1BDHA

Purine repressor mutant-hypoxanthine-palindromic operator complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Positively Charged Residue Bound in the Minor Groove Does not Alter the Bending of a DNA Duplex
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
total genus 121
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1996-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1bdhA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bdhA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bdhA02
4MGEA 2ID9A 3H75A 4XFKA 2R48A 3QWGA 3FDFA 4OG2A 4M88A 2PJUA 3NNDA 3GA5A 1NXWA 1UTXA 3NHZA 4D6XA 1XWRA 3QLTA 2XDYA 1S8NA 2QW1A 3BDNA 3MMNA 3OLVA 1JH9A 2R25B 5TPWA 4KRFA 3LUFA 1B00A 5FWYB 2E4ZA 4S04A 1M2FA 1NXOA 1TMYA 2A6CA 1KMIY 3N0XA 4OBBA 5KQLA 4ZYLA 3QK7A 2HQBA 2FSPA 3HUUA 2FN8A 3JPYA 4X4GA 2L17A 4RK6A 2CROA 3HO1A 2LYQA 4B09A 2FXIA 4IMJB 4RS3A 4YP9A 2QVCA 2LPMA 4Z9BA 4LDAA 5TQ2A 3QF3A 2FEPA 1XWWA 2WJAA 3FFWA 1PRAA 2LCVA 3VNAA 3RVLA 2FW0A 2IU7A 1KGSA 1ZVVA 1M5UA 2JRLA 1JFVA 3G85A 3EDCA 1UXDA 2LYLA 4X4HA 5JS2A 3GYBA 2QU7A 3LUCA 2XI8A 3CECA 4FN3A 3QLVC 5KI6A 1VLZA 3BD1A 4G0MA 3QELA 3TX6A 2PUGA 4Q7EA 1EWTA 3I5AA 4JB2A 1DG9A 1Z17A 2L2QA 2LYSA 1ZITA 3KTOA 1Z13A 3RVNA 2CHFA 1YK0A 4X4BA 5C5CA 1VPWA 1A04A 1BDHA 2HJ9A 4GNRA 1ZUGA 1BA2A 1CQTA 4EVQA 1NEQA 1RZRD 2LYKA 2KPJA 5CNJA 3T6KA 3DLHA 3SCFA 3FFTA 4W5QA 3IPAA 2AXZA 1URPA 3IP7A 3BILA 4YG4A 3EJWA 4Z58A 3I45A 4TLMB 4ETNA 7ABPA 3U3WA 2O20A 4MS3A 2WWVD 3URMA 4N41A 1APBA 2N9UA 1D5WA 3RVQA 1HEYA 5GOTA 1TVMA 1L5ZA 4L4UA 3O9XA 1DCFA 3LOPA 5DCLA 4HNRA 1USGA 3HEBA 3CROL 1DZ3A 1E6LA 2E4WA 4JP1A 4W5NA 4PE5B 2J48A 2XSDC 2MYNA 2JBAB 4MCTA 3GBVA 4F12A 3FYAA 1ZS4A 4JQDA 2M98A 4Z5DA 3O2QB 4MS4A 1AB5A 2GX6A 4KQCA 4MQEB 4N47A 1OXBB 5BRJA 1R63A 3T38A 5JNUA 1RPEL 5EWMB 4DN6A 1D1PA 1RIOA 3OM1A 1MB0A 6CHYA 4NCAA 2XIUA 2JBAA 1NTRA 4MS1A 3TD9A 2PAFA 1RZSA 3IP9A 2H0AA 1P2FA 4WT7A 4ZMSA 1E6KA 1VKRA 2E4UA 2GI4A 2FQYA 3A0UA 5E3JA 3CFYA 3UKJA 3GT7A 2PUCA 4F8DA 2NT3A 2H3HA 3GBPA 4RKQA 3LISA 2MEZA 4EY3A 2FVYA 4RSMA 1ZZCA 2AWIA 1IIBA 3CNBA 3G1WA 1BAPA 1PUXA 4LE0A 4MQFA 4E7OA 2ZAYA 5TPZD 4Z4GA 4O1HA 5TQJA 3QLVA 1OXKB 2FQXA 4EGSA 1U2QA 3F7NA 2GKGA 1MIHA 3N75A 1CEYA 1R8JA 5C5EA 1YS7A 2AYZA 4X4IA 5TPWB 3GL9A 1NATA 1FFGA 4DQDA 1NXPA 2TMYA 2WJWA 2O38A 4PEVA 2A9OA 3TRBA 1CJGA 2IPAB 3QX9A 5DGCA 4PYRA 4EVRA 6ABPA 3SCHA 1LCDA 4Z4EA 3N6VA 3H1EA 2PKXA 3DNVB 1C0EA 1ZZ8A 2PUDA 3BREA 4G0XA 1QQBA 4Z4IA 1ISRA 1MAVA 1PNTA 1X57A 4OB4A 4S05A 4Z5CA 2R1JL 2NZUG 5A7LA 4OTZA 4YRZA 3CRNA 2GZUA 2JVLA 3KCNA 3SG0A 5KWSA 2O49A 1LK0A 4J1WA 1Z15A 2R47A 3CZCA 2WB4A 3HK2A 2CWDA 4RDCA 1PRVA 1A2OA 3LUGA 3HUTA 4MQEA 1C4WA 3FMYA 2BNNA 1JFTA 4MRMA 5TPZA 4PU7A 2B1JA 3Q15C 2PLNA 3CG0A 5EWLB 2HQRA 3QQ6A 1W25A 5FWYA 2I6FA 3HDGA 4PICA 5FWXB 2FEWB 3OLXA 4X4EA 4YWHA 1NERA 2IYNA 4F3TA 3GN5A 1P6QA 2LYPA 1JDPA 4KK3A 2FLWA 1JLKA 1GUDA 2AUWA 3ZHIA 3K4HA 3A0RB 2MYPA 4Z4FA 3HZIB 2IVBA 3C3MA 3RVPA 3QEKA 3QEMB 4ZJPA 9ABPA 4RZSA 3O2SB 4MAAA 2IUOA 2HQOA 2LBPA 2MSKA 4LZLA 1U04A 3B7HA 3RZZA 4IMIB 2MSLA 1ZDMA 4JAVC 1EHCA 1NXXA 2WY2D 4EYKA 3C97A 3JVIA 4YR7A 3H6GA 3HXMA 1D1QA 4ML3A 5ABPA 4GHJA 5KC8A 2RDMA 1E3OC 3OQMA 4QPJC 4I6UA 2MQKA 2O4AA 4G0PA 4O5AA 1AB6A 1Z2EA 5DLEA 3B2NA 1JYEA 3Q7TA 5CNIA 5BR1A 2MSWA 1LQCA 5CNMA 2JCGA 3NHMA 1ZZ7A 1Z16A 1DCMA 4RV5A 4IRXA 5HKOA 1TM2A 2CSFA 3MM4A 4XLTA 3UK0A 4D6YA 4N76A 2PUFA 2BNOA 1J56A 1POUA 3KG2A 2AXVA 3KYJB 4Q6BA 3CZ5A 4W5RA 4I8TA 1ADRA 2IPMA 1D2AA 4P98A 3ROTA 2A9RA 1QQAA 3L49A 4FBIA 2FMKA 2BGGA 1M2EA 4WUTA 2VUIB 4CBVA 3KXAA 3LFPA 3NNSA 4JCYA 2IPLA 2AW6A 2WMYA 4KV7A 1K68A 4UHJA 3CLKA 3G5GA 1CHNA 1FFSA 3CHYA 3RVKA 1QKKA 3SM9A 5D2CA 4OLAA 1QO0D 2QZJA 4KVFA 1ZESA 5EWMA 4I6RA 3F52A 3SCGA 2QSJA 3HSYA 4N0QA 4KZKA 1PRUA 3TB6A 2PMCA 1IC8A 5JNRA 4IVZA 3GWGA 1Z12A 4Z4HA 1JHZA 4GPAA 4JOQA 3L6UA 4LX8A 5JNTA 4RY0A 3FMVA 4Z4CA 1BVHA 2YHBA 1DP4A 2LUOA 2OQRA 4DADA 3EGCA 4MR9A 2GWRA 2B5AA 3E61A 2IV1A 1JFSA 3SY8A 2GRMA 2JK1A 2BJCA 1AU7A 3ZKCA 4YBAA 1ZZ9A 3KZ3A 3O21A 3OMXA 4FE7A 4UHKA 4E7PA 4FB4A 3JPWA 4I6TA 4GQMA 3CU5A 3H5OA 3ILYA 2PL1A 5KQGA 2OR1L 2NZVG 4RK4A 4OATA 3OQNA 3T8YA 3GBFA 1Z25A 1ZZBA 1TLFA 2OENG 4MR7B 2HPHA 5IEJA 3O1JC 4G0YA 1EWVA 3P9YA 4N0PA 3TMYA 3H5TA 3MLFA 1FQWA 1VRVA 4XARA 3HCWA 4MLCA 4PZ0A 5JNWA 3OMTA 3CLCA 1P6UA 4X4DA 3C3KA 1OSLA 3EULA 1TJYA 2M1ZA 3F6CA 3HV2A 3LUAA 3LUKA 3MYYA 3RVOA 3JXBC 3GN5B 3KSMA 1A0OA 1NXSA 1K66A 3Q41A 1HF0A 1M5TA 2A9QA 3N53A 4KMRA 4IGAA 3O2JA 3QELB 2WRZA 3F73A 3JXDL 4NDWA 4ZMRA 5IULC 4LDZA 3OLWA 3A3KA 1LJUA 2PL9A 1QP4A 4F06A 1LCCA 2FJRA 3HZHA 4G0OA 3IP5A 4TN5A 4WZZA 5EWLA 1YTUA 4KK4A 1DBWA 3O1HB 1EFAA 5EWJB 2P9HA 4F8JA 2LP4Y 1ZGGA 1WIZA 4RY9A 3D02A 3HM9A 4FE4A 4KFCA 1XHEA 3RVSA 3H1GA 2PE5A 2VUHB 4W5TA 4G97A 4G0QA 1ISSA 3BRSA 4IF4A 4NCBA 1RPJA 4YCSA 1RZRA 3H5WA 3OMWA 3LUHA 1Y1LA 1Z2DA 1Z26A 1SXIA 2RGYA 4LE1A 1Y9QA 3S99A 3T95A 1ABEA 5TQ0A 3S8QA 3LUDA 1ABFA 2HSGA 5TE9A 1XHFA 3KHTA 1ZN2A 3MQ4A 1Z18A 4MS4B 3RH0A 3MA0A 4Y9TA 3G7DA 2IVGA 1QPZA 3C6QA 1BDIA 4Z5HA 3LTEA 5HM6A 5KC9A 4OLBA 8ABPA 1PEYA 1O4XA 3N0WA 4ETIA 1PNRA 4YLEA 4EYGA 4PU4C 3JTEA 4YG7B 2JVKA 2D5VA 4Z59A 2R4QA 1QNLA 4G86A 4PU8A 2E4VA 3EODA 1DW9A 3MF4A 3F6WA 2XCJA 1YMVA 5DKFA 2VYCA 4TLLB 4YGXB 1CYEA 4N03A 1S7EA 3H5VA 4MR8B 2RJOA 3FGZA 3KLOA 4NICA 3RVMA 2AYXA 5T7BA 5FBHA 2EF8A 2EWTA 3EQZA 4MS3B 4Q6WA 2ZWMA 1QO0A 4YG1A 1WETA 2PUBA 1GCGA 2KEJA 1GLGA 1YVUA 4G0ZA 4ZPJA 1DC7A 2F8TA 1EAYA 3H5LA 2NT4A 1SXGA 3RVJA 4J1XA 3GRCA 2R63A 2AXUA 4NV3A 5EWJA 1U0SY 1LBHA 2IPNA 4XXHA 4XASA 1GT0C 1FFWA 1RXEA 2QV0A 3N0RA 1F51E 3H6HA 3R0JA 1KRXA 3LFTA 2RJNA 3H1FA 4RU1A 1Y7YA 2B4AA 1DCKA 1DBQA 3JY6A 2FKAA 3VK0A 1SXHA 2MYUA 1R69A 3EQ2A 3N8IA 1LMB3 3NNNA 2L49A 3OO0A 2E4XA 3Q9SA 5IUNC 3HDVA 3QYXA 4O1IA 4ETMA 4KREA 5K98B 1ZAYA 5PNTA 2PIJA 1JBEA 1GUBA 3DGFC 2JVJA 4QICA 5JNSA 4O8BA 5JNVA 3D8UA 3OO1A 3D1NI 1QP7A 1DBPA 2CD7A 5KQPA 1WH8A 4MR9B 3ILHA 4JA2A 4QYMA 5IC5A 5FBKA 4EYQA 1NXVA 3OQOA 2IOYA 5IBQA 1PEAA 2LYJA 4RKRA 3SQNA 5B3JC 1DC8A 3OLZA 1QP0A 3RQIA 3I42A 3M9XA 3OLYA 2KEIA 4RXMA 1LLIA 1YMUA 1U2PA 1JYFA 2IDMA 3K9CA 3A10A 5BQ3A 3C3WA 1YK1A 2FLKA 3F6PA 2W42A 2F8SA 1DWKA 1RNLA 5IEBA 2QXYA 4LE2A 1NY5A 2PUAA 2X7XA 3CKMA 3LMKA 1MB3A 1SQ8A 1ZGZA 4RK5A 4TMYA 3BBLA 5T3YA 4F11A 4RK0A 2KEKA 4LRQA 4QYWA 2ICPA 3O1IC 2JVIA 1ZH2A 2QVGA 3CS3A 3DZDA 4RK7A 3QLUA 3OM0A 3ROFA 2FEKA 2ICTA 2VK2A 3O74A 3TO5A 1L5YA 3HVRA 1E6MA 1D4ZA 3L1PA 4YS6A 3Q7RA 4Z99A 1OCTC 4XAQA 1SD5A 1WH6A 3R1FA 2OFYA 1BDJA 4EVSA 2PPXA 1YIOA 4JB0A 4RXUA 5FWXA 5B3JA 4RXTA 5IX8A 4MYRA 1PHRA 1USIA 5GQSA 5TQ0B 1YSEA 2KZ8A 3JXCL 3DGEC 5BRAA 4MQFB 4H60A 3BRQA 4L85A 1LBIA 1ZH4A 3PXPA 1UDRA 4JASB 2PUEA 3F51A 1QMPA 2LYRA 4Z9AA 3M9WA 1B0NA 1UXCA 3HJFA 3BS3A 2V0NA 5HQJA 4Y42A 2GRLA 2H8RA 3JS5A 2E4YA 1P8AA 1ZPQA 1U8TA 4KPYA 5JS1A 2XJ3A 2EBYA 2FMHA 2FMIA 2GBPA 2DRIA 3IP6A 4YO7A 2ID7A 3NBMA 2L19A 4MCXA 4JCXA 1PERL 1DRKA 1JDNA 1T34A 4H3HB 4WXEA 1DJMA 1E2BA 2P4UA 3LUJA 4MR7A 1X2LA 1F4VA 3QLUC 2MYTA 3W9SA 3KLNA 5KQMA 4RY8A 3KYIB 2IVQA 1JL3A 3H5IA 5IUJC 3FYMA 4WXMA 3IPCA 4MS1B 5IUKC 3SNKA 2L8NA 3GV0A 4EYOA 3E3MA 4MPTA 3HS3A 1EWKA 1FSPA 4IA8A 3CG4A 1YS6A 3LKBA 1MVOA 4Z0NA 4NQRA 3SAJA 3QX8A 3CTPA 3O75A 2FMFA 4MRMB 4YV7A 5DTEA 1GCAA 1KRWA 3FFXA 2FN9A 4IILA 2WUSR 1JF8A 4P1ZA 1RXIA 2FTKE 2LIVA 2Q5CA 5CNKA 4H3KB 4X4CA 5HSGA 3ZHMA 1I3CA 1USKA 3UUGA 2QR3A 1NXTA 2A9PA 1H9CA 3KJXA 4YARA 4PU3C 1DRJA 4HNQA 4X4FA 2CHEA 1ZHHA 2FQWA 2KYRA 3EUSA 1JWLA 2NUBA 4HNSA 4KQ9A 3MIZA 2YHAA 3UFDA 1ZZ6A 3KKEA 2HINA 4MLDA 1LJLA 3DLBA 1ZY2A 3I09A 3QEMA 4MR8A 2L18A 3KS9A 2IKSA 4WWHA 5CHYA 4W5OA 3JVDA 3EAFA 3VNBA 3OP9A 3IDOA 1L1MA 4D74A 3DBIA 1JX6A 3Q7SA 3IVPA 3RVRA 5ED4A 4KNYA 3LKVA 4RK1A 1W9HA 5TQ2B 1SRRA 4IWRA 2BNMA 5I4CA 4EUKA 3M6MD 2WIUB 4RWEA 2JB9A 5F64A 4HYEA
chains in the Genus database with same CATH superfamily
2ZXEA 1CCWA 4GU5A 2AIRA 3ID6C 3B6IA 3ORRA 4XFKA 4CQLA 3UMBA 3EARA 4LBYA 1YZGA 3GCDA 4QEKA 3AL2A 3DEFA 5HGJA 4LXQA 3C43A 4RD1A 3R9KA 1TC1A 4B6SA 3X2FA 3PIIA 3QFCA 1RZ3A 3DW3X 4NU8X 4ZV4A 5B1HA 2LVBA 2HV8A 1T4CB 3WB9A 3MHTA 3WWCA 4KRFA 5H9WA 3OUZA 4DQKA 5ESRA 1B00A 3HJGA 2Y1LA 4HHEA 3BFKA 1NXOA 4J1QA 4JOSA 3KEFA 5AICA 5KREA 2PX3A 1RWQA 3A31A 3O0DA 4LJ4A 3KJZA 4O4LA 1U81A 3GAMA 4H31A 4X4GA 4CKEB 1SQSA 3O6VA 4JJGA 4ZT5A 4M0DA 2ZSAA 5J1TB 3S55A 4B09A 1A9PA 4RUKA 4DILA 3GX1A 5JJBA 1BGXT 2WFLA 4EHAA 4X62B 4EAQA 2PSSA 1QV9A 1G66A 5DGHA 1DQNA 4S35A 1YZUA 4HNGA 3VNQA 5AI5A 4YV2A 4HDNB 3BTSA 3BT7A 3DWIA 4EKEA 4P81A 3HWSA 5KI6A 1L7QA 4LY9A 4QUJA 2YIJA 4ZO7A 4EPYA 1GAXA 1CEQA 3TJZA 4ZZ3A 1UBGA 3BD7A 2LIPA 1YQWA 2DWOA 4D0SA 4OKIA 5HJ7A 4D99A 4FTWA 5L45A 2ZPTX 3ZXXA 5HFJA 5F9MA 2VBFA 1VI2A 5T4EA 3QW4B 1MOZA 3AF4A 3E7FA 1BA2A 1RTKA 1NPYA 3V9PA 2KPJA 3IBSA 3IMCA 2OBYA 3R44A 3DB1A 4WKPA 1NA5A 3VSAA 4QIHA 3ZH2A 3TECE 1B7GO 1F2VA 4A6DA 2Q2VA 4ZXFA 2RFLA 3EJWA 3I45A 3OU2A 3S8MA 2OKGA 1DAIA 3D81A 1I3NA 3Q2OA 1APBA 2ANBA 3VR5D 1DGQA 1PLJA 1SBTA 2Q3CA 4FCTA 1FTSA 2IIVA 4B7AA 4UFNA 1C9KA 2OO5A 3O8BA 1CFJA 4GR4A 4OQZA 1USGA 4WK0B 5DWVA 3NHWA 4CEHB 2H4HA 4FEGA 4EG3A 4RLSA 2XADA 4HN2A 2QP3A 4Z5DA 3WADA 2J5KA 3VSDA 4YAIA 1AQIA 1P33A 2IGTA 1PF7E 4ZU3A 4GF5A 4BJ6A 4RMIA 1GZ3A 2V65A 4UJ5A 1TRHA 1BU5A 3G5MA 3R5KA 5AXCA 1TAUA 4DXAA 2ZS8A 4URZR 3AF6A 4LOHA 1H85A 3PX3A 1NWHA 3OM1A 6CHYA 1YE5A 2D62A 3GGGA 4XQGA 3W3ZB 3ZWOA 4OK3A 3AFOA 3HR4A 2AX3A 1IXKA 4JJEA 3OPYA 5D51S 3RSHA 2FMUA 4GC9A 4LF5B 3WOVA 1FXWF 4UMFA 1WMEA 3N3BC 2Q3MA 5CFPA 1GL9B 3JQ8A 5TMEA 4N7RA 3U1TA 4I7EA 4LYJA 4EITA 2QTWB 1CRPA 1F6DA 2XRYA 2PYIA 3R3XA 3OWHA 3RIYA 4W63A 4DZRA 2DPLA 3FYUB 1MOQA 4XYBA 4OFWA 5FUWA 4O1HA 1JG4A 4HDCA 4DZTA 4QGHA 4JT8A 3A9YA 3KYCA 4IICA 4NJMA 2E5LB 4BX0A 1ZNZA 3D3JA 1P0MA 4TXNA 4UQPA 2IGBA 3L4JA 2HYIC 2JAUA 5F7OA 2KX7A 4U00A 2FFRA 4X4IA 3MMPA 5JT1A 2F9MA 2ZTSA 1HFEL 3IUEA 3NBQA 1P7VA 2OHVA 4ZVMA 2YUTA 3JQCA 2XQGA 4NJEB 5AW1A 1YBHA 1LCDA 3IELA 3AYZB 4PINA 5JZOA 2ZBUA 5E3IA 4AKSA 2HCFA 3MJFA 4PX3A 4BNUA 1F5NA 3DQQA 4CKWB 3VUFA 1OV4A 5A7LA 2OKCA 2I3BA 4ALNA 2FGKA 3IDZA 1FJ2A 1I3LA 2ZIAA 3T5GA 4IWNA 1WCV1 3UGTA 2X0FA 1S2LA 1Z7YA 2CWDA 2ZCUA 4MKIA 4HX9A 1XQVA 4JQSA 5HW0A 3Q8KA 5AJUA 1NMSA 3CG0A 3D2CA 5HE8A 5AKKA 2VBGA 2R97A 5AJZA 3R7WB 3IHWA 1KSGA 1SRQA 4TRMA 3TW6A 5FWYA 4TWRA 4WKOA 2VPXA 4UHBA 2OP1A 5K3CA 4YMVA 5K8CA 2J5RA 2J9GA 2WSLA 3EDMA 1LRLA 3MXOA 4BKUA 2L1PA 3W2EA 1R50A 1UP4A 4IDCA 5HIMA 3QKSA 3DBLB 4IQ4A 2B3DA 5JJIA 1U1FA 4CXMA 1NE7A 1ADFA 1SKYE 3AOEC 4YAEA 3GGJA 3QEKA 2VLIA 2JH9A 1GQFA 4ZJPA 2OSVA 4BHTA 2LBPA 4LZLA 1NNUA 3R0VA 2GRJA 3P2EA 4QXAA 4HUJA 1TZ2A 2BEWB 4F9GA 2B35A 4O4IA 1ISFA 2Y1WA 2BBSA 4DBVO 5IJ0B 1PFQA 4RVCA 2EL9A 2ANCA 4ZVQA 2OO7A 3NBUA 3GRKA 1VLQA 1VIVA 2EJVA 3SXUA 1G8MA 2YN0A 1EUZA 3K92A 1IM8A 4TPKA 4RPKA 3TQFA 3ZV4A 1TVCA 3DFZA 4PLGA 1SIOA 1JYEA 1XNHA 2BLLA 5IT9A 1E3WA 1UXKA 5LYJF 5IZ4A 1G20E 1QQ6A 1EXWA 5EJ4A 2O0KA 3UW3A 1CYDA 2CMKA 3KCQA 2VDMB 2DLDA 2Z2ZA 2ZANA 4BX8A 2PCJA 2QQGA 1E0SA 3MTDA 3WYGA 4JUDX 1UBOS 2VF8A 3I1YA 2CJYA 5HZMA 4ZICA 1L5NA 4F38A 3QRWA 4UPDA 4Y2XA 2Z43A 1ZGAA 3WO1A 2I99A 2PXFA 5GM1A 3BXXA 1JVNA 4DUGA 2VUIB 3EXFB 1V1JA 1RQRA 3T3MB 1R8XA 5D01A 1T3GA 5IMBA 1RHMA 3UHFA 2O8EB 1R15A 1DRWA 2JIBA 2X23A 3QH4A 2V4MA 2WJIA 4BO4A 3LWBA 1EFTA 4F5ZA 3VM6A 3QHAA 5CK4A 3NKLA 4V0LA 3UHPA 3WJAA 3RV3A 4HFRA 3PVSA 1BHJA 1TM7E 3CNHA 1GFWA 1UL1X 1OFUX 3E2IA 1KVTA 4M1EA 5JYEA 2R96A 4Y2HA 1RYYA 2ZWPA 5DWQA 1L8XA 1M6YA 4DV3B 4QC2A 2HGSA 4BKMA 2G36A 3IO3A 4RY0A 2R4TA 3MS4A 3G8YA 1I6WA 2PPLA 3PHIA 2LUOA 5IKXA 4HWGA 2F8LA 4I1VA 5IYZA 4OU4A 5BOSB 5LYJB 4ILKA 4DTIA 3SY8A 5CDTA 3KZ3A 2NXJA 2P9JA 3VH2A 4LJ7A 3TR6A 1K8XB 3NLLA 2VSNA 5G4LA 1Z74A 3R6WA 1GCOA 4C08A 2IZZA 1S3IA 2OR1L 1ZR2A 2IFTA 2NZVG 3JQAD 3UJPA 2JAPA 1U2GC 5GGYA 3ISVA 2JZCA 3I0ZA 3WLKX 5A9RA 1KL7A 4B17A 1JPNA 3CW8X 1PK9A 3D0RA 4Q3OA 1QV7A 1Z6TA 2HD4A 2HLHA 3EFHA 4FS3A 5ALXA 4CUKA 1T4DA 4OQQA 2AA3A 3H17A 3IV6A 3C3KA 4TKUA 1BJKA 5LDGA 3NTRA 5FOVA 2QTZA 3JYHA 1O5IA 3JXBC 4Y9SA 3DJYA 1B4DA 4J03A 4YFVA 4YIHA 1CD5A 2PS3A 3DZ8A 3U61B 5K0FA 1P1JA 4YECA 4E2ZA 2G04A 3RQSA 4PGAA 3V8RA 2RH4A 1JQEA 2NZYA 5JVDB 4MDYA 3IKMB 1QP8A 3PUHA 2R60A 1LJUA 3WGOA 1EFRA 3HKCA 4FLMA 2FEOA 4OM7A 3LF2A 1ZW1A 5COQA 4C5BA 3ZWDA 2C9DA 2R8XA 4AF7A 3AB3A 3IAM6 5K4AA 3UXHA 4F6RB 4BNFA 2J41A 4D42A 1CUWA 1EFUA 1V5IA 5WRFA 4RS4A 1IYZA 2PK3A 3IUMA 3UG6A 3E1KA 1JHVA 2H7XA 5IJAA 2ZJ4A 4H1VA 3I2JA 3ZVNA 2CT8A 3PTLA 3VBCA 1QHNA 1YL5A 1WW3A 4J0JA 5FHQA 2YWHA 1JA9A 1GP2A 5J2UB 3RIEA 1ISSA 3LY7A 2IIBA 1GAEO 1N9GA 3MB8A 1O3YA 1RZRA 1NVKA 2WIAA 3IQZA 3PT9A 1DAMA 2R6R1 3A1WA 3FWZA 1Z2DA 4GQBA 3EEOA 1RPZA 2VQSA 5AK6A 3A70A 3STUA 3GFPA 4LC1A 4OFBA 3QEJA 4V2IA 5JANA 4CODB 2ZRFA 2R8YA 2HSGA 3E9MA 3FAZA 3MMSA 4NCHA 3ZHUA 4DG9A 4J16C 4R2MA 4M9ZA 3LDHA 2QXUA 3G7DA 4Y9TA 3DB2A 3PPXA 2CB0A 4CHTA 2X3YA 4LC0A 3FUTA 4R3WA 2E48A 2XAUA 3KAJA 4ZWNA 4HEA1 1L3CA 4B33A 1KETA 4DCUA 1A27A 2IY9A 1OWMA 2VATA 5I7VA 5EJ2A 2Q3FA 5ITSA 3P0FA 1WIWA 5MF6A 4COOA 1ECBA 3F6WA 3IE0A 3WQQA 5A0TA 2I3DA 2QSYA 2R85A 1T5TA 5C3MA 2VYCA 4MQUA 3RUHA 1NUPA 4N03A 1SXJC 3FGZA 2PWBA 3OX3A 5HRCA 4LX0A 2QUHA 2DE0X 3I01M 3LHFA 4KPUA 3TE6A 1P7YA 1ZWKA 4DLAA 1BCSA 1R5BA 5TF0A 3GZCA 1WETA 4PSVA 1G5IA 1DX4A 3S81A 1E2LA 2NT4A 1U4NA 2YY6A 3FM9A 4JUFA 3U80A 3RVJA 4B2YA 3D2LA 1SXQA 2ZE8A 4RD3A 3DBRB 1LBHA 4J9VA 1MEOA 4GXNA 4MO2A 3L4BA 4XASA 2QV0A 3QPAA 4HWRA 3L84A 3HH8A 5FPKA 4JI4B 3KZNA 2RJNA 1UWVA 3NHAA 2O9JA 3NNNA 4X6YA 3OO0A 3G0CA 2Q4OA 2YZKA 3KQMA 2R6JA 2BP7B 4ETMA 1UC5B 4O1IA 1EUDA 2C04A 4CKZA 3LA6A 1M0EA 1G2IA 2I4RA 3EWIA 4QYIA 3VO1A 5KPDA 1GUBA 1Z29A 4K1XA 4KPGA 5JNVA 3FMGA 3KX2A 4QLAA 4LJ9A 4YDRA 1SVNA 5DNEA 1U28A 4C29A 4M9UA 1PVDA 1W8IA 3ZCXA 4HRXA 1KFBB 2VF7A 4QSMA 2P2SA 4FI3F 3D64A 4A4DA 4W9NC 3P7MA 1YGPA 1JDZA 1R6AA 4NWIA 1WCIA 2JHPA 2DBZA 4RXMA 1T8UA 2BRUA 4URVR 1JYFA 1KO5A 1NQAO 1TQ6A 5ALDA 4BJ1A 4DDVA 1YK1A 2FLKA 1TPYA 3CMMA 3ND8A 4UFOA 4C14A 4AP6A 3H2GA 3FIJA 5CURA 5T3YA 1SQ8A 2VSFA 3JAKB 1UJ5A 3CYFA 3G59A 4MKHA 1EDDA 1JDUA 3ZDFA 5LLTA 3QBTA 1ECJA 3EEFA 3K9QO 1MVNA 1KZ1A 2FETA 4N5LA 1RHUA 1K6IA 5DF1A 4LDRA 3P2YA 3R6DA 4HDKA 2C84A 4Z99A 3SYKA 1AD2A 1NJGA 2OFYA 3VTAA 3JYNA 5JXIA 4EB6A 1NBWB 1C0IA 1YIOA 3U9TA 2JEOA 2ZE5A 3D2AA 4TQGA 4BX9A 4QHYA 2QVLA 1TUIA 4UHEA 1B26A 4IV8A 4WUVA 3VR3A 2LLVA 2GM3A 4XPIB 3JYQA 2NO9A 4CM9D 2VDKB 1ULTA 1AKMA 1Y80A 3CY6A 3HUFA 3KKZA 2CBGA 4LTDA 1Z4NA 4Q37A 4DSOA 1WDKA 4IRUB 3D1LA 4BTLA 2I2CA 1N6RA 1UBJS 1TGVA 4ZO8A 4BQNA 4IGKA 1GPLA 1N6NA 3GMTA 4HT3B 3O8RA 1KTVA 1ZPQA 8ATCA 1NU6A 1N34B 3B9PA 4HH0A 2C2OA 1VMKA 3RUAA 3QWFA 4MCXA 1B41A 1HY3A 1JEJA 1PE0A 2FW8A 2W7TA 4TL7A 1ISHA 1BGWA 1JJVA 3SU8A 2QL7A 3TZKA 1W0JD 1XRMA 2SECE 2I6SA 1HGXA 1SOMA 1J0BA 2AJCA 2MYTA 3GVXA 1DEHA 2WTEA 4L4RA 1ZINA 5MN4A 2IVQA 1YQ9A 3EZFA 1S7CA 2WAXA 3R5TA 2CNDA 5T4HA 4EYOA 1MB9A 2X0KA 3TQIA 1OAOA 4QTZA 1EWKA 2B2CA 3QFTA 5LLDA 1TT5A 3EVEA 2WWXA 2WABA 2OB1A 1L4LA 3PHLA 3QFHA 3HP7A 2RAFA 3PCTA 1YQXA 3IMFA 3G0BA 4MRNA 2ZOSA 3SS9X 1JE1A 5BN1A 3U7HB 4Q3CA 1RMYA 1J25A 4KMSA 3AHIA 4UOZA 1ZM2A 4JBWA 2GN2A 1EE9A 1ZIPA 1OGIA 4NKRA 4RQAA 5CVJA 4AMUA 4BKPA 1KDPA 2EFJA 4ZXPA 4HDSA 2MMGA 4JX8A 4KWIA 1L4BA 1IN6A 2XVMA 5DHFA 3KKEA 3SF8A 5JQGB 2IHNA 2HINA 1RHKA 5H81A 1MENA 1GTZA 1E1NA 3LQ1A 4KBFA 2Z2YA 3UMFA 2XCSB 4GKJB 2CMDA 1F48A 3C2QA 2EXXA 1X87A 3G8AA 3EAFA 3GEBA 4YAJA 3OP9A 4OL0A 4D74A 2WQZA 5IM4F 3DO6A 3U4QA 2EGGA 2QUAA 4TTVA 2XITA 3N2LA 4DA0A 3T3NA 2RH5A 1WEHA 2BT4A 3M6MD 3KPVA 3AEXA 3I12A 4UPVA 4HYEA 4LN1A 4KTTE 2VVTA 5CT8A 1A1VA 3BB1A 3GA0A 3IV9A 3JQQA 4EHLA 4YJ3F 3GQBA 1J2TA 4BFXA 2P1DA 2KHZA 2Y1DA 3U48A 1O4WA 2HRZA 4I1UA 2J31A 4PHHA 3W7VA 1JA0A 1ZLYA 2FSHA 3UYKA 1UMDA 3MMNA 4PC6A 3VR4H 3QJYA 3RNOA 5LMUB 2YX1A 2H7YA 1VIYA 4XB6B 2A6CA 2WSSD 3N0XA 3PI6A 4I4TF 3LLCA 4QDUA 5DOVA 5FL3A 3UV7A 1DBRA 3AVVA 3CUSA 1FXWA 3OZIA 4S3MA 2C98A 2OUKA 1P39A 4YRBA 3SC4A 1XRNA 4OY3A 5IF9A 2EU8A 4NU0A 3UHOA 1KNQA 4Q9DA 3E7DA 4FSDA 3AVYA 3K20A 2FW0A 3ZDBA 2ZS9A 5L51A 1I1OA 1OFIA 3TCXB 5AI8A 2MTBA 4K9LA 4GUAA 4PLPA 2JCVA 5THKA 3D3WA 2Q1XA 1KEEB 1T43A 4B2IA 4BKOA 2MSEB 2P67A 1HQ1A 4IIYA 3KQOA 4UCQA 1ACJA 5ALFA 1Z83A 2FEMA 2V8BA 4F97A 2Y1KA 3BDIA 1GTRA 1PR6A 2OGTA 4XX0B 2GAFA 2DUNA 1PW7A 2IUYA 2RCNA 4EHIA 3ULKA 5IT4A 3IR7A 3WSTA 1FQJA 6LDHA 2NNWB 5EHZA 5EMLA 3D43A 2G7ZA 3MJSA 3N7TA 4DLUA 3SQOA 1YC2A 2CV2A 1UOEA 2PVPA 2BKEA 2PJZA 4BQIA 1GPH1 4YCCA 4Z58A 4ETNA 1H1LB 1R0RE 3CM0A 4JIMA 2Y1FA 2ISCA 4H3SA 1GAQA 2OGSA 2Z8YM 4HNRA 1UM9B 1MPXA 2NO0A 3HEBA 4DGQA 4MCIA 3B2QA 4WNAA 1XWIA 1GPJA 1RWVA 3GBVA 4UM9D 3GLHA 4U2BA 2BIFA 3VZDA 3DQPA 3NYRA 4UAJA 4BVLA 3JZAA 4PE5B 1U2RA 2GZMA 4O4LF 4C2TA 3VU8A 2BV3A 5JNUA 1XMJA 1UBSB 4HS9A 4ZJUA 3S8YA 1C1XB 1D1PA 2KJQA 1GQYA 2QZSA 2XIUA 1QQTA 2VHVA 4MS1A 4MULA 5JMPA 4BVHA 1UDBA 1FQOA 4ZPXA 3LHSA 3I28A 5JZSA 3U17A 5JQGF 3DLCA 2CXUA 5I7FA 2XRMA 4DV0B 2BPOA 2J6HA 4Q12A 5F4BA 2Q4DA 1NXQA 3RJMA 2NV0A 4AS3A 1T25A 2A7XA 3AP1A 2YV4A 4YRFA 2VCEA 5DYYA 2ASVA 1WZNA 2BR5A 2IK8A 3HPQA 4KX5A 5K3OA 1H4VB 4C2UA 3CNBA 1IIBA 5JD4A 3FF4A 3GH3A 3E4CA 2I8LA 4H0CA 3UMJA 3ZDCA 1GL7A 4BNXA 3KALA 3DE1X 3AEQA 4OXRA 2JG3A 4KR2A 1F60A 2CXTA 4XIIA 3VR5H 4EGSA 4G4JA 1PS8A 4TYNA 1QZ3A 5DN9A 4E5PA 4R4JA 3FKSA 3AERA 2XOKD 4AWAA 3C48A 2GASA 3NVAA 4OB6A 1QKIA 2YWJA 1KE1A 1Z45A 3HNOA 1BXZA 2EQAA 3CCCA 3MWEB 4XIYA 6ABPA 1JGTA 2BHNA 2RHHA 3ZOZA 2W2VA 2UAGA 2WBLC 1E3JA 1PJ8A 2HTFA 3LOQA 2OCYC 4KHZA 3DDUA 3L92A 3P27A 4Q9IA 1TMKA 4YRZA 3OFNA 4YP0A 3Q9UA 3AF2A 5I8PA 1EFCA 1S3GA 2WB4A 4YJFB 4D44A 5K0LA 3V7YA 2W2NA 3NP7A 4RDCA 3L0CA 4BXOB 4RFLA 3DT9A 4BJ3A 1C7IA 3CLSC 3EGOA 3NB0A 4I14A 3FOCA 2ZQ5A 2GJSA 3MTJA 2B4YA 3UT6A 1Z8NA 1IZZA 3LYHA 4JEMA 2Q3HA 1AKUA 1WL8A 3IE1A 4K9DA 1G0NA 2CEKA 5BW8A 4ZVVA 2PM8A 3IO5A 1ZHFA 3JWIA 4PNHA 1BXRB 1T10A 2PZLA 4FJ0A 2AOUB 2JIMA 5DSTA 2H16A 1K3FA 3ZHIA 2H1CA 3TLJA 3NRJA 4QOIA 2V3VA 3RTCA 4MQBA 2UZ1B 1YKGA 5GJVC 1ESNA 4HTFA 3SHOA 4CIDA 1F3LA 1PU2A 1VI6A 3WJ2A 1XPOA 5DRTA 2EJCA 2MSKA 3OFVA 4UMVA 5JRJA 2AV6A 3ZX5A 3LX6A 3DFMA 4YUVA 3BWXA 3M6VA 4ZO4A 3BFJA 1XLTA 4BQEA 1R6DA 2VUTA 3U1BA 3UTCA 1JR4A 1P60A 1YS2X 2WM2A 3KXIA 4I50A 4GBMA 2F62A 1IVYA 3FCCA 1K9VF 4J2TA 3BJIC 1PX2A 3NEPX 1KYWA 2OXCA 3IPXA 3SWWA 4XCQA 4TXLA 5JSKA 2VYVA 3M6IA 2PRSA 5E9AA 4L95C 3ZIAD 3Q7TA 4FXOA 4IIJF 4IJUA 1PDOA 2Q1UA 4U3JA 3VTZA 3WJ7A 3KRTA 4Z3OA 3CH6A 3H2SA 2GN0A 1P1CA 1UXJA 1PDVA 1XYGA 4BPRA 3AW9A 3Q3IA 1RVV1 4AMBA 1GPMA 1TM2A 3C6XA 3CURA 3IJ5A 1QTIA 2EP8A 3QU9A 5EYPB 1LSSA 3T34A 5HR5A 3AG5A 4ZGGA 5E7QA 3C4JA 2BEJA 4EMTA 1V7ZA 5C1IA 5C4GB 1OBCA 3V00A 2BUCA 3PXGA 1J4AA 4WY2A 4BEVA 2UUPA 1EFPB 1JIJA 5DSZA 5EN4A 3O03A 2NTNA 4YQYA 1VJ0A 4R71A 5BNTA 5FBLB 3WBFA 3SVLA 3TFOA 1KI6A 1U5BA 2PGIA 4XYLA 4BLWA 3VZCA 2Z09A 3BKWA 1W2HA 1O96A 5LCXA 4DIUA 3KYBA 3RBZA 1CU1A 4DMCA 2KLBA 2IE8A 2H00A 1MV5A 1RRCA 1ENYA 1JSRA 4LY6A 3KD2A 4QAQA 2JHAA 3AILA 2P8JA 1PSWA 2WJVA 5ILGA 4IHJA 2G4VA 3ON5A 1ZESA 3N59A 3OJLA 1QRAA 1RC1A 4UAUA 4N0QA 2GPTA 4PZDA 4D46A 2NU6A 1XKLA 2PQ0A 4V0ME 3VR2D 3HB7A 1C8LA 4B4KA 4RJIA 2JARA 1RD4A 4TSFD 2QN8A 2F67A 4A73A 1AGXA 3C24A 3IS3A 2Q99A 3G9QA 1H4SA 4MB2A 4JOCA 2XUZA 4DJDC 3OKZA 4BFYA 4H1UA 4BFTA 4B4DA 3FWHA 3D6MA 1V3UA 4DJ5X 2I29A 3NP9A 1A9RA 4FYHA 2NTYC 4FB4A 4K9OA 4BE7B 2O8BB 5EE5B 4AMGA 4GQMA 3H5OA 1GPUA 1XAHA 4IY1A 2CSXA 2ZJOA 1N2CA 1NR1A 4LG1A 2HPHA 3CUUA 1JU3A 5K5EA 4N5MA 2C9YA 4D25A 3B7GA 5FNVA 2QLJA 4OHRA 4A15A 3H5TA 4KWEA 1HE2A 1XBTA 3O90A 1EK6A 1FDIA 1TYEB 4WLVA 3HLKA 3LQQA 4YIKA 3ZHXA 1SUSA 1EP9A 2I4MA 3BERA 2RGGA 4J1TC 3ZDYB 3GJ0A 3MOIA 3TLBA 2B78A 5BV7A 1QRSA 5CB4A 4EJ2A 1Q2XA 2YIMA 3NC1C 1IFXA 1X7ZB 1XO1A 2O2DA 3ESXA 1RU3A 3HB5X 5A5FA 2ACVA 3QGMA 4J7AA 1M2NA 4NCKA 1KJYA 1SCKA 2BF4A 2IXDA 4P3KA 3R0ZA 5FBQB 2VT3A 5DYNA 4NDWA 4MWBA 2NVUB 3RABA 1Y5RA 2XEXA 4MB0A 1BWSA 1EM8B 4ZREA 4P2BA 4FFBB 3UFXB 1Y3FE 1K8ZB 3G68A 1WJGA 3GJRA 3IQXA 4OBXA 1CF9A 1H6BA 1RLMA 4G0OA 4J16A 3Q0IA 3PQ4A 4FVTA 2VT6A 4TS1A 2JJ2D 4H1WA 3C1AA 1P9WA 3DOUA 4XJVA 5AKGA 3H0KA 1E2JA 4FGUA 2PXXA 1PJ4A 4ANFA 3QENA 4WTOA 2CZCA 1EFLA 2BFOA 8LDHA 1IM5A 1M34A 2IHVA 3WFIA 1L9XA 4LC9A 3ELUA 4PU0A 5E6RA 1JLLB 5M2QA 3RYFA 3P5BA 2BDUA 3T5BA 1NN3A 2JJ8A 4OGKA 1JNXX 3IP1A 4RTOA 2RGYA 3P52A 2WFLB 5G53C 1XR3A 2VNIA 3QV1A 5HFNA 1ULSA 4D9JA 3L43A 3QYAA 1MO4A 2B4TO 3FR7A 4JL6A 4UCFA 3OIYA 3A11A 1RIIA 3I5XA 1Z75A 4HFMA 3BQ9A 1KY2A 1LZLA 1NI5A 1Y6QA 2D1FA 1M7GA 3BXGA 3FRIA 1SXJB 4KG7A 5CMLA 1JXQA 3AR8A 1PNRA 3DTNA 4FNMA 4N7MA 2DKNA 1S8OA 2ZSEA 3F67A 1VTKA 1XTUA 4G5RA 5CGQB 3ZCRA 2IH4A 1QBGA 1G3UA 3FNHA 4TYMA 2F59A 1TO6A 5IABA 1WWKA 2REQA 1W2WB 1CUJA 2ZYHA 4P5PA 2DFVA 3DKRA 4EY6A 1YR9A 2FPLA 1IQ0A 3I1IA 3ND6A 4P3PA 3AKCA 3HLTA 2P5YA 4N9QA 4BNVA 5T7BA 4KQXA 3K0CA 3ACCA 4B40A 3ME5A 1H05A 3K4PA 3NOQA 1TCBA 1V16B 4P3XA 1PR2A 2FG6C 2C5HA 1SAYA 3VPHA 3PPYA 1EVEA 2WKRA 5K3BA 4EB8A 4KXVA 1FUEA 1M83A 1ZAKA 1YZLA 2PD6A 5EY5B 1R6BX 5A7HA 5K0CA 3TM5A 4NV3A 3ADKA 3FOFC 3E5NA 5MFZA 2ALJA 4UUNA 4TV9B 1WXEA 2E55A 2VFAA 1C7RA 1WZIA 1G63A 1Y7TA 5CVVA 2GJAA 4FFPA 2GO1A 2YVQA 1RXCA 3G2HA 3WMXA 1D2RA 3O84A 5FBRB 3ADDA 5KX5F 3VK0A 1DG3A 3GJSA 2ADMA 3BWMA 3LBYA 4GEGA 4ARCA 1EFVB 3HCFA 3HDVA 4JLNA 1CLUA 3RIXA 1ADYA 5DM70 1M8GA 4RTNA 1NBIA 4OGGA 4BX2A 1VDMA 3OO1A 3TGWA 3AM4A 3G1TA 4AULA 5KJ6A 1D7AA 4IKPA 2YWCA 2COUA 1RYFA 3MCAA 4XM1A 1NBMD 2XA1A 1A1SA 2LYJA 5B3JC 2CW5A 3NT4A 5A4MS 2RGXA 4GPD1 4UEKA 1J90A 1NVBA 1DV1A 1O9GA 5T3UA 5L3VA 1NP3A 4XKJA 1L4EA 4KTVE 1YMUA 1KZYC 1U2PA 4LJ6A 4TKZA 5FA8A 4E13A 3WB0A 3IAAA 3JZMA 3PEEA 2GN1A 3QJ5A 2QJTA 4K5QA 4W8OA 5IEBA 1VL1A 4H6PA 5FBVB 1NY5A 4TMYA 2JIZA 2H2GA 3Q3CA 2XBMA 5JCPA 2WYIA 1JZSA 1BCRA 3DAHA 3LRXA 3KYDB 4JBIA 2PVCA 1DIGA 4Z9YA 3Q3HA 1JR2A 3DZDA 1ZRNA 2BM9A 5CA0A 4BAGA 4NTZA 1JQBA 4FHDA 4OOEA 2G9NA 2ICTA 1SKMA 2NP7A 3TO5A 2JGMA 2QM8A 4I8IA 5LZ7A 1U9JA 2WINI 3EVCA 4NX2A 2D1TA 4NFLA 2P65A 4BVKA 4DLKA 1JQJC 2H2FA 2GSDA 3ZJYA 5CJPA 1T5LA 2ZIGA 1XCLA 3BE5A 3L0DA 5HCIA 1NFRA 5TQ0B 3LUPA 4O33A 3K70B 2WJ6A 3GNQA 1JEAA 2AR9A 3QNUA 2D5AA 3OMLA 2ZBGA 4DARA 1KOFA 2IZ7A 2B9VA 2EBUA 5HIJA 3ZTYA 5B6JA 5GAGi 1L7OA 2B83A 1UXCA 3MMZA 3IKJA 3BS3A 3GJ4A 2QMUA 5ICGA 4Y42A 4UHHA 4XVHA 2VPZA 3VH1A 5BSMA 4CNBA 4NECA 1T6XA 2OCPA 3IP6A 3K6JA 3WYFA 3GZDA 3O31A 3IGFA 2V3CC 1NBHA 4TMKA 2IHUA 3FYTA 2PH3A 2YXPX 1GM5A 2PH7A 3LUJA 4FMDB 3V1KA 1IXZA 1RI1A 4L28A 3SE0A 1JV2B 3VYRB 2V7UA 2E87A 4P6VF 3WMFA 4UBIA 1LWNA 1ZVKA 4AI6A 1XQ1A 5A5VA 2F3RA 2H6EA 3FROA 1GKLA 4ND8B 3ORFA 4HJXA 3EWAA 3ZE6A 1XZ8A 3GRAA 1FSPA 4PXSA 1NDUA 4R8MA 2ZRBA 1T1IA 2H08A 2ZUVA 1G4HA 2P4QA 1OF1A 1U3DA 1YU9A 3P97A 2AQIA 1QIFA 3QX8A 4OHXA 4P35A 4ZIRA 1RYZA 1OBFO 1XFDA 3V1YA 4Q3NA 2G4LA 5G0UA 4QOEA 2FDXA 2DTEA 4IQFA 3ZHMA 1RC0A 1USKA 1V1MA 1ORDA 1XF9A 1NQ5A 4J7UA 3JQPA 3QIVA 5DBOA 1NULA 3ZDEA 5ICMA 3RLFA 3TQOA 2A3RA 1S1CA 3IA2A 3CINA 4JJ7A 3H4MA 3NTQA 2ODPA 4PX2A 4ER5A 2Q6VA 3LPMA 3FZQA 3AM3A 4WCDA 1C9MA 3SHQA 3U60B 5ALMA 2VF2A 4RZ3A 5K9ZA 4NFSA 4M7RA 3LTNC 4YMUA 2NACA 3FPAA 1BHSA 1U1CA 2Q4EA 3MINB 4GP6A 3HGMA 4M9CA 4OIMA 4YC7A 3RM3A 2CSUA 3RV4A 3T5TA 3AHHA 5AW0A 1IQRA 3HV0A 2XCOA 3IMGA 1Q5PA 2XVAA 5KWEA 4M1QA 4W7IA 4HNAB 1GEGA 4K9QA 4XIFA 4QYXA 1YT5A 1EBUA 1QGDA 2IZOA 4DM3A 2R87A 5LKRA 1ML4A 1NXWA 1TI7A 3A4YA 5FUQA 1XWRA 2HH9A 1ZIDA 3AC0A 3OLVA 2MCFA 2WOJA 5K6TA 1JH9A 1LF5A 1JN0A 1KC1A 1SHZA 2WZBA 3PC4A 2HFJA 4UDXX 5E6SA 4E4TA 1W0CA 1VLHA 2I2XB 3CLUC 1CP3A 4Q3LA 4QDOA 3JRWA 4O2BF 5CB6A 3JWEA 1T2VA 4G5XA 4XGKA 4CTMA 1G21A 3GT4A 2ZUBA 4Z5XA 2CLDX 3GVCA 2XAAA 1CUIA 5FL7A 3Q3VA 4YP9A 5A6VA 3WYEA 3AHEA 3OQIB 3OCCA 3MWKA 3QV2A 1N1EA 4EW2A 4ZI7F 1JIIA 1QH8B 3C7CB 4FDMA 3DHEA 1VSQA 5EI5A 3L2OB 5JS7A 5K0GA 1ZJYA 2I65A 4FYWA 1QTNA 5E1BA 2OR3A 3U31A 1KQGA 3TGPA 5LQJA 5JJ5A 3O4GA 1EJ0A 5EUQB 1BVYF 1BQ3A 4MW4A 4D02A 2FOXA 2CUZA 5DP2A 5JG7A 3P9RA 4QOFA 2OV3A 1WB6A 1NMQA 1KC3A 1B0UA 1RR6A 2O3UA 3PXCX 1KHTA 5JXHA 1ZH8A 3ZCQA 1EB8A 1CY7A 2VDPB 2B99A 5H4GA 1HRKA 3DVLA 5CFQA 4LRYA 4OI1A 4Q4HA 3U6KA 2ECQA 2Z5FA 1UQTA 2QM0A 2X4GA 4JVSB 3EISA 1C9JA 1DKMA 3CWZA 5AHRA 3QOWA 4DSNA 5IVIA 3ESDA 4EVQA 5HXAA 4L5YA 3HJUA 2H0QA 1ADBA 1VPLA 1LLCA 5KHLB 4FB5A 2B98A 3HHPA 1UFQA 4N3NA 1I33A 2D4HA 4Z7NB 5I45A 3DP7A 2OBNA 1YZVA 1YF3A 1KI9A 5DP1A 3QBJA 3M6UA 4N41A 3ITNA 4LFBB 1SC9A 1X15A 2PH5A 3AI2A 1L4NA 3PENA 3DUWA 4IHQA 3SJ7A 3PXXA 1X3LA 1DWUA 3T1TA 1Q0HA 4TKMA 1EVIA 1M10A 5KHAA 3RS7A 5LQNA 3JAWB 4MAMA 1DOHA 2XBLA 4KL8S 4UU0A 3PWZA 2C7RA 1PJSA 3GUZA 5FJIA 2HA6A 1ZOSA 1Y98A 1IUOA 1JFFA 3O2QB 3P2MA 4G65A 3AU8A 5J23A 1E62A 4QXOA 4QO8A 4D3ZA 3FCXA 5ALTA 5CDGA 4BNZA 5K0TA 2B8EA 2EW1A 2O1EA 1AJEA 1SQ6A 3ENWA 2BJHA 2I9KA 2P6UA 1WKVA 5AVUA 2FUKA 1UBKS 1NOKA 2W4QA 4UVEA 2PAFA 1FDTA 1UKVY 1P2FA 1X7WA 4WKNA 1D07A 2H11A 3N2ZB 4UUAA 5JJLA 2I2FA 2GESA 2GEJA 4FYPA 2XJ4A 5F2KA 1O54A 1G1MA 2CC2A 2JDIA 2XUFA 1MO3A 4GZ3A 1ZD2P 4HDMB 1OIWA 3E9RA 3V4ZA 1A8HA 2GPBA 2YW2A 4AKTA 2H3HA 4BPBA 4AWXA 1J23A 2QD2A 4ZYUA 3QPWA 2UZ4A 3OJWA 1RP1A 4RENA 3OURA 4D4KA 3HYRA 5E9QA 4ZCIA 3GN1A 1O94A 3RS9A 3HFGA 5KTYA 1YRQA 4LYYA 4LYAA 2VZEA 4K6KA 4WFJA 1YB7A 3A7DA 4W9NA 5CA1A 4D2IA 4OLFA 5KNDA 1CUSA 2Z08A 3PL1A 3RU2A 3JD2A 2FMTA 3BQMB 4TN1A 1XD2B 4PPNA 2FPIA 1NIJA 1WCWA 4PZ9A 4RIEA 5HJEA 1YACA 2HDHA 1RJFA 3CLHA 3DF7A 4U7DA 2TMYA 4EBFA 4X3CA 4K81B 1G7SA 1XJCA 2ZDHA 4AZ3A 2IS6A 2HNKA 1KZ6A 2HMUA 2OFWA 3SICE 2IODA 3W4IA 5BN3A 2RHLA 1SCUA 3BMXA 2RH8A 1TDJA 1HFWA 2AEJA 1M6VA 4ES6A 1TIBA 4EMUA 5BPHA 3BTOA 3RG8A 2O48X 3MT7A 1R64A 3WL8A 4C22A 3INYA 1B8OA 1U7OA 1G8YA 3DR3A 3IEXA 1YU6A 1K8QA 1YO6A 3ROPA 1YJQA 1DO8A 2G5TA 3ABZA 4MUAA 3O4FA 2RIRA 4PG7A 2X4IA 3B5JA 4CIXA 1YJAA 4DIFA 1RLUA 1W25A 1XDSA 3PD0A 4NYJQ 4WN3A 1JEYA 4H17A 3IALA 4BS9A 3LXRA 3ANLA 1Y9EA 3JQ7A 4FNOA 4MIEA 3OOJA 3UGKA 4PIMA 4B4UA 5FO1A 4DBZA 4M8SA 1ZSVA 2YN4A 3BSFA 4K2HA 1G8PA 1BGVA 4IVPA 4Y0NA 4I9GA 3I61A 4BGDA 4OREX 4YDQA 1K27A 5LUBA 2NOAA 4D41A 3ZLTA 1J5PA 2B7CA 9MHTA 2QPTA 2JFZA 3L4SO 3JW8A 4NYMR 4INPA 2EAUA 1SJ9A 4QX6A 3SLRA 1ZDMA 4L76A 2CHUA 2PNFA 1O9HA 3OLQA 2XVZA 2DHDA 4JP3A 2HV9A 1W36D 3FUXA 2WWIA 4P4LA 3SYLA 2VG8A 2QG6A 4UOEA 4D5GA 1FTGA 1G0OA 2PHZA 3P1JA 4IDOA 4XWOA 1ZK0A 6PFKA 1VL0A 3QUTA 4J9UE 1Q21A 3F3MA 3LSTA 5LZ2A 3PHHA 3QY0A 5CNMA 2QRHA 5EUMA 4BNDA 4ZDKA 3KSAC 4U7GA 1DEXA 1R0YA 3KQSA 4HOYA 3W6NA 4C7MA 3ZKWB 1CRWG 1WRBA 3EVDA 2OM2A 1G5HA 1TMGE 1J7KA 3ICEA 4JYCA 3ABQB 3N76A 3ENNA 1FLDA 1EDZA 1V9SA 2KQUA 3ENQA 3ITEA 3JQAA 4X6XA 4WBNF 4CIWA 5EP3A 1L5LA 1J07A 2OG2A 5E8JA 5FUMA 4JP5A 3WZ2A 2PXDA 3COVA 4J4TA 1L7RA 4I8DA 2PBRA 4LY3A 4UMDA 4HGNA 2AZMA 4YRRA 2ZR8A 1E6EA 2GD2A 2MR6A 2OHIA 3B52X 3CX8A 4GZ6A 4EFNA 3KB6A 2QZJA 4XB1A 2AFHB 2UVPB 2IV3A 2X7JA 3RUDA 1Y9DA 3OCWA 1LSUA 3TVYA 1PRUA 1SVKA 3G9XA 2RI0A 3UQZA 4BCBA 4C4AA 4IVQA 3QOFA 1COWD 4FCCA 3GHHA 3H4VA 2I8CA 4P54A 4R0VA 3ZLUA 3TI9A 1PGNA 3EG9A 3OPMA 1RXYA 3L04A 1SEVA 4RZIA 5D86A 1U80A 3KKLA 3A06A 3MJRA 1U8ZA 1N5RA 4MARA 2QRZA 1V4BA 3R3SA 3DMTC 4QFMA 5FOXA 3VUEA 3H9JA 2QTRA 3I01A 2LNMA 1MA0A 4IXDA 5G40A 4ZZ2A 1H42A 2CVHA 1ZBQA 2JK1A 3KOOA 3SJAA 2WTUA 2D59A 1E1CA 1HT0A 2OORA 5HIIA 1ZI8A 1J09A 3ZYCA 1JDVA 1PT7A 4EO4A 3DWGA 1ZW6A 1QDEA 4ZOLA 5F3DA 2Y68A 3VZQA 4YJDA 4Q4JA 1PS9A 3HYSA 4W1RA 5DBGA 3T8YA 3GBFA 2ZG6A 4G1CA 1ZZBA 2BE9A 3E9NA 3BZBA 2LKDA 3PUYA 4XOUA 2V7QA 2K5UA 6Q21A 4WCVA 2ZUUA 4H7KA 3V5NA 4U39A 3MLFA 3PXUA 1CVIA 3ZQJA 4DIEA 3U4HA 1O5OA 1DV2A 1JG1A 4HWTA 4NS4A 3W6UA 4YMWA 1REQA 1NUSA 1P6UA 4LJAA 5BSGA 2M1ZA 2GVZC 1R0SA 3T1OA 3CZMA 1CJVC 5CXSA 4BN5A 1NXSA 2BM0A 1ODKA 2PMDA 1GTMA 3I76A 1KDRA 4E5UA 3OEWA 4AQ7A 2JIPA 1CQIB 2OCBA 1OJ7A 1DHRA 1SKAA 1WSDA 2WQ6A 4LGMA 3TLAA 1GN9A 2COKA 3COWA 4BMNA 3ORQA 5IYZF 2GZ1A 2Y0EA 2WF6A 2Y9MB 3DF9A 4K9NA 5AK0A 4CKXA 4QBIA 2A86A 3IP5A 1S0UA 4X1YB 4HQFA 2HUNA 3GDGA 1OYYA 1EFAA 1YCFA 4F8JA 3FI9A 1XLUA 3TAXA 2W2QA 3R7WA 3O91A 1ISGA 2MINA 2PO5A 4HZIA 3PQ3A 4DW8A 1P4HA 3HKBA 5CDUA 4UNSA 4IF4A 4GE3A 3CH5A 2P9GA 1Z7EA 3LOUA 2Z2XA 4URYR 1O97C 3KLPX 3OTOB 2QWXA 3CO5A 2NU9B 2VQFB 3CMCO 3RANA 4LXXA 1SXIA 3RIGA 2XOEA 3MBIA 4GPBA 1LSJA 4LE1A 5BYAA 4BLRA 5ALYA 4QQNA 1WF6A 3GZJA 3LUDA 3NHJA 4E4YA 1Z36A 2ZZKA 2ODRD 4YCAA 2XXJA 3IP8A 4OMFG 2G40A 1KGDA 2FPGB 2OV6A 2WJ4A 1CE8B 4Z5HA 1MP0A 2JLQA 2TYSB 3AXSA 4HDRA 2GCOA 5BSKA 1DAOA 1G38A 1FFXB 4RQUA 2YJ5A 3ISJA 1BU8A 2XKJE 5ALJA 3DVAB 3RK1A 1Y8QA 1I4WA 1QVWA 3KKPA 3MPUA 4KB5A 4CM9A 1QFSA 1QJCA 1XI2A 2O7SA 1UWKA 1XEAA 3PPVA 4Y30A 2ZJ1A 3ZS8A 1TIKA 1E1DA 4QHSA 2GM9A 1OZAA 1FJHA 2WHPA 4EABA 3LPNA 1H23A 3W90A 2G71A 3D2BA 4YDHB 4NABA 3V1MA 1WLYA 3U9SA 1CYEA 5FFMA 4MR8B 4MUKA 4I1PA 2DWUA 3ZCTA 5EEHA 1V2HE 1ZK3A 1TYBE 3R7DA 5BT8A 1WULS 1O94C 3EQZA 5CFRA 2ZWMA 3CJQA 2H9AA 3NCTA 3VU3A 4I1OA 1FTNA 2GD0A 5IKOA 2VXYA 2DTDA 4IH9A 1QH9A 4AW9A 5CDHA 3KL2A 5J59A 2VK8A 2WV7A 2VRNA 2W11A 1N6HA 1WMBA 1UM9A 1CC1S 3B53X 3VU9B 4CKYA 1WS6A 1P7PA 4CN8A 2NVOA 3GR6A 4BNNA 2RGDA 1P9NA 4PCVA 1FFWA 3P32A 4KUHA 4GGMX 1M9NA 1MOSA 3VYUB 1F51E 5ALPA 5IN5A 2GZHA 2SHKA 4E1VA 4RU1A 1KRXA 1QH1A 4FINA 3FB4A 3K4QA 1FVOA 4HD8A 1U94A 2E4XA 3UHJA 3V34A 2V7XA 5ERXA 3TUZC 2R6CA 3QYXA 3A36A 4ZV7A 1DFGA 3ADBA 1ZAYA 1HQDA 3P4UA 3PDIB 4YRDA 2YHSA 5LA6B 3V7UA 1G59A 1QX4A 4Q39A 1JR6A 5HRAA 1T3SA 1YA8A 3UZUA 5EIXA 3EIHA 1DAEA 1YFLA 1CJKC 1KZ4A 2IYPA 4AMVA 4LW8A 4JA0A 1DC8A 4RLQA 1QP0A 1SXJE 2ACWA 4XQ0A 1XN1A 1XTIA 4QRHA 3UN1A 3FW1A 2ZDQA 3NHKA 4RTKA 1Y6RA 5BN4B 1XZHA 2P6PA 3GJZA 3BUSA 4DDTA 2CHVA 5LN1A 3Q6MA 4NE2A 1AHPA 2PUAA 4B4OA 2I7XA 4RK5A 3VHLB 4JODA 2FCRA 1LGYA 4HLCA 4M1ZA 5DPMA 2KEKA 4X00A 3ABOB 4ALJA 2AFVA 3QPUA 4YRMA 2ZSHA 1NSFA 3CLSD 2CV1A 5AKZA 5K05A 3FTNA 4AJ9A 1M7BA 5KOYA 4DLLA 4HYQA 4R84A 3VR5A 3F9RA 3QIAA 3UQYS 1IU9A 2C03A 2P3SA 3FTQA 3L8DA 3AXTA 3ZXIA 5AKLA 4BOYA 3QOXA 4XGNA 2WNSA 2JGDB 4A5SA 3WA7A 2PXAA 4QWWA 1KJJA 5SV2A 1XALA 4PR3A 1K6MA 3U3OA 4BC0A 1J8QA 2ZSDA 3C3XA 4OEHA 1J5EB 2HDWA 3GGDA 4FFOA 2ZBRA 4BNKA 1QGAA 2VH1A 2QN6A 4MI1A 4UNPA 2VT2A 4DCGA 5HUQA 3OFJA 1YNOA 4DE8A 1A9OA 4NMWA 2P6NA 1KMNA 1XTPA 3IT2A 1OBHA 4F3RA 3UKDA 2ID7A 2HLPA 5CVUA 1IVNA 4ZYZA 1XB2A 1CZUA 1V4VA 3MJ4A 1C30B 4FKZA 1PD1A 4H3HB 4PNPA 3RREA 4UCWA 1GVHA 2RONA 2P40A 2UVQA 4P4GA 3LM8A 5IDYA 2UZ1A 5IUJC 2ES4A 1TEXA 3QE0A 1FVHA 1HLGA 4OHUA 3GV0A 3AZOA 2GZDA 4B3BA 4QDXA 2TMKA 2QDKA 4R5HA 4N5NA 3L8YA 5KTPA 3FWNA 2NO5A 4MCHA 5KYVA 2KS6A 1SUFA 1GU7A 3EGEA 2DPXA 4AZSA 3KB8A 3IMKA 2WMOB 4RANA 3FFXA 2FN9A 2XT0A 1M75A 2ETVA 4YP7A 1NW5A 4X4CA 1KQ3A 1M1NA 1SN7A 1TQDA 2PYZA 2NO4A 1W1WA 3F5MA 4AD8A 5AFSA 4OIFA 4YY3B 4C9BA 2XQIA 1NVWQ 3TLKA 4LVNA 4TQUS 3UF0A 2XE6A 4RA9A 5ILOA 3GMIA 5ALEA 4Y6SA 1TAHA 4MLDA 3R0XA 3FTCA 5KOJB 2VOEA 2IC5A 2CLFB 2GCIA 1W47A 2HA0A 3H19A 5HF6A 1ZMRA 4HVCA 1XZCA 3DDOA 4FYVA 4TT8A 3TTSA 1JX6A 1JMYA 4LSGA 2QTBA 1E89A 3ZGLA 4BU1A 1QHYA 1KAGA 5ECYA 3VA7A 3UICA 2W0MA 4DLZA 1ZM7A 2ZITA 2Y27A 3NASA 3QUCA 4PO3X 1QYCA 1IXSB 5T4FA 2H1WA 3LC7O 1Y7LA 1OCEA 3WYCA 2ZIXB 1UBFA 2P41A 2PX8A 1JWAB 5I4KA 1QNFA 1TM5E 2O2XA 4REMA 3SKVA 3A9UA 1ZU4A 1NYRA 5E9JA 3DOFA 4XM2A 3Q2KA 1K63A 1OZFA 3LY9A 1JSXA 4TKLA 3TF5A 4MTCA 4G23A 4UM9B 4TTJA 3IUNA 1VBNA 1GGEA 1LVHA 3JPYA 1O0CA 2V97A 2ZB7A 3FMIA 4HLUC 4CLRB 4YJ2B 5A2GA 1OA1A 3FPHA 4US0R 4F86A 1KJZA 2QG4A 4RSGA 1QTRA 5K7SA 3QSGA 1NSTA 1F0YA 3G2MA 4DSUA 2IU7A 1MJHA 2GFQA 2EFHB 5DT2A 4RDHA 2VP3A 3X1XA 2EEZA 2DMRA 3VXKA 4N40A 3CECA 2A7QA 3H65A 2I62A 3UAGA 4PG4A 4AROA 2GAJA 5EGSA 4DTCA 4NK5A 3C4VA 4KFRA 5K01A 1VHDA 3RYCA 1E77A 1EWTA 1MO6A 4QNNA 5IWCA 1T4CA 1U6IA 1DULA 3K73O 3LQ2A 2R7NA 3O3CA 1BVUA 4HZUB 3SR3A 4R2XA 3E9QA 4B3HA 3AVPA 2FHPA 1A4XA 3FVQA 4EF6A 3OE7D 5E7JA 3BXZA 4QYTA 1A04A 5B2EA 3MT8A 5K0NA 1EUYA 3C5VA 2R5NA 2J3KA 3H8SA 4N39A 3NYIA 3SR0A 1X7HA 4RSHA 2EKPA 2HCTA 2OXTA 3OX1A 4CUJA 5HVNA 2VPYA 3ER9A 2NVUA 1LDNA 3U3WA 1VRCA 1WV0A 2JD2A 4YALA 1O4VA 3N2YA 4NYJR 4OAOA 3QUSA 3W5CA 2GVDC 3EXHA 4PY2A 4KIFA 4PAOA 1S7GA 1KMQA 1WO8A 1Y1SA 2IOFA 2VA8A 3BL6A 5MHTA 2QRJA 2JFUA 2FG5A 2XWBF 3SHVA 3E81A 4QU8A 3ASYA 3VYVA 1B0PA 4IW3B 2Q5IA 4E1BA 1JQKA 3A2MA 4DB2A 1BE8A 2EZ9A 4RZ2A 4F45A 3AONB 4IV5A 3TL6A 2A0WA 3WL5A 2NUPB 1DAHA 4XUEA 4UTRA 4TL9A 4UBKA 5FI5A 2D7DA 1OH5A 4U1RA 4FMBB 1P80A 2Z2KA 1B6SA 5AW4A 1T8TA 3K9HA 2VAMA 4TTIA 4RVSA 1AZTA 2XMSA 2ZRDA 3DOIA 4JVOA 4L78A 4WFQA 5FLKA 1MX5A 1ULUA 2DLNA 4AY3A 5JH7B 1FFHA 5E3JA 4A16A 2X77A 3BJRA 4B4VA 3VO8A 1PTJC 1LJ8A 2IXAA 2JJQA 2UZ3A 3LHKA 1Z5VA 5TY0A 1ZNQO 2MEZA 4EJ0A 2G9QA 1ZH0A 2DG2A 2ZVPX 1USUA 2ZJ8A 4MQLA 4ARIA 4ISCA 3ONDA 4I4LA 4AJHA 1C9DB 2SKDA 3DO8A 1B93A 2A92A 2ZT8A 4L8VA 4EGJA 3BCUA 4UE3S 1US8A 1I30A 2C5BA 2GR9A 4JLPA 4Y7CA 1V3VA 4ZQIA 4B5KA 4FR5A 4XA8A 1CEYA 3HCPA 2E3JA 4RNCA 3BSSA 2FHSA 1NXPA 2GARA 2OAEA 3S1AB 1I7DA 4PYMA 4EZEA 1I4LD 3OPNA 1XU9A 2I2WA 2YDYA 4PCLA 1YFKA 421PA 3L7LA 1WLSA 2B7BA 2O1SA 3WVNA 4QJBA 4DC1A 1ZIOA 4DR2B 1QIHA 3C87A 2GK3A 2CD9A 1Y8RB 3H1EA 3V8QA 3SZLA 2XGJA 4OQNA 4A0QA 3WB2A 1HYBA 4JLBA 5ENZA 2DKFA 4HGPA 5HOQA 1AMNA 1DHTA 4N8DA 3X1YA 1CNFA 1AGYA 3M5PA 5KWSA 1LK0A 1T8YA 1B16A 1YA4A 3HKCB 4X41A 1VE5A 4JV5B 4JXZA 2P9TA 1PRVA 4M0KA 1DXYA 4UBLA 3UC9A 5TGDA 2BMWA 3MOSA 1Z2CA 4MRMA 4BO5A 4PC1A 1SIWA 1CERA 2PLNA 3M7IA 3HY3A 3SIXA 3W5IA 5LQSA 1OX4B 4KXMA 4F91B 5LL6P 5DCYA 1NI4A 3CXUA 4ZO6A 5M5BA 3CUYA 2IS1A 4PICA 3UBMA 3JD4A 1H2ZA 3WKEA 1Z4JA 4ZK2A 4E2WA 2W2LA 2ZRIA 1F7UA 4H9GA 3RYIA 3D31A 1R12A 1XU7A 3VR6D 4GOJA 5KYKA 3NHBA 2BRUC 1XYVA 2WUEA 1V8BA 3A9XA 5IVHA 1YGYA 1Z0AA 4CV3A 2PMBA 4KH0A 5KAPA 3B8EA 1B6GA 2A4KA 4EHFA 1OGYA 2QGZA 5ER6A 3PVCA 2G88A 5J2UF 3R3WA 1PN3A 1IHOA 3E8XA 3Q2IA 4PBSA 4AYTA 3LYUA 3U5TA 3MGGA 1M33A 4I81A 4HMOA 3H6GA 5BNFA 1CRLA 5AT1A 5JADA 1NE2A 1KJNA 3BH7A 3K0FB 4PGGA 3EW9A 4J0DA 3HO8A 3RB8A 3WKBA 4AJPA 4TLDA 4MKRA 4D9NA 4I6UA 2F3UA 2VTBB 5SY9A 3VPXA 5CFLA 4JP2A 4EENA 3BGOS 5CA1F 1WKBA 1A7UA 1NLUA 2P9FA 2YQ5A 3KPWA 5L6LB 2MSWA 1CF4A 1K9SA 3DE4X 2QVYX 1YAJA 4IKOA 2GZSA 4UXJA 1UKEA 2FW1A 4IJ6A 3BXPA 4LPKA 4W7SA 2D2FA 3CPEA 1QIIA 4MWCA 3DSRA 2PUFA 2BNOA 4MKXA 5EJFA 2D1SA 1KPHA 3EDRA 3NIFB 1QGOA 2ZBQA 2HJGA 2IF0A 3HB0A 4DY4A 1L4MA 1IBLB 1AKEA 4MDEA 4JXKA 2BGIA 4RTQA 1JHOA 2GCNA 5SZIA 1OPRA 4M0CA 4B2PA 3S8EA 4U2FA 2AW6A 3M5WA 2O2YA 4O8ZA 5EOVA 3EIEA 2XWJI 1ODJA 3GFGA 5J2TA 4GBJA 4GXQA 4WL0A 1GU1A 3BHIA 1ZEMA 2ATEA 4S12A 5BR4A 3PTAA 4EYEA 5JXWA 1AUPA 4BE4A 2HQ1A 2Y6VA 2Y99A 1PX0A 4D7AA 3X1ZA 1ZPDA 3LBFA 4F8EA 4UPEA 1WY7A 3EMBA 4MA0A 1P18A 5LP6C 1V9LA 3RYHA 2PMKA 2K7FA 4KH1A 1Z12A 2ECOA 4IIVA 1V3QE 3K1JA 4JSRA 2W9XA 4BDSA 4UEQA 1OYOA 1YCHA 1SPXA 2DHRA 4IUBS 3CEMA 1XAIA 2XNDA 2XE4A 4L6IA 4D0RA 1SFRA 3TXXA 1ZD8A 3NJ8A 4PAQA 1ZJJA 2ID8A 2EJBA 5L4SA 1SGWA 3EXFA 3HN6A 3FZYA 5DM60 5AI9A 5DNYB 3M4NA 4A1OA 4KE7A 2QTFA 4X1KA 2ZI4A 5KQGA 1NMYA 1OGJA 5FYQA 4MUXA 5CX1A 3A1VA 4FGSA 3PGJA 4J0HA 3RAJA 3W1WA 4ECAA 1E5QA 3C4QA 1ZVJA 1ZUNB 2PZ8A 3D8HA 5DHAA 1RXWA 3NVDA 2PLAA 1EP1B 4LDQA 4QLBA 2O2GA 1W85A 5AVTA 1FQWA 2WUWE 5EUCA 3AF0A 5LWQA 3PI7A 3NGXA 5ADUS 4MKZA 1XJ5A 3OMTA 2DBYA 3KM0A 3LUAA 5TPZA 1TJYA 3KJHA 2I2DA 5C46F 1W34A 4FHZA 3TYXA 2CLSA 4HXGA 2PL3A 3A26A 4UULA 1JHDA 2XT9A 5FL7D 1D1TA 1FUKA 4W8HA 4EHBA 4KR6A 1NAHA 2XE7A 3LBAA 1I3KA 3JTMA 4I3FA 4X1IA 3U3ZA 2HMWA 2WTNA 3FWPA 1X7GA 4WOKA 2HXGA 1JAIA 3CUVA 3QF4A 2Z9DA 2YWXA 1CR1A 3WZLA 1EHYA 1J1ZA 2L42A 1TB4A 2HQSA 2J3DA 2JGLA 1QRRA 2D6FA 1QFMA 5LNK6 1XJWA 2CFIA 1RLOA 3HDJA 3R5FA 2AXNA 3D54D 4RABA 5K8UA 3WYNA 4TYWA 4NBLA 1YTUA 2GPAA 1C1HA 3HJCA 4OM8A 3DD5A 4C4SA 1RHQA 1AIPA 4I8XA 1ND5A 4NBRA 4U6QA 3KK0A 1KK3A 3D7LA 3U44A 3L4EA 2QVZX 3NDIA 2BFCA 5EZYB 3H1GA 5A4KA 1ZOPA 2PE5A 2IYOA 2XI4A 4W5TA 2O3JA 4NCBA 3D8BA 1W87A 4J90A 4R1LA 3E70C 2YFYA 3SP1A 4KITB 2CYCA 3R5HA 3KWJA 3MWLA 2IW1A 4X60A 4GE0A 1C7QA 2OECA 3VR4A 2OBBA 1W8DA 4ZU1X 1SBNE 1RKXA 2C5GA 3I5UA 4X8MA 3HEMA 3ZE7A 1ZJ4A 3EZGA 5JY6A 3HCBA 2P90A 1X9HA 3LFHA 5HM6A 1HE5A 1LK5A 2DR0A 2V5UA 2XUOA 4RPLA 4LF6B 1DKPA 3BRWA 4KQEA 2DX7A 3TQCA 2ZSJA 5G4KB 1R9MA 1E0DA 5HDBB 1GGJA 3EH2A 2JVKA 4S2UA 4RELA 1J97A 1QNLA 4RMHA 2PRJA 2J0EA 5GONF 2IH2A 4MW5A 3X2SA 4LZWA 4MNTA 3LCRA 3MF4A 4WN9B 1E3QA 2J3HA 3F98A 2I55A 3GK3A 5SYNA 4GQAA 1KYXA 2V45A 3PNQA 2BKXA 4YEDA 2WSSA 1YRLA 4R54A 4WZBE 2RGCA 4GWKA 4B7CA 4BUCA 1CY1A 2W2PA 5JDCA 3JXEA 1W4AA 1SUPA 4LMPA 5EXEA 5L4NA 1ODIA 2GOYA 2Y1OA 3FSGA 1NZDA 1AV6A 1FMJA 2OORC 3NORA 2AXUA 2EGUA 1RXSA 1JXMA 4ARBA 4FN4A 1TLTA 4R1NA 5LXTF 3OJXA 5I9TA 1HFKA 3NR2A 3TL3A 4CN9A 3I30X 1U0GA 2J3JA 1CDEA 1NVXQ 5AW2A 3FCSB 3PXAA 1WPXA 2LZ0A 1R1DA 3LFTA 1CZNA 3KFVA 3M6LA 4Y1RA 3ROQA 1YCGA 3EQ2A 3IQHX 5JRZA 1ESZA 2H48A 1BYUA 4G2NA 3LPDA 4B6EA 3TKAA 4BO1A 4O63O 2FU5C 5ELXA 4ZYTA 1CUAA 2C96A 2ODAA 3DHVA 2DPHA 2W98A 2XVXA 4G36A 3U9LA 5A2QA 5ALGA 4ZDWA 2GA9A 3DE2X 1WH8A 2O0MA 1W5TA 3NKFA 3N0TA 3OQOA 5FOSA 2C4UA 4ZKDA 4KDEA 1XZFA 4KI0A 1L7BA 4IS2A 2P2GA 4RPJA 4WLNA 5K3EA 1F2UA 5F21A 5DHUA 4Z7JA 1P7CA 1Z5WA 5IHXA 5ALRA 2VEDA 4OU5A 1VSVA 1EGMB 1B0AA 2GGSA 1CR2A 2JK0A 3PDJA 3D8NA 4YJHB 3UGQA 4JJ4A 5HDQA 2C0CA 3TFLA 2LV8A 4AK9A 2ORED 1GLNA 1SHUX 1VGRA 4FGKA 4FGZA 1DC6A 5GM2A 3ZNQA 4DR4B 4B83A 1SHJA 1SUIA 2GM4A 2Q2WA 4OBWA 1RCFA 4KQ1A 3UJ9A 3NQ41 1R18A 1GU0A 1L3IA 1Z9BA 2YQZA 3DDNA 3ROFA 5CT4A 5C4IA 4B45A 1GL3A 4P82A 2GM5A 5HYVA 1F2DA 2HIHA 3AV0B 5B30A 2B5OA 1I5RA 1O9BA 1PD0A 1H2YA 1QQ5A 1UOQA 2RGBA 3H9UA 3OIUA 5DNDA 4RXTA 3TNLA 3ZU5A 3VPBA 1N2IA 3IJPA 1FYVA 4HATA 4N3BA 1VCMA 2FEAA 2J08A 4MH0R 1IHYA 4D0GA 1WCIB 3IB3A 3H3XA 4L85A 4HFNA 3LPLA 1Q7TA 1VPDA 4JASB 2V6MA 2P5SA 1Z4IA 4GLLA 4MKFA 2WP8J 2AC7A 1ES9A 3MG9A 3HJFA 1MQSA 1Q57A 3AUXA 4WLEA 1PW5A 2CCKA 3OQBA 1U8TA 5DU2A 2QAGB 3GCZA 2BFBA 4RH0A 5PGMA 1MU0A 4Y2PA 5GONB 3UJHA 1D6MA 2D13A 2IUTA 2ZWVA 1DX9A 3KB1A 3KU1A 5HCUA 3RBVA 4IFEA 3U4DA 2BKLA 4DUPA 3OQHA 2ZB8A 2FG7C 1NVVR 4BWVA 1UPXA 1XKTA 1E6CA 2ZB4A 2C1XA 2LW7A 3PD7A 1VLMA 4MS1B 4NFHA 2Y0DA 4XRRA 5DGIA 2ENWA 3CF0A 3GPLA 1C2YA 1JMVA 2XUAA 5ALLA 1CUDA 5EXXA 3Q6NA 3VQTA 1OC2A 3G0GA 4M8LA 2P91A 4XSVA 1XDBA 3IFSA 4DCNA 3FHJA 1FLNA 2H59A 5CLGA 3HZZA 5AI4A 2ZWOA 2XNCA 1ZZEA 1GFIA 2VP9A 3L7KA 1EJ2A 4AUMA 4DPMA 4JKOA 1NUHA 1JI3A 2V6JA 4F5WA 4MPPA 1IN8A 1RWOA 2AQKA 2LCIA 3INGA 4RVDA 2D3TA 4HNQA 4MJXA 5JHHB 4X3OA 3VNUA 1M73E 5CP8A 1NHWA 1WXWA 1SCNE 1SY7A 3MS7A 5IC6A 5E7IA 5JTUA 2IQIA 4PAGA 3N2KB 4YRCA 4ZQBA 4M99A 4QDKA 4A8JB 4J0EA 5TT1A 3BEDA 3U2QA 3SR4A 5B1YA 3BCRA 3LP6A 4WPGA 3HE3A 5FTNA 2C58A 3IVPA 4I2NA 4WOJA 1EEXB 4UNNA 2JD1A 3LKVA 2IT1A 3BMOB 1J2RA 4RK1A 3UT5B 4CCYB 5CXUA 5I4CA 1N2HA 4RTJA 1KEUA 4O2RA 3HJTA 3OTIA 4RWEA 2Q4RA 3ICVA 1M1XB 2ZAMA 5J4HA 4I0WB 2ZJBA 1GHTA 3I4LA 3H75A 5DMXA 5FB3A 1RWPA 3GXOA 2ZBDA 3F7OA 3V42A 2VXOA 2LRHA 5FOWA 3BWBA 3PGKA 4DZZA 3NNDA 3EVFA 2EZUA 3GA5A 3WK9A 1C3VA 2GILA 1Y48E 3IDSA 4NE7A 1BTOA 3NHZA 4JUCA 1BXGB 3WL3A 3QLTA 4CMIB 5L6MB 2KPOA 1KXJA 1M7HA 1JDTA 1YVPA 3HVJA 4MW1A 1M2FA 4MVWA 3AJ8A 3ZIAA 2PXVA 4NHOA 4LCEA 3QK7A 3L7JA 4O3MA 4AURA 5EIEA 1WB4A 2FN4A 3AUAA 4MOWA 4PONA 2LYQA 3L05A 4C4XA 4C89A 4TWAA 1KH2A 1TJ4A 2NZXA 2Q0QA 2YMQA 1A50B 1EAMA 3QF3A 1SOVA 2WJAA 4IMRA 5EZ5A 3LH5A 4CEJB 1XZQA 1R88A 4Q4AA 3STHA 4IJMA 3VJRA 3QX7A 2LYLA 4X4HA 2BSQA 2J7UA 4Q2JA 4ATNA 5AUOB 4FUTA 3FTEA 3VR6A 1ZI6A 5JDIC 3OCVA 3C1OA 2O8CB 3INTA 4J3NA 2FX2A 4GMFA 3GLRA 3Q9LA 4TRNA 2RB5A 3CSSA 3VZSA 1ZITA 4LQLA 4AFNA 2P9QA 1YS9A 3N58A 2WE8A 4ZDIA 2YKGA 1TM4E 5I47A 3MHPA 4FR2A 2XZOA 1L8LA 4BFCA 1HORA 1IDOA 4IJ5A 2ARKA 4GNRA 1ZUGA 2HBRA 4GPTA 4QA9A 2AOXA 5DLQC 4A23A 2QA5A 3PRJA 1P0FA 5HOEA 2IYVA 2EGHA 3TLEA 3IPAA 1EVKA 3OP1A 1E3EA 3DEAA 1XTTA 3IAM1 3BILA 5CEEA 4NU6A 7ABPA 3EVAA 4MS3A 4W5WA 4OMDA 1GKYA 3URMA 2N9UA 4C3OB 5I7RA 3RVQA 2OEPA 5J58A 2NTJA 4KYIB 4YCDA 3GG2A 3MELA 4J0IA 1GIAA 1GPDG 2A5YB 4C0BA 4LQDA 5C7IO 4CKCB 1NNEA 2W2KA 3WRYA 1XIVA 4C6SA 3TZLA 2P1RA 3CROL 1HH4A 1CEEA 2R6DA 4W5JA 4RBNA 1K8YB 2FPUA 1WPQA 1ZS4A 1QLHA 1U28C 5AOVA 3TQSA 4LF7B 1G6KA 1DAPA 3K53A 3C5HA 4P58A 1KRHA 1AS3A 2J9YB 3QMWA 3C5CA 1UINA 4LHSA 5AW7A 2Q6IA 4F1WA 4AN1A 3U0VA 4N3AA 4X7BA 1NKVA 3ZVLA 1HDZA 4YMIA 2DWCA 4PLWA 4FT4A 1QHGA 1JQ3A 3OG9A 3RSSA 1U3CA 4WJKB 3GBSA 4WT7A 3SYNA 1CUHA 1PKXA 3O1LA 2JLYA 2QE7D 1NT4A 2BDTA 1T2AA 3D4PA 5IAAA 3P71T 5KJ1A 1N2CE 2ZT7A 3SX4A 2OY0A 5IT0A 1W5AA 2OG1A 4BECA 4BFUA 1IXYA 3CKKA 2PUCA 4RL6A 4K6HA 1PQ4A 2HU8A 2EKLA 2PZBA 2Q5LA 1EE2A 3AB8A 1SELA 1XCBA 1G4AE 2GAIA 2Z5LA 4M60A 4BMOB 2ZTVA 4MQFA 4MYHA 5MFPA 2F3SA 4OH1A 3VPSA 2WWWA 4L8GA 4U2DA 1I4TD 1R5JA 1RKBA 1P61B 1RQNA 1T6BY 3RDPA 2POCA 1VCNA 2VQ3A 3OHMA 1UKYA 5D85A 1R8JA 2Q41A 3DKVA 3QXCA 1Y3AA 4BAZA 2D5LA 4XW2A 1G41A 1RAEA 2FLVA 5IASA 3TK1A 1SQ5A 5D3KA 5HTOA 1SC3A 1E3WB 3GMDA 1BMQA 3UMCA 1QHEA 4MVXA 5FA6A 1UWLA 5G2OA 2IPAB 1P73A 3F97A 2ZJFA 3U4IA 1X14A 4RKFA 3BMNA 1KDZA 4N0MA 2P0AA 2NUAB 1U7TA 2I4OA 4JEIA 2QTVA 4M98A 4MAFA 1Z22A 3L7MA 4EJSA 2DFNA 3CUWA 1C9NA 3G5AA 4CDNA 3O9ZA 4L02A 3QMPA 3ZD8A 4P7KA 3E22B 3QBDA 4JJIA 4J0GA 1PWHA 2J5BA 1V11B 5HQ3A 3OCYA 2XHEA 2GH1A 1I7NA 2B1RA 4V0KA 1VB5A 3HFJA 4JYAB 2OB2A 1GQRA 4ZZ1A 2DH5A 1DTEA 1KMMA 1U9IA 1X2EA 2B8JA 2Q1WA 3BC1A 2HQRA 1ESCA 2GK6A 3WX0A 3DOOA 4CIBA 1N8SA 1PVOA 3W7AA 1T1RA 2IEYA 4YWHA