;  4HVB A;  2WMN A;  3FU6 A;  4Q94 A;  4FHJ A;  3R9A B;  2NYJ A;  1A17 A;  4KYO B;  1ELK A;  3RK6 A;  2XGM A;  5BV1 A;  2ETB A;  3X2Q E;  5A7D B;  2VJ8 A;  5EID A;  4GZ6 A;  3SBT B;  2GW1 A;  3GZS A;  5BW8 C;  3D9L A;  1L5J A;  2QFC A;  4PH4 B;  3FUJ A;  2CFZ A;  3S7B A;  4YVO A;  3JXJ A;  1OWO A;  1PC2 A;  2Y69 E;  1U3C A;  2IOL A;  2MYO A;  3JCK C;  3UXG A;  2IEJ A;  3ULY A;  2XQ0 A;  2ETA A;  2H6G A;  4F1S A;  1ELR A;  4HFG A;  5LFA A;  3DEO A;  3ZUV B;  4ILH B;  3PZ2 A;  1U2V G;  5B1A E;  1SZA A;  1FT2 A;  4LNB A;  4CCA A;  3IHV A;  3MV2 B;  3DSW A;  3T8M A;  4I6E A;  2CFU A;  3DEP A;  4HOS A;  3DXK G;  1MHQ A;  3MGB A;  4I43 A;  1TNO A;  2WQ6 A;  2FF4 A;  5G04 J;  4DRX E;  2FO1 E;  3LY9 A;  1E8Y A;  2ETC A;  5M72 A;  4HOT A;  1E96 B;  1DVP A;  1IHB A;  3BEE A;  4NQ0 A;  5AQB A;  2VGE A;  5ENO D;  2FUL A;  5T3R A;  4A55 A;  3CGH A;  2X6H A;  4GZ3 A;  4ANW A;  2C0L A;  4TUM A;  4EBA A;  1RZ4 A;  4N3C A;  3WG7 E;  3CVU A;  5HI7 A;  3TJP A;  5ITZ F;  4F6R D;  3FU3 A;  1MJ0 A;  3ASF A;  2IJG X;  3R9M A;  3J5Q B;  2BTD A;  4GZC A;  3Q9U C;  2J07 A;  2XEH A;  3Q73 A;  5LOZ A;  3ZGQ A;  4I1A A;  3BG0 B;  1AWC B;  3U3W A;  2CHZ A;  4FLH A;  3FUL A;  2AJA A;  3SFY A;  4DLO A;  1YMP A;  4O60 A;  3NOC D;  2LUH A;  3TWT A;  5LX8 A;  3UUX A;  4AP2 A;  2VGX B;  4G8L A;  4R7L A;  4GA1 A;  2PZI A;  1MX2 A;  3TWW A;  1HO8 A;  3HHM A;  2CHW A;  2HYZ A;  2DYS E;  3R7Q A;  2PNN A;  3J5P A;  2LNI A;  2F8X K;  4JEH A;  2NC9 A;  3Q75 A;  4J8Y A;  1LF8 A;  2IF4 A;  1BD8 A;  4LCT A;  5FJY A;  2I2O A;  2QYU A;  4U0Z A;  2V5F A;  1HX8 A;  3FFL A;  3ZU7 B;  3HXC A;  3SY2 A;  3FTY A;  1E8W A;  3DXM G;  2XEV A;  3CSF A;  4UI9 K;  1HZ4 A;  1OWN A;  1KT0 A;  3PE4 A;  4G8K A;  3DSX A;  3OXL A;  5CCL A;  4TUU A;  4UWF A;  3IV0 A;  4L23 A;  5FIO A;  3PNT B;  3L17 A;  2IFU A;  3CHQ A;  4ACL A;  2V8S E;  3FTZ A;  3NZU A;  4FC8 A;  3T5X A;  1N0Q A;  3FHE A;  4MRU A;  2OVF A;  1NFI E;  2MHK A;  2ZGD A;  4Y6C A;  1ZB1 A;  3ZXS A;  4XI9 A;  3Q7F A;  2P58 C;  2A5E A;  3CHS A;  1OCO E;  3FH8 A;  3CVP A;  3MEK A;  4IRU A;  4K0R A;  2VQ2 A;  3JQ0 A;  3FEY A;  1UN8 A;  3LY7 A;  4CDR A;  5G05 C;  2QC9 A;  4AOF A;  3AJI A;  2WXM A;  3TG4 A;  1LD7 A;  4ACK A;  3MKR A;  1EPU A;  1KPS B;  1TJC A;  2LAH A;  3PS6 A;  5KCM A;  4AV7 A;  3PRZ A;  4DX5 D;  2P9I G;  5EN5 D;  3U4T A;  2J09 A;  4LSZ E;  3BUA A;  3ESK A;  4F53 A;  4WNF A;  3V2O A;  3TWX A;  4DX7 D;  3AG3 E;  3C72 A;  4HI8 A;  3AS8 A;  4E6H A;  3LJN A;  3L08 A;  5T8I A;  1OT8 A;  1HXI A;  3W9G A;  1OUV A;  1NA0 A;  4FUL A;  3CHR A;  3CVQ A;  1ZBP A;  2WXP A;  4FLB A;  3UIO C;  4QQI A;  4YVQ C;  3SD5 A;  1BI7 B;  3V79 K;  5ARG A;  3Q4A B;  3D9H A;  1INZ A;  1JUQ A;  5DBK A;  4TRQ A;  1UOH A;  4O1P A;  3QAR A;  3B13 A;  3L22 A;  2UY1 A;  1LD8 A;  4M3O A;  4P29 A;  3I4G A;  2X38 A;  4LUN U;  3CVY A;  2EIM E;  3Q5M A;  2OEW A;  4HRL A;  4PS7 A;  4G25 A;  4XKC A;  2VTB B;  1K3Z D;  4L2L A;  3LY8 A;  3ISM C;  2LXM A;  4HS2 A;  1JCR A;  4H7Y A;  1N4S A;  2X3M A;  4XEI G;  4X8Q A;  3PRE A;  5ARF A;  5CMW A;  4UWG A;  5FTP A;  3V31 A;  3UQ3 A;  3ABL E;  5HQ8 A;  3V30 A;  3E32 A;  3HVE B;  3SQV A;  5A6C A;  1PY1 A;  3RRU A;  1WG0 A;  3QB2 A;  3D9K A;  4RG9 A;  3CLJ A;  3LXU X;  3G2S A;  2XEE A;  4GTP A;  1EYH A;  5JJT A;  3QNK A;  4GTT A;  4L2Y A;  3URZ A;  3FTW A;  4MLP A;  3U64 A;  5C1D A;  3PZ3 A;  5T4Y A;  1TJF A;  1TN6 A;  3AAA C;  3SFX A;  3EDT B;  2WXQ A;  3LKU A;  4G26 A; 
#chains in the Genus database with same CATH homology
 5ENR D;  3F6Q A;  4UUC A;  3V79 K;  5AAO A;  2J8S D;  2XEN A;  2DZO A;  4HRN A;  5BXU A;  2BKK B;  2NYJ A;  3HG0 D;  1YCS B;  3D9H A;  4K5A B;  3ZKJ A;  4LNU D;  1N0Q A;  5ITZ F;  1UOH A;  4K5B A;  5KNH D;  2F8Y A;  4O1P A;  3ZNG A;  5AN8 A;  4F6R D;  1YYH A;  2ETB A;  1NFI E;  1OY3 D;  1G3N B;  3EU9 A;  3NBN B;  4HI9 A;  3T9K A;  3C5R A;  3NOG D;  1MJ0 A;  4ATZ D;  2ZGD A;  1SW6 A;  3HRA A;  5JA4 D;  4OAV B;  4NIK A;  4DUI A;  1BI8 B;  1MX6 A;  3J5Q B;  5EID A;  2DWZ A;  3T8K A;  3Q9U C;  4A63 B;  1S70 B;  2QYJ A;  5HRY A;  5CER B;  4YDY A;  1BLX B;  5HS0 A;  2XEH A;  5AQA A;  4HB5 A;  2A5E A;  4BEP A;  3EHR A;  4DX1 A;  5CBN A;  1D9S A;  4HRL A;  1AWC B;  4C48 B;  3B95 A;  2F37 A;  4BER A;  3JXJ A;  4DX2 A;  3TWV A;  4ZFH A;  1K3Z D;  2AJA A;  4U96 D;  5D66 A;  4HRM B;  1DC2 A;  1BU9 A;  1WDY A;  3TWU A;  1YMP A;  4O60 A;  3NOC D;  2Y1L E;  1QYM A;  3TWR A;  3TWT A;  2MYO A;  4CYM D;  2QC9 A;  2P2C P;  5FIN A;  5ENQ D;  1K1B A;  3UXG A;  3AJI A;  2ETA A;  4G8L A;  4GMR A;  4RLY A;  4U95 D;  5BXO A;  1N0R A;  3SO8 A;  2V4H C;  3V31 A;  1MX4 A;  2BKG A;  5AAR A;  3V30 A;  1IXV A;  3UI2 A;  5CEA A;  3DEO A;  3ZUV B;  4N5Q A;  5KWD A;  1MX2 A;  1TR4 A;  5HKP A;  4U8V D;  2XZT G;  3TWW A;  4JB8 P;  3KEA A;  2DZN A;  2RFA A;  5EYL A;  1AP7 A;  1WG0 A;  5CED B;  4OAU C;  2ZGG A;  3UTM A;  1MYO A;  4K5C A;  3EHQ A;  2KBX A;  5AQ9 A;  4DX5 D;  3JUE A;  5ENT D;  5EN5 D;  5EIB E;  2PNN A;  4J7W A;  3J5P A;  1SVX A;  2B0O E;  2XEE A;  1K1A A;  5KBA A;  2F8X K;  3JXI A;  1A5E A;  4J8Y A;  4LSZ E;  4HQD A;  4QFV A;  5JMN D;  2XZD G;  1BD8 A;  1DCQ A;  4HLL A;  5EIL A;  3DEP A;  4F1P A;  4YDW A;  5KNG A;  5EYP F;  3TWQ A;  3TWX A;  3IXE A;  3V2O A;  4DX7 D;  5CEC B;  3ZU7 B;  5ENS D;  2L6B A;  4GPM A;  4HI8 A;  4BES A;  4CZ2 D;  5AQ7 A;  4ZHB A;  2HE0 A;  4Z68 A;  3TWS A;  4DRX E;  2KXP C;  2FO1 E;  2Y0B G;  3W9F A;  4B93 B;  3LJN A;  4HBD A;  4U8Y D;  2ETC A;  1N11 A;  4HNA D;  4BET A;  1IHB A;  4G8K A;  3AAA C;  5ENP D;  5CBO A;  1OT8 A;  3W9G A;  4DX6 D;  1IKN D;  4LG6 A;  2JAB A;  5AQB A;  5FIO A;  4BSZ B;  2VGE A;  3B7B A;  5ENO D;  3V2X A;  4O1O A;  4QQI A;  2RFM A;  2V5Q C;  3Q9N C;  1BI7 B;  4TUM A;  2DVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...