1BDHA

Purine repressor mutant-hypoxanthine-palindromic operator complex
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
338
structure length
338
Chain Sequence
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Positively Charged Residue Bound in the Minor Groove Does not Alter the Bending of a DNA Duplex
pubmed rcsb
source organism Escherichia coli
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*AP*CP*GP*TP*TP*TP*GP*CP*GP*T
total genus 121
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1996-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1bdhA01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bdhA03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1bdhA02
5TQ2B 3O1IC 3HV2A 2JBAA 1QPZA 1X57A 5BR1A 2MYTA 1OCTC 3D02A 4I8TA 5JS2A 4H3KB 4X4HA 4Y42A 1LMB3 1A2OA 1FFSA 2W42A 2M98A 3HUTA 3N0XA 4MS3B 4B09A 3JXBC 3LUFA 2R63A 4NCAA 2JVKA 1D2AA 2HINA 4RKRA 5TQ0A 3TD9A 4EYGA 2FVYA 2A6CA 5C5EA 1OXKB 3CS3A 2A9RA 3QELB 1ZAYA 3NBMA 4IRXA 3EULA 4KZKA 3BDNA 3NNSA 1ZPQA 2FN8A 1R63A 3O21A 1VRVA 2MYUA 4Z0NA 6CHYA 3JTEA 1RPEL 4RY0A 4F3TA 1BVHA 4MRMB 4NCBA 4FB4A 1WH8A 2KEKA 4XASA 3F6CA 3GRCA 4RXMA 2CSFA 4M88A 2AUWA 3KYJB 2EBYA 3IP5A 3LTEA 3SNKA 1ZGGA 3QEMB 2OFYA 5K98B 1DBPA 1Z18A 5T7BA 3CZCA 3HDGA 4PZ0A 1POUA 4MQFA 3OM0A 1EWTA 1JX6A 1RZRD 2LYLA 5E3JA 5KQGA 4MR8A 2I6FA 2A9OA 2AWIA 3A10A 3MQ4A 3JPYA 1EFAA 2FMIA 3QF3A 1I3CA 4PICA 5DCLA 3EUSA 2R25B 1XHEA 3KCNA 2QXYA 1ZESA 2IDMA 2IYNA 2PL1A 3OLVA 4G97A 4WXMA 4N76A 5BRJA 1LQCA 2YHAA 5EWMA 4EYQA 3C6QA 3TRBA 2LYPA 3KLOA 4DN6A 2X7XA 4I6TA 5ED4A 2HSGA 1ZS4A 1JHZA 4UHKA 1WIZA 3OQOA 1YS6A 1JH9A 3M9WA 3C3MA 1A04A 3IP9A 2OENG 3MA0A 4ZJPA 2FQYA 2M1ZA 2LIVA 1D4ZA 1OSLA 1SQ8A 4YG4A 1DJMA 3LUCA 4X4CA 4Z5CA 1MB3A 1RIOA 3MMNA 4Q7EA 3OLYA 4KNYA 1DBQA 5A7LA 2QW1A 1P8AA 1GUBA 2GWRA 4YWHA 5KQLA 2EWTA 1TLFA 3MLFA 3KYIB 3Q7RA 1M5TA 1PHRA 1ZH4A 2PUGA 3LFPA 1USGA 1DCKA 2MYNA 2WUSR 2E4ZA 4YP9A 2JCGA 1LCCA 4NV3A 1CYEA 3B7HA 1DRKA 2GI4A 5TPZA 3H5IA 4N03A 2MQKA 2R1JL 2PIJA 1ABEA 5CNKA 2AXVA 3T38A 4EGSA 4OLBA 1PEAA 3IPAA 1DG9A 3VNAA 1ZZCA 1TJYA 3CG4A 4YGXB 5FWYA 1UXDA 3SCGA 2FTKE 1IIBA 2GZUA 1BDJA 4Z5HA 1NXTA 2QU7A 3HCWA 5HSGA 1JBEA 2CHFA 3UUGA 3IVPA 3LOPA 2QV0A 5IBQA 4YARA 3BRQA 3H5VA 3JXCL 3F51A 4RWEA 1YMVA 4Y9TA 4MS1B 3KG2A 4MCXA 2H3HA 3CFYA 3OO1A 4G0YA 2QVCA 3N53A 4RK0A 5BRAA 3DGEC 4JA2A 4JCXA 2L2QA 5KQPA 2ZWMA 3QLVC 1JFVA 2E4YA 4MCTA 2LYRA 3H5TA 3QYXA 2IPNA 3KHTA 4P1ZA 2FKAA 2IVQA 2L8NA 3M9XA 4G0OA 1DRJA 4EVQA 3N75A 2ID7A 2JVJA 2HQOA 2HQBA 1JDPA 3CLCA 3MIZA 2B4AA 3O75A 3LMKA 1YVUA 5JNWA 1QO0D 4JQDA 3QEMA 2JB9A 3H5WA 5TPWA 2WWVD 3IPCA 2EF8A 4W5RA 1ABFA 2JVLA 1JWLA 1U2QA 3RVNA 5DKFA 3UK0A 4P98A 4YBAA 3FMYA 3NNDA 3SY8A 3GL9A 3Q7TA 4ML3A 3LUDA 3VK0A 2R4QA 2PAFA 1ZITA 5HM6A 1JYEA 3EQ2A 4MR9A 1R8JA 1DW9A 4HNQA 1TMYA 2L18A 3FFWA 4YO7A 2H8RA 1U2PA 2IKSA 2LYQA 5IUNC 3QWGA 1Z13A 4O1HA 3K9CA 3W9SA 1XWWA 3CHYA 5KC9A 2GKGA 2PLNA 2PUEA 3QLVA 4H3HB 1E6KA 4G86A 3H75A 1EAYA 3QLUA 5CHYA 1ZDMA 2V0NA 2YHBA 4MYRA 1T34A 4LRQA 4N0PA 3SQNA 4XFKA 3QQ6A 4EYOA 2PMCA 2CWDA 2BGGA 4XARA 3QX9A 3T6KA 1EWVA 2GRLA 3HZIB 4KK3A 3RZZA 1DP4A 3ILYA 5GOTA 1LJLA 5B3JC 4MPTA 1P2FA 2VK2A 5TPZD 3OMWA 1DC7A 2FMFA 2NT4A 4QYWA 4Z4IA 2ICPA 1Z25A 3JXDL 3NHZA 4O8BA 3LUHA 3I5AA 2A9PA 3U3WA 2WB4A 4XAQA 1JLKA 1LK0A 3FMVA 2PUCA 2BJCA 2DRIA 2ID9A 2LP4Y 4GQMA 1BA2A 1E3OC 3OMTA 4Z4CA 1H9CA 1CQTA 1QO0A 4RY9A 3M6MD 2MSLA 4ETNA 3L49A 4JB2A 3HK2A 3D8UA 1OXBB 2LYJA 3ROTA 3RVPA 1O4XA 2HPHA 3ZHIA 4FBIA 2FEKA 2NZUG 2VUIB 4YRZA 3H1FA 5C5CA 2IPLA 4X4IA 1GCGA 1VKRA 3OQMA 1GLGA 1NATA 2L17A 1QP4A 4I6UA 2AYZA 3BREA 4G0XA 3OM1A 2RJOA 4PU8A 3FYMA 3C97A 1HEYA 1R69A 1RZSA 2PUAA 1ADRA 4MQEA 4MR7A 3RVOA 2IUOA 2LYSA 1U04A 4NDWA 1HF0A 1VLZA 4KVFA 4MS1A 2VYCA 1S8NA 3OO0A 3I45A 4YLEA 4IGAA 2JBAB 3DLBA 3HS3A 1K68A 4MGEA 5B3JA 3ZHMA 2P4UA 3L1PA 3F6PA 3LKVA 2AXZA 1DC8A 3G1WA 3HSYA 4GPAA 4RK4A 1YK0A 3FGZA 4RXUA 5JNUA 3JPWA 1J56A 4PU3C 1PRUA 1CJGA 3JS5A 4IA8A 1D5WA 1DBWA 2QR3A 4F8JA 1E6LA 2O49A 2LUOA 3EQZA 2FEWB 5IUKC 2P9HA 5IUJC 2O38A 1GCAA 1USIA 1ZZ9A 1Y7YA 3SM9A 2PPXA 3R1FA 2R48A 4LDZA 3PXPA 4IF4A 4RV5A 3A0RB 4RXTA 5T3YA 2WY2D 2QVGA 5TPWB 5IC5A 4EVRA 2XI8A 2JK1A 3RVKA 2CROA 2GRMA 3O1JC 3GN5A 1M2EA 3N0WA 3ZKCA 2FXIA 1P6QA 2IOYA 3QK7A 4KREA 3S99A 3HUUA 3KTOA 3OMXA 5DTEA 5CNJA 1NXWA 1U0SY 1C4WA 3H6HA 3ROFA 3MF4A 3O2SB 4RZSA 4TMYA 5KI6A 3SCHA 2KZ8A 2E4UA 3CLKA 1EWKA 2FMKA 4OLAA 4Z4EA 4RS3A 1GUDA 1PRAA 1AB5A 2CD7A 2IPAB 3KSMA 4RK1A 4WZZA 4CBVA 1PRVA 3GYBA 5JNRA 1LLIA 3RVSA 3OP9A 3C3WA 2OQRA 3DGFC 4WWHA 2PKXA 2MYPA 3O74A 4F12A 2WIUB 4F8DA 3GT7A 2H0AA 5FBKA 3H1GA 4MS4B 4QICA 2KEIA 1RNLA 3DZDA 3RVRA 2GX6A 4L85A 4UHJA 4DQDA 1RPJA 5I4CA 4WXEA 1JF8A 3R0JA 1P6UA 3N0RA 4IMIB 1ZY2A 3EODA 3LUKA 1ZZ7A 5PNTA 5IX8A 4PU7A 1UXCA 4Z4HA 1F51E 2NZVG 1PNRA 3FFTA 3DNVB 4FN3A 3GWGA 4MAAA 1WETA 3KS9A 5KWSA 6ABPA 3GBFA 4OBBA 2IV1A 3I09A 4W5QA 1FFGA 4J1WA 2JVIA 3E3MA 5TQ2A 1NY5A 2IPMA 3G5GA 3FDFA 1JL3A 2FMHA 1L5ZA 1ZHHA 4PU4C 4HNSA 4RSMA 3LFTA 1PNTA 1ZUGA 3LISA 1SRRA 4JCYA 1LBHA 2PJUA 4PE5B 3T8YA 4Z4GA 3CROL 2WJWA 5IEJA 2LYKA 1C0EA 3RQIA 1NERA 3SAJA 3H1EA 1Z26A 4KQCA 4L4UA 5TQ0B 1CEYA 2MEZA 1PEYA 2PE5A 2MSKA 4X4GA 1F4VA 4TLLB 1ISSA 1SXGA 4Q6WA 3BILA 3B2NA 4NQRA 1QKKA 1X2LA 4KV7A 4RY8A 3MYYA 3LKBA 2Q5CA 2BNMA 4G0QA 4MR7B 1L1MA 4MQEB 3T95A 4D74A 5FWYB 2WJAA 3F7NA 3E61A 1QQAA 1VPWA 4Z59A 1USKA 1JYFA 3O2QB 8ABPA 4Z9BA 3CKMA 4W5OA 3CRNA 2E4XA 2L19A 4PEVA 2GBPA 5EWJB 5JS1A 3CTPA 3P9YA 5GQSA 3RVQA 2J48A 1W9HA 2B1JA 2PL9A 1E2BA 1PUXA 2R47A 3H6GA 3Q41A 3RVJA 1Z2EA 3SCFA 4GNRA 4LE0A 4F11A 4XLTA 1YSEA 1MB0A 1LCDA 3JVDA 2KYRA 1ZN2A 3HVRA 1FQWA 1DWKA 4Z58A 1ISRA 1SD5A 4JOQA 5BQ3A 4F06A 3TX6A 1Z2DA 2AXUA 2RGYA 3Q9SA 5FWXA 5JNSA 3LUAA 1FFWA 4XXHA 4D6YA 4YR7A 4MR8B 4TN5A 4PYRA 3BRSA 4D6XA 3GN5B 1B0NA 5IULC 2IVGA 3HM9A 4Q6BA 5EWMB 5HKOA 5CNIA 1YK1A 3BS3A 3TB6A 2BNNA 1CHNA 1QMPA 2FW0A 2F8TA 4ZMSA 1WH6A 4IMJB 2L49A 4OTZA 3HZHA 3IP6A 2PUDA 4IWRA 1SXHA 3UKJA 4OB4A 1Y9QA 3K4HA 4YG7B 1ZGZA 2IU7A 5D2CA 5EWLB 1KRXA 1APBA 1YIOA 4LE1A 2WRZA 1ZZBA 2IVBA 3I42A 5TE9A 1BAPA 4G0MA 4YV7A 1ZZ6A 2FN9A 4ZMRA 2CHEA 1UTXA 3G7DA 1NXOA 3QEKA 4N0QA 5KC8A 2B5AA 3OLZA 2ICTA 4LDAA 3HEBA 1JDNA 3KXAA 5DLEA 4DADA 1TVMA 2AYXA 2HJ9A 4YCSA 3A3KA 4W5NA 4JP1A 1LJUA 3Q7SA 2PUBA 5JNVA 3JY6A 4RU1A 4IVZA 1W25A 3FFXA 2D5VA 3LUGA 3NNNA 2FSPA 2FJRA 1LBIA 1YS7A 3URMA 4X4EA 3N8IA 1Y1LA 1D1PA 2AW6A 2FLKA 4WT7A 1AB6A 4ETMA 9ABPA 5DGCA 4N41A 2TMYA 4ZYLA 2RJNA 3KKEA 1NXXA 3L6UA 4IILA 3HO1A 1QQBA 1Z16A 4ETIA 4OATA 1DCFA 2BNOA 2XDYA 4RK7A 1M2FA 1M5UA 5JNTA 1QP0A 3KZ3A 5ABPA 4OG2A 2LCVA 4RKQA 1XWRA 4GHJA 3GV0A 2KPJA 4MS3A 1Z15A 4KQ9A 1RXEA 3RH0A 4W5TA 4QPJC 4LX8A 4EVSA 3CECA 3RVMA 1JFTA 3QELA 1GT0C 1AU7A 1DZ3A 1YMUA 4NICA 3A0UA 2JRLA 1KRWA 4WUTA 1FSPA 1PERL 3O1HB 3MM4A 1JFSA 4EYKA 2E4VA 3N6VA 5HQJA 4G0ZA 4KPYA 1NXVA 3BBLA 2FLWA 3NHMA 4HNRA 1L5YA 4S04A 3S8QA 3FYAA 4FE4A 4MRMA 3HXMA 2O4AA 3QLTA 4H60A 4ZPJA 4RDCA 1YTUA 1KMIY 4YG1A 3H5LA 3KLNA 3QLUC 3TO5A 4I6RA 3VNBA 4FE7A 4EUKA 1NTRA 3D1NI 4Z5DA 3LUJA 4LE2A 2XSDC 3H5OA 3CU5A 4E7OA 3QX8A 5FWXB 4MR9B 5KQMA 2VUHB 1BDIA 3G85A 4JASB 4MQFB 1ZZ8A 4X4FA 4Z99A 2NUBA 1RZRA 5EWJA 3UFDA 1MIHA 4N47A 2XIUA 4S05A 2LPMA 1XHFA 1NXPA 4JAVC 2QSJA 4LZLA 4MLCA 1K66A 2OR1L 1TM2A 1Z17A 2O20A 4RK6A 1E6MA 3O9XA 4RK5A 3Q15C 2F8SA 4KK4A 2QZJA 2KEJA 4HYEA 5FBHA 1IC8A 4X4BA 2PUFA 3CG0A 4MLDA 3TMYA 4J1XA 5IEBA 3CNBA 3EDCA 2A9QA 3DBIA 3C3KA 5EWLA 3IP7A 1MAVA 1ZH2A 4KMRA 1QP7A 3SG0A 4TLMB 2MSWA 3OLXA 1URPA 4KRFA 4JB0A 1A0OA 1UDRA 1D1QA 1DCMA 3BD1A 3JVIA 5CNMA 5TQJA 1NXSA 3DLHA 3F73A 4QYMA 2LBPA 2E4WA 1BDHA 4G0PA 1RXIA 3HDVA 3RVLA 2HQRA 4MS4A 1B00A 2FQXA 4X4DA 3GA5A 3EAFA 3F6WA 3ILHA 4O1IA 5F64A 4KFCA 2XJ3A 1KGSA 2FQWA 3CZ5A 4E7PA 4Z9AA 1MVOA 1ZVVA 2RDMA 3O2JA 7ABPA 1U8TA 2WMYA 3HJFA 3F52A 1S7EA 1EHCA 3GBVA 4EY3A 3OQNA 1Z12A 1SXIA 2NT3A 3EJWA 3EGCA 3GBPA 3IDOA 4YS6A 1QNLA 2XCJA 3OLWA 4O5AA 2N9UA 1NEQA 3KJXA 2FEPA 2ZAYA 4Z4FA
chains in the Genus database with same CATH superfamily
3SEZA 4MYDA 5GM1A 2QX6A 2ODEA 2X13A 2Q21A 4EEKA 3F78A 3BAFA 4GOND 3P0JA 3U1BA 4WEQA 2M98A 2BFWA 2EX1A 2ONZA 3AL2A 4OHWA 2YVKA 4MS3B 3ZCUA 3JXBC 5HZMA 4OM7A 3C3XA 1U5AA 1UMBB 2LGJA 2FRDA 2QLTA 3CS3A 2QBYB 2JIRA 1APBA 1MJGM 3BZWA 4EB6B 1MAWA 1UQUA 2AD1A 2GN0A 3BFVA 4L0CA 3IDSA 3WI7A 2A0FA 1M8JA 3FKQA 5A4JA 3FTPA 4ZVRA 4RQUA 4H3SA 3VXKA 1RPEL 3OOWA 2JAOA 4XYMA 4MDEA 4KL8S 3GRCA 3O4RA 1P4AA 3OOEA 1TTPB 4MA4A 3C8HA 5I45A 4J0DA 4BLTA 1RRMA 2D8MA 3IUBA 2QMZA 3EG9A 5K98B 2FXVA 3EMVA 2HCBA 1V4BA 2PZMA 4ZZ2A 3PXCX 4KR9A 4LF5B 5JCXA 2O8DB 1SVSA 1JX6A 1NVVQ 5E9AA 1RZRD 5KQGA 1RZUA 3ZYZA 1XVAA 1PTKA 1FUEA 4B85A 1G2OA 4CKCA 4D25A 4XTRA 1OXMA 4QEDA 1GU7A 4PGFA 3UXEA 1JLLA 1OA0A 4MWCA 3ZWNA 4ZTUB 3DH0A 1XDSA 4WQMA 2XKBA 5CJ2A 5ALWA 3A05A 2WSLA 1U0OC 2IDMA 5JCPA 4DQUA 1F38A 5IPFA 2O3JA 1W93A 1RC8A 3CINA 4BDSA 2GFHA 1HE1C 5HZHA 1P6XA 4RFVA 2LTAA 2VJKA 1JXAA 3DTVB 3MBIA 4S1OA 2OXTA 4ETWA 5B2FA 2IS6A 1XIVA 2PL3A 2DWPA 4X9XA 1DKOA 1N5KA 3NUZA 1OB2A 1XVTA 2HSGA 4JXJA 1ZS4A 2WFAA 3QA3E 3AJDA 2WVGA 3IBGA 2G9NA 2B34A 4O4LF 3M8KA 4HBZA 3K7EA 4JBNA 4Y2YA 4C43A 4DR2B 2JFWA 2J0UA 3DJFA 3KEOA 2BIFA 2BGTA 1EA7A 1FS4A 1NVDA 4PYNA 5F23A 1TA9A 1WCXA 4P3NA 4Z5CA 1PS8A 3LPDA 1DDGA 1XTBA 2E5FA 3A1UA 5THQA 3K70C 2B6HA 2OBXA 4DA6A 5A7LA 3GF4A 1DI0A 4K6GA 2JZCA 2EWTA 2OOSA 3MLFA 3AFNA 4F96A 5ISMA 2PUGA 2V7BA 1P0QA 3ZJTA 2FPKA 4CV1A 5I47A 3H5IA 3QUAA 2BP7A 5G4KB 1ULAA 5L40A 2B0JA 1G8JA 2HNAA 4RCVA 3RFCA 2DUJA 1N8TA 3UENA 1EFCA 5LJLA 3L0IB 4UULA 1L5QA 5IVHA 3RC8A 1EWRA 4MI3A 5HSGA 4N65A 1XG5A 2GDJA 1QHIA 4TMVA 1VA5A 4U7TB 3DE2X 5IBQA 4EA9A 3LYHA 3LQXA 4FOLA 3R7WB 4ARIA 3W0LB 1L3BA 1L4UA 5HDBB 3C7TA 2XKAA 1WABA 1VIMA 2Q0HA 2Z2XA 4LYGA 4RULA 3PYLA 2C4NA 4LZPA 1F0PA 3U56A 3R3YA 2RK6A 4U2KA 3T7EA 4B4UA 2YY7A 3G2OA 1AX9A 4KXQA 3MB8A 4PBSA 3E7PA 3K9FC 3IE1A 4RC9A 4EI7A 1ZN8A 4P86A 4HPWA 5LP6C 4AG3A 4JI0B 2R79A 4I4TA 3QEBZ 2CNKA 2WVJA 4LQDA 4BZXA 5G3YA 2LKCA 5KYWB 3PITA 2ECFA 1KI7A 2C4TA 3TRFA 3CN9A 1WNFA 2M6LA 2QM0A 2HD4A 3WTCA 2OWDA 1F4PA 2E49A 4C7JA 4MUNA 1U2GC 2FKNA 4HGNA 3R9WA 2JGDA 3L5KA 4W5RA 5ECGC 1CUCA 2CNWA 3DZHA 3IT0A 1YZQA 2YIMA 2LVBA 2NAPA 3FI9A 4WK2B 1Q1NA 4CFSA 2NTNA 4N9QA 4QU5A 4DMHA 2JLRA 1OHHA 3R9IA 1L9XA 3MT8A 5IAJA 1XTIA 5J2TB 3DAYA 1L7XA 3ADBA 5JQGB 2B2NA 5BN3B 2I03A 3EF0A 3P9RA 4O4JB 4FFPA 4AY4A 5CB4F 4LNHA 4BHTA 5LP6A 2ZS8A 3CV3A 1O9GA 1PTJC 2AJLI 2J5KA 2DPGA 2QJRA 5ALSA 2NV6A 4AIIA 5DOVA 4BGEA 2Z56A 4C21A 4DXHA 3C0KA 2NTEA 3L7DA 4XR4A 5ADWA 1BEEA 1ZBQA 1LJ8A 1B14A 2EX0A 1H2XA 1Q15A 3DE1X 3IFSA 3AU8A 3QX9A 4D96A 1LDYA 3K71B 5ERGB 4RH3A 1JW9B 1N9ZA 3GGPA 5LDDC 4TYNA 3G0TA 2YYZA 3GY0A 2OXCA 5AJZA 3JWPA 4R2KA 4BVGA 2ZJ7A 1ULZA 3F3KA 4ZQBA 4HNUA 2WB2A 1C3LA 2HJVA 3NVDA 3VTFA 3LUHA 4Q4HB 4DM3A 2Q2QA 5JYBA 4IQ0A 2FZKA 2OCPA 2H65A 4DYHA 2EJBA 3DE5X 4XQ9A 2BHTA 3U7QB 4GQMA 1RHUA 3BJIC 3EEOA 1TRKA 1KKMA 3FF4A 5C51B 1L8QA 5EG5A 3WMEA 3GT4A 4TRNA 1H5QA 2CBGA 4DAEA 4EUNA 1HEIA 4M1KA 3ZI0A 2WE8A 4BVJA 4F4HA 5KKNB 5JJIA 4NYMR 2P9YA 4OXXA 1CUEA 5DDIP 4G8DA 1S02A 3PTLA 4IS3A 4KSYA 3VPBA 3D9QX 3ECAA 3TLKA 4ZJZA 2ZBEA 4DUPA 5TLSA 2XB2A 2AUNA 3MJHA 5KYYA 3IO5A 1YRQA 1ZC4A 4NCJA 4XH9B 1GQYA 1Z7WA 5HIJA 4I5DA 3H1BA 3DXYA 5FQOA 2J9ZB 2Q62A 1OFUX 3BORA 3EPRA 1VJ0A 3EY4A 3S28A 4EO4A 4G36A 1DCTA 2VNHA 5DHQA 4QDXA 4V0RA 2BCGY 4WK0B 3QNUA 5JNUA 4PU3C 4H6VA 5LYJA 1EVQA 1UQRA 1AV6A 3A6DA 1X92A 4INZA 2H51A 2O49A 3EQZA 4DCTA 1TO2E 1AC5A 2GUWA 2ZBUA 3CPHA 2Q6TA 3GLFE 2QG4A 4H31A 4HDCA 3GMSA 4GL4A 3A0RB 3NBXX 1VFPA 4J4BA 3B9BA 3A1EA 3WOHA 1ZYUA 3OZFA 1IEXA 3KQPA 4Y6LA 4Z3KA 1QV6A 4WCFB 5FBWB 4UUAA 2GRMA 1U2EA 2GO1A 4CI0B 2W58A 5JROA 1XEXA 2IIPA 3ZVMA 1QONA 5E6RB 4KWTA 5HKLA 1AV7A 1MBZA 4ATNA 1PVDA 2XWSA 2AJTA 1GFSA 2HR1A 3CVXA 3MWGA 4L5CA 5J63A 1WWKA 2QX4A 4OHOA 5KYGA 2VEOA 4CIWA 2OAGA 4UAUA 1JR3D 1V8DA 2V9PA 2C8LA 3VOAA 1O6ZA 4QJIA 2AJDA 2JIMA 1QWSA 1CDZA 4FYYA 5AKJA 5FNVB 5LMZA 3SIRA 2R8RA 3FN4A 2B5WA 4L3VA 3ZHYA 1G21E 2MYPA 1E5QA 1T24A 4F12A 1A77A 3OE1A 4MB0A 4EVIA 2M6KA 3HNRA 3M49A 4CL3A 1HYQA 2KHZA 2NP6A 3TTUA 3SP1A 1Q7TA 4BMCA 3BHNA 3SXUB 3COSA 3WGNA 1G7SA 1GPYA 3MPUA 1XA0A 2B7LA 3DOIA 5K09A 2AH5A 5GY7A 1MN6A 1N0IA 4ZQEA 3EIQA 4B4VA 4PGAA 3GFRA 4HSGA 3HA2A 2WUGA 4OV6B 3WDSA 5ALYA 3M3PA 4K9PA 5KYVA 3K0BA 3K1AB 5IXYA 3QV2A 5ESXA 2YICA 2Y6UA 1YR1A 5F4ZA 2GJSA 2F9LA 4G5FA 4Z1MA 3U4DA 1XN1A 4C2AA 1U7DA 5EP4A 3FUCA 3MGKA 2V0CA 5FUQA 1VSBA 2C07A 4OMUA 4JCYA 3FI0A 4JJ7A 1REQB 3O95A 3DE3X 1EFKA 3UGJA 5ALHA 1I32A 4GMHA 2IHJA 1ZRNA 2NYUA 1VBKA 2YMMA 3DHVA 3SAJA 1XTQA 1DTEA 3GGOA 1YR3A 2COKA 1KEKA 5A4DA 1J1IA 2GBLA 1IB6A 1ZWLA 2ZJ6A 4PLVA 1K86A 5BOVA 3WLSA 1Q44A 3U3MA 2AQ8A 1CLEA 3IA7A 1Q7CA 1HL3A 4ZEVA 3BGVA 2GPJA 1ZVMA 4G9GA 3G79A 5FI5A 3WGOA 3CKMA 2V3WA 1NZJA 3I01M 1ZFNA 2G1UA 4HZGA 3UAOA 2Z5FA 4NJEA 1QTIA 2CXPA 3S5JA 1LY1A 3CTPA 3OZBA 2D00A 4ENTA 3AOGA 2ZR9A 4LS3A 2VNAA 4H18A 2R5FA 2BFOA 3EVEA 2B1JA 1C3VA 3C6YA 4FD2A 5LYJB 2WHEA 1WVGA 1PL8A 3WE7A 5U4XA 1P77A 3NBZC 1T3HA 3OCXA 3K4PA 1K7FB 2G25A 3AR4A 2YXPX 4L8FA 4XLTA 5EYPA 4N5DA 4MUXA 3ONVA 5TQVA 3LC7O 4ZCLA 3DCYA 1BWRA 1ECGA 4JNCA 2P69A 5D51S 2E7ZA 2YMLA 3K0CC 3P4XA 3THYB 4CCSA 3T4PA 2XUZA 1FDSA 4QPPA 4YR7A 4I1YA 5FAXA 2H07A 3KOYA 4QNNA 1E62A 2GCOB 2VF7A 3FDZB 2ZRDA 5DBEX 5IULC 4F1WA 1TZCA 1V9CA 2IYFA 3T9EA 3WRXA 4BX8A 2A0WA 4R2HA 3VVMA 4NU8X 1ZM4A 3EMBA 4PONA 2ZDQA 2OBFA 3C15C 4Q9NA 2B2XA 4R6WA 2WJIA 4M0LA 1J0EA 5HQ3B 4ZYYA 3RYIA 2H1OA 4BUZA 1NPYA 2QR5A 5A0VA 1KO4A 1XK7A 4A8JC 2ZBVA 1I7QB 2J9FB 1XEAA 3AC0A 2F3QA 3LSTA 4G56A 3BWMA 1Y6RA 1CKEA 1YIOA 4JNKA 1NRWA 2OZLB 1LI7A 2HBZA 1BAPA 2PVPA 3LL7A 4MWGA 5CD1A 4YAWA 2DKOA 4BB5A 5H9VA 1UXOA 1DKPA 4LOLA 1DAFA 1N2XA 4RE6A 3INNA 4FT4A 4BGIA 2AJBA 3ZK7A 2FP4A 2AQIA 1CZHA 1TVMA 4TTJA 1KU0A 2PK3A 4BQFA 5EJ9A 1AKTA 4RGVA 1VXOA 3FWPA 4CN9A 1CUAA 2ID8A 3CY6A 4IO0A 1IQUA 3VFDA 3ZU6A 2B4TO 2RGWA 1NJ1A 3PPIA 1CQZA 1E64A 3F1KA 1XU7A 3IPRA 4JJFA 2FSHA 1I4DD 4MKIA 3BWDD 4W4TA 3GNQA 3X1KA 1ULHA 3ETHA 4INAA 1B2RA 4ESVA 1YBMA 1KIMA 2JS7A 4R41A 1WPQA 2NUPB 13PKA 2TMYA 3UFXB 3ZHUA 5CB4A 1P31A 2OC4A 2NYRA 3E8MA 4N54A 4NHOA 5CLIA 4I19A 2XUQA 4IILA 4Z3OA 5TNXA 2HBQA 3OH8A 3O4HA 3OHMA 2XDYA 1UPAA 1M2FA 1KI6A 4BO8A 5ABPA 3JWIA 3H1AA 5EJ6A 2UUPA 3EC7A 4ZGBA 2W6CX 4CTKA 4AW9A 5CEJA 3CR3C 2CCJA 1N7GA 2JD0A 5SZKB 3T34A 4EVSA 1I33A 1SQ0A 1JFTA 4ZHSA 4FS3A 4YFVA 3ZV5A 2IOFK 4MKFA 3ERCA 1WDLA 5LQKA 3WHIA 1G20B 1KAEA 5DWVA 3UIEA 3WGJA 3D0OA 2RB5A 2ZWPA 3PXDA 4XA8A 1LSSA 2D0PB 2V96A 4JB8A 4YJFA 4MRNA 1VB5A 2HMYB 3GQBB 3HXMA 3Q9LA 5ENDA 4G8BA 2O4AA 1OPXA 1C50A 2EF1A 2G82A 3Q40A 2XCQA 5DN6D 4XWYA 1EB9A 1KFKB 4EUKA 2CNOA 3QLUC 2NPOA 1LVHA 1R16A 2DFVA 3F8WA 4ALIA 4JT8A 4TSKA 1RCTE 1AURA 5FWXB 1T29A 4OHVA 3MC1A 1L3IA 4W9NA 5AK4A 3SJUA 1KA9H 4G26A 1J09A 3LXMA 1RKQA 4QXAA 2GPAA 4RTQA 1M73E 3ZWWA 3GT0A 1TU0A 4UAGA 3GEPA 1Z4MA 1ZI8A 1Y63A 3UHPA 3PFGA 1M6WA 3NPAA 4TZ0A 2XVXA 2HBYA 1H3EA 4YDQA 3SZ3A 4HAIA 2B4YA 2VAWA 4IFTA 4RK5A 5DNUA 2YXDA 3JD0A 1M1UA 1JMVA 4EPTA 4CF3A 4BO9A 1SOAA 1J7JA 4IZ6A 5KOHA 1J07A 3KXIA 4F5EA 1RKBA 3O7WA 2B2CA 1TD1A 4URYR 2P5SA 4LC9A 3WHKA 1E0SA 3GR6A 2VH1A 4EB3A 4LJ5A 2Q6KA 3MLBA 3P5BA 1DBVO 1B0UA 1VJTA 3C3JA 4Q4DA 4Z7OB 4D3DA 5HKKD 1D1TA 1VL0A 2FUKA 2CDNA 3IX7A 4N3AA 1G6HA 3E9DA 3GROA 3OIGA 4OQYA 4EDFA 9MHTA 3OAAD 3IUMA 5DM60 2CL7X 1SXJD 1XDUA 3KYBA 3Q72A 2E4WA 2PM8A 4ZU3A 4BJ6A 1BEZA 4KN6A 3T1TA 4MS4A 2X1VA 5CVEA 4CN8A 2EBWA 4C4XA 2O23A 4FEGA 2QF7A 1X1TA 1TJ4A 3TB4A 4ABTA 4TKUB 1NJFA 3KP1A 3DTTA 5EIWA 1JILA 2EFDB 2NO4A 2V6FA 1BDMA 1EFRD 4JVNA 3F52A 4OQZA 1GYPA 4ABYA 1ZA1A 6AT1A 5CDYA 3QY0A 1PQWA 1DWQA 1P5FA 1QNLA 2VTVA 4ZVMA 1T5IA 1QVZA 5BVHA 4V0ME 8GPBA 5MDHA 4WZ6A 3HV2A 3VVCA 3WB0A 1L5GB 1K9SA 2MYTA 3ZHQA 3BB1A 4KQ2A 1W2HA 1JV2B 3X0DA 2FGKA 1A2OA 1FFSA 5BURA 2IEDA 3N0XA 3IBSA 4XCQA 2P7HA 4WXRA 3ZWAA 2FZCA 1KK1A 4EYGA 5IJAA 3CSDA 2ZJ5A 3N74A 5ALTA 1X80A 1LW7A 5I48A 3EPPA 3U4GA 1CS4C 4AUNA 1LLCA 1E5XA 3G8YA 4MVJG 2P68A 1LD3A 3SSMA 1Q20A 4HLCA 4EPXA 1G4HA 1XTVA 2HKIA 2H5EA 1OX4A 1P7PA 1OU0A 1JGTA 3AINA 4MRMB 1TYBE 4QODA 2QEQA 2PXAA 3R0VA 4UDXX 4ASUA 2RGXA 2VPZA 2G71A 3BE8A 1E60A 4YA6A 5E6RA 4PTYA 2BSQA 2J3LA 4YALA 1TCVA 4V2IA 3DOCA 3SNKA 2BD0A 1AMNA 2VRCD 5MF6A 1RVDA 1Y1PA 1J25A 4LNAA 4P9NA 2MINB 5TT0A 3P0EA 3WL6A 2RB4A 4NS4A 4PLWA 4Z1MD 4CODB 4OB6A 5E3JA 5KCMA 4K0KB 5K8CA 3AF4A 2GETA 1TQHA 5EIHA 2R6DA 2ZRGA 2J9YB 3O5AA 5T67A 1G7RA 1NVBA 1XNJA 4UD2A 3QH4A 4FNAA 4KC0A 4Q48A 4PNZA 3OLVA 3M4XA 4OHYA 1ZESA 1WTAA 3HFGA 3PDHA 4I6EA 2DPHA 3V1MA 4CEHA 4I14A 3FJYA 4KUEA 4FCCA 4OAQA 2EP8A 4O63O 4PLHA 5TT1A 5LU8A 2HTEA 1K3FA 3SHQA 4ZU6X 5MHTA 1QYCA 1IVSA 5E0OA 3HJCA 3G9TA 1YJ8A 2YOHA 5AJXA 5ED4A 4B46A 2IXTA 2YINC 3BXZA 1CR2A 3CX8A 3PQ8A 4R7TA 4X54A 1B15A 2KS6A 2VDJA 1YQ9A 5CURA 2QTVB 3IIMA 1N92A 1M9NA 2LIVA 1NMQA 4J0EA 1OSLA 3B52X 3M89A 3SLRA 4X4CA 7GPBA 2CL0X 4C0HA 3Q8LA 2GM9A 2BFMA 1PV2A 3EGOA 3JTMA 2BGNA 1KARA 4WW0A 2X22A 2XTNA 5ALEA 1BMQA 3UK1A 4CQMB 4AM8A 1LGYA 3H2HA 3N5KA 3EZ6A 3ZWXA 1GFIA 3TSWA 1EM6A 4IJMA 2HT6A 2QN7A 2WV9A 2VJMA 2WNSA 3DBRA 2MQKA 1Q0UA 2PIJA 2XNDD 4MW2A 4RVUA 4AO7A 4DIUA 4RNDB 1OZHA 2FOIA 1ORDA 1YOVA 1D4OA 4IKEA 1PJQA 2MMGA 2ZI6A 1T2FA 4AYTA 1AF4A 1SH7A 1I0IA 3IUYA 3BGOS 1DAMA 4DLTA 1G2IA 2X2OA 3WWOA 3GPLA 4FW8A 4PAQA 4C06A 3G59A 4CL8A 5C1DA 2QUAA 4RTMA 2IOFA 5JWOA 2H9IA 3HCBA 3JXCL 3DT9A 1ECLA 1FSSA 4M83A 3PDIA 4ER7A 4PHGA 1GTMA 5BO5A 4D3XA 2FSVA 3GEHA 2FJPA 1YD7A 1LPAB 2H3HA 5FTKA 5L6MB 1LNSA 4FR5A 3HKEA 4OJQA 4QOGA 3QGMA 2X0KA 4XRRA 1QSGA 1N0UA 4MV8A 5LNK1 2F3RA 3W34A 2GEJA 1T6BY 2R4TA 3AR3A 4HDNB 4YB8A 1XTUA 4K26A 5CM8B 4YRSA 5J5AA 4XVQA 4MGKR 3N75A 4Y8VA 3NEJA 5KHOC 1NVWQ 2CYAA 2HQOA 1NIJA 4BNGA 2DWOA 3RC7A 2CYBA 3FOEC 1Z2NX 1E2EA 1MRNA 1NVMB 2A88A 2BGRA 2C5FA 4ZV9A 1QO0D 4YJ2B 1MC5A 3NMUF 4QASA 3H5WA 1H6AA 2LCQA 5EL0A 2WILA 2ZWVA 4II7A 3RR2A 1IEWA 2JGRA 1ZI6A 3QYFA 5ENVA 4H0FA 2NU9A 3DT8A 3OQIB 3CLRC 4FMDF 3KQKA 1C81A 2BFCA 2QP3A 1DEHA 2WJYA 4H7PA 3HNPA 4UXHA 4EGFA 3GX1A 4MR9A 3WGLA 5A02A 3UV3A 3DPSA 4AVYA 3MRVA 4G25A 2B5VA 2QPAA 3GFSA 2H8RA 4ZFNA 3EPLA 3OEEA 5PGMA 1WIWA 1GDTA 1IK6A 3TQRA 4TT3D 1JHQA 2B8TA 2ZWIA 3QLVA 3QE2A 4ON9A 2HRQA 3TXAA 3RS0A 5HF8A 1TDJA 4UOQA 4I1IA 4LRQA 1EUZA 3BH0A 1I2CA 2AF4C 3ORRA 2HSWA 1E1QA 5AXDA 2BGGA 2O19A 1CP2A 1GGKA 4F2HA 1OB5A 3YASA 2AFHE 3TRHA 2W2KA 4GOLD 4GG1A 3RZZA 1FS5A 2JDID 1PJLA 2FWJA 1WUHS 4X6UA 1DULA 1KK3A 4MPTA 1EQ2A 4AY6A 3KHKA 4LF6B 2P75A 3G2NA 3HKCB 4W82A 5K20A 2J85A 3LVRE 3A2MA 2GK3A 4F3NA 1E0JA 3GJ8A 2Y3IA 2VPYA 1G3MA 2ID9A 4E2ZA 2WPDA 4X8OA 1KJZA 4X6XA 4ZRDA 3GRPA 1JSRA 1LEHA 3NTXA 4K9RA 4L50A 4Z4CA 3UEOA 2ZSBA 4DS3A 4CCYA 5BWNA 3ADPA 2BRUC 1EFVA 1T0UA 5JU6A 5IYZA 1WJGA 1ZM2A 3SBOA 3QW4B 1NR7A 1ZICA 1W46A 3H1FA 1FLVA 1SOWA 1ZP6A 2AC7A 3VPSA 4B6QA 1HFJA 1DJPA 1N1GA 1SUAA 4JJ6A 1RZSA 3QVVA 4NMHA 3G2PA 1KY5A 4KNYA 2WEKA 5GAGi 4WKGA 2WU3A 2VJAA 2EDAA 2HPZA 3EWSA 1H66A 2ONYA 3TDMA 2W6MA 1R1DA 1R5JA 3L1PA 2VDWB 2VT7A 3B3GA 3F6BX 5C5IA 4N6NA 4YDHB 3K5HA 3HE3A 3N8DA 4D44A 1TCCA 1L4BA 3H2BA 3X43A 4EIWA 3EEFA 3Q0IA 1GPKA 1EE2A 2B3TA 1PZHA 3DEFA 1Z45A 2Y1KA 4PLZA 3CUKA 3RSZA 2YY6A 3I37X 1H2HA 3VR3D 3TFOA 1HNZB 4TRJA 5JPCA 4N18A 5EXTA 3ABZA 3I76A 3K8QA 1GG9A 2ANBA 3ORHA 2D5BA 1MC8A 5JFOA 1X8KA 1T2DA 4M9QA 1M2EA 2RHOA 5AKKA 5KNBD 3EGWA 3GLGA 3KFLA 3A06A 3HUUA 3ZTTA 4AQDA 3U48A 2JD1A 1PBTA 3BKXA 4RHYA 3ZIUA 1K0FA 3JD2A 5C5DA 3CXUA 4XEUA 1ID1A 1JVSA 3KVVA 3CNOA 1JKIA 4AJEA 2XB6A 5EVJA 4LHWA 3VM6A 4GMGA 3PTZA 1A50B 2HLPA 2Y1DA 4C9BA 2OM6A 3AZPA 4URHA 1PRVA 1NX9A 2EJWA 3UH0A 1LLIA 2GHQA 3C3WA 3FJ1A 3OOHA 1ILEA 3MTAA 3LM8A 2PR7A 3VZQA 4MQ4A 1T1JA 1ZD8A 3AI1A 5DMXA 1Z2AA 1MCZA 5FOUA 2CMFA 3ED1A 2WT8A 2YYYA 3NDIA 3ZPXA 1XX6A 2A0XA 1HQ1A 3DZDA 5DNAA 1UZMA 3LWZA 3NOQA 3IYLW 1OWMA 1NWHA 2XUKA 3MPOA 4IV5A 3WLJA 1JF8A 2JIZD 2LIPA 2Y77A 3PFFA 4DCSA 1M76A 3TZ6A 1EP2B 1VQ1A 4ZVPA 1QP8A 2X23A 3I3OA 1J8YF 2WA2A 3RK4A 3W8RA 5JMWA 2Z3VA 2AXEA 5REQA 4ZAWA 3RRYA 5EJMA 4RTPA 4KDCA 3K0KA 2P2GA 3O0DA 1A98A 4MSUA 4Q37A 1OXVA 2QSYA 4BLWA 5BYBA 3QOXA 1JHDA 4MW5A 3C48A 3H9QA 1XEFA 2VSXA 3LISA 1SJ9A 3W2TA 1E3JA 3PCTA 5FDFA 1KVRA 3GXBA 5GVSA 2JGNA 2OGUA 4GWKA 1W88A 1C9JA 1NZDA 1Z26A 2MEZA 1L5HB 1KZ4A 4L95C 5JVDF 3LO5A 5K0LA 2RIRA 4M2LA 2QJWA 3BILA 3R0IA 4QYIA 1TQ8A 4RY8A 2V65A 3ER6A 2Q5CA 2D1SA 2OO5C 3ZDFA 2YIDA 4MR7B 1W4RA 3HYLA 1YB7A 4HS9A 1USKA 2IY7A 3NOOA 4F56A 1W35A 3EK2A 4ZZIA 5HIKA 5K1ZA 1IUKA 1L5MA 2IIVA 2GNPA 3D4NA 1Z39A 2JIQA 3ACCA 1CS0A 2YMPA 3B8HA 3LC2O 2VHXA 3NVKI 4ZGWA 2OFXA 3UW1A 3W5IA 1D03A 2GD6A 2VT2A 3K70B 4TRMA 2OFFA 3SCFA 2DQZA 5KTTA 3X1DA 4E33A 4HT3B 4QJ4A 5MN6A 1VMIA 2EP5A 2JC3A 3HXLA 3TFQA 2A78A 3LBAA 3MJ4A 2YYAA 2F8MA 4Y2SA 1SVWA 1ZCZA 3T4EA 4AMYA 4AQYB 1T9KA 3ZJUA 3SX0A 4LSWA 2YOGA 1UFKA 3VI4B 2RC6A 4XXHA 1ZCAA 3FUUA 4E31A 1WY5A 1WOYA 2ZXUA 5EIBC 2GEDA 4UE6A 1SVLA 3PRYA 2OCLA 1OREA 4INPA 1V41E 1ODIA 2XT0A 2E82A 4FFRA 4QM6A 5IT9A 3WB9A 1U0HC 1UP6A 2YZ7A 2FW0A 3LHKA 4IJKA 1PJZA 5KWIA 3FCSB 1CZOA 4CEJB 4I2NA 4BLQA 5F77A 3OTIA 1EP9A 1J1ZA 1TEHA 3L0SA 4URUR 5C1OA 1B1AA 2GM4A 1J2TA 5EJ8A 1LW6E 4X1OA 1LLQA 3AX6A 1HDCA 1FX1A 5B6JA 3K4HA 3M34A 3O31A 4UHBA 4ZEXA 5KWEA 1DAHA 2OFPA 3LT0A 5TY0A 2VQEB 1FVOA 3I1FA 2FN9A 5LP6B 2VT6A 3KEFA 1E8DA 3QF7A 4AN1A 1RHQA 5C8XA 2PXXA 1W5FA 3QPUA 1IBCA 4JOBA 4WSOA 2B5AA 5JWRA 5B2ZA 4NBRA 1XGKA 3W79A 1RQ7A 2GD1O 2Y9MB 3OPQA 4MQBA 4NYIR 2ZIZA 3CR8A 3ADCA 4YAOA 3TECE 2XF8A 3PEUA 5JNVA 1HYGA 4BASA 4LXXA 4B6FA 4CQMD 5EJEA 2WKSA 3FFXA 5FA5A 1X6VA 3LUGA 3ZZ1A 4QZVA 4D4MA 4M98A 3L18A 4J0GA 2PWYA 4LYAA 1JDJA 1CQJB 2FSPA 2FJRA 1FPQA 1JAXA 1Q12A 1UINA 2IXEA 3DBLA 3IB3A 4IDCA 5ETJA 2P78A 1Z37A 3HVKA 4LQ4A 1YB2A 4H15A 4DXDA 9ABPA 4Q4HA 2UZIR 1LBEA 2YYSA 5IT5A 1K6IA 1ZZEA 2JFOA 4LNUA 4MARA 5CK4A 3VR5D 5IBCA 1TB4A 4R9RA 1JHAA 4MLPA 4ETIA 2NNWB 3EUEA 3LQFA 4XGRA 1LDGA 2P3QA 1M5UA 2FW1A 5K3FB 4IQ8A 3PF8A 3WIUA 3RUIA 4QLOA 2ZEJA 3WWYA 3T3NA 3OKZA 2QOEA 1ZJWA 4YJ3F 5DLQC 4TL8A 3GLTA 3OEED 1CJSA 1I6KA 2X5OA 4JUAA 4EHFA 2FFQA 1RI2A 2ADOA 3QI2A 1GCUA 3RTEA 3U81A 3KD3A 3CECA 3ITEA 1ONSA 1NOIA 1F2UA 3PHJA 4YRTA 5FV7A 4TZKA 5HJ2A 1P4SA 1LC0A 3AVTA 3EH1A 2AW5A 1QX4A 2IEIA 4RFSA 3ENQA 1CLUA 5DHAA 1ONOA 5CT4A 5HE8A 3SN6A 1EJBA 2V7VA 2ZJ2A 2UYCA 3GLHE 1NLMA 2ZTHA 3E0XA 5CH8A 3W3ZB 4DNXA 4DRYA 3S8QA 1V26A 2AG5A 1J6UA 1TFRA 3OE7D 4W8OA 3UGKA 1I36A 1KMIY 3KLNA 3UMMA 3BVPA 3L4KA 3I4FA 4Z5DA 3QU4A 2QRUA 3BHIA 2YHUA 3FPSA 3HY3A 3CU5A 1W48A 2QTRA 2R44A 1ONNA 4I9NA 3L6DA 3WMGA 4EJSA 2ZBFA 3G85A 1QQ5A 4TMWA 5AJYA 2GN9A 5KTNA 3QJGA 5FFMA 4QVIA 3B3QA 1QUEA 3PXEA 4OQPA 5K8UA 4KO1S 2XDAA 3UFDA 3TEJA 4EG6A 4R84A 1WV0A 1LPOA 1Q0RA 4K9SA 4AF7A 1G8SA 1Y9DA 3EZNA 3H2ZA 4LJ7A 4FT2A 4LZLA 1K66A 1O08A 3K9WA 2PNJA 5AHOA 3PFBA 3AF2A 5M29A 1NJ2A 5FTNA 5JDIA 4J0KA 5ICCA 3LRTA 5DGXA 1NTOA 1HDRA 1IN5A 1N5DA 4ENUA 2Q7DA 3ZE7A 3B3AA 3FCXA 4M49A 2NXJA 3UMBA 2PXKA 4KIWA 3F2IA 3GEGA 3R9XA 4EG4A 1OWOA 2N46A 4A8PA 1G3IA 2AHRA 4RETA 1JU9A 4E5SA 1Y37A 5CM9C 4EHDA 5CNMA 3K4QA 3RVDA 3AHIA 2PQ0A 1U63A 1MX5A 3I9MA 5AWFC 3MRSA 4EPYA 1W8IA 4FBGA 4X64B 3WR5A 4DCPA 3L7OA 3QOYA 4J1TC 1GT91 4OLJA 4BLVA 3TEPA 4BMPB 4QJ5A 3NBYC 2HLHA 1E4YA 4J16A 4JXKA 1YZHA 3BFKA 2BJVA 2LXNA 2GPTA 1HA3A 1UT6A 1NA5A 2Q5FA 1G8GA 4C5AA 1J33A 1H1TA 1M2JA 4LMRA 4YS6A 2CJYA 4H4EA 5KOIA 1IEQA 2OD7A 2PWZA 4HAVA 3QI7A 4RA6B 4MI6A 5L7YA 1IEVA 4B2IA 4DNOA 3B85A 4A4DA 1DBIA 1X57A 3EGIA 2UYOA 4MUIA 4F92B 4MYTA 2QVXX 1E2PA 4UKDA 4DV2B 1ZSVA 3HXKA 3I2JA 2PBLA 2X0JA 5FBQB 4QT4A 5DP2A 4B09A 1XD2A 4A6PA 4BKPA 2FWIA 1VE9A 3O4JA 2F2TA 1EVYA 2PEYA 1OXKB 2XQJA 1YULA 1MT3A 4RVHA 5AXAA 3ZG6A 3W78A 3L1HA 4W7IA 3Q85A 3TLYA 4RV4A 2AN5A 2AFHA 1ML4A 4FR2A 1JMYA 4WEOA 4MXDA 4Z9XA 3QUCA 3HLKA 5I9TA 1EA5A 2JIZA 1S6YA 2ZJYA 1FNMA 1QBKC 2EV9A 4ZU1X 2R62A 1CUFA 3NVMB 3MMXA 2ZJAA 4DLLA 3NOVA 1UBRS 1T5LA 4EENA 1XROA 2NX2A 2V5VA 1OFGA 3Q3CA 4IG4A 1KO1A 4J4TA 1W30A 3C8MA 4AMZA 5I9SA 5BQFA 2A5JA 2QD1A 2QENA 3HRIA 1LX6A 4W8GA 5E6UB 1XL0A 1X8JA 2VG8A 2ZDHA 1AGRA 3C98A 4G2TA 3TLJA 3KTFA 4BKRA 4EYEA 3F97A 4LUCA 4UBJA 2GTHA 2O3SA 4P22A 1KXZA 4MR8A 1Y33E 4YVFA 4F46A 2MOKA 3GXOA 2PL1A 2PYZA 3JZIA 3OD1A 5EAIA 5H4HA 5LUAA 5BRJA 4LSGA 2YHAA 3AFHA 2CMHA 3FR7A 1K98A 2I6SA 5BNZA 4MX8A 1OJ7A 4P81A 1C30B 4GX1A 4HAXA 3AY3A 4IDFA 3EH2A 1ONPA 5B55A 1AQYA 2Z95A 4NXNB 3GFVA 4FFBB 2XOXA 3ESXA 5CAEB 4HFNA 3R75A 3VZCA 5KSZA 1BE6A 1K6XA 1K06A 1MO2A 1PGPA 1N2JA 4IGIA 4LCBA 5DM4A 1O94C 2V4UA 2P9GA 2XNKA 3RYIB 5IJ0B 3OE5A 3B5IA 2NVUA 4G0UA 2QRPA 3AO0B 3MMNA 5EJGA 3NANA 3N2NA 3ZQUA 1BN7A 1F20A 1NI4A 2HQ1A 1JDTA 1LPSA 1M1YE 1U8XX 1MU0A 3RJMA 3IP3A 1PHRA 4KXYA 4DTCA 5JD3A 1K8RA 4DKXA 1H9AA 1Q95A 2F59A 2KMLA 2WAXA 5GONB 3ZKAA 3PS9A 4N03A 3OAAA 4OLBA 1GNSA 3F5SA 1W76A 2IDKA 2ZJOA 3D0KA 4UBOA 4EHKA 1VHQA 4LQCA 1V4VA 4Z0PA 4MCJA 1NPTO 3CNQS 1N77A 1N7IA 4H7JA 5EHGA 2XIQA 1D1SA 1TYZA 4JWTA 2DHEA 3TLCA 1FSGA 4OK6A 2ZYIA 3NHWA 3R5FA 4HTFA 4BP9A 1Z0JA 3DEZA 1NW8A 2AFRA 3DWFA 1Q2UA 3KAPA 3LY5A 4HDSB 5ILQA 3GT3A 2G4CA 1ISGA 3C6KA 3I2HA 1SU8A 5E1MA 1DRWA 1Z5ZA 3D3WB 2PGJA 3KT8A 3NH6A 3SQMA 5CG2A 2HYIC 1A9PA 3HB1A 2J3JA 4NXMB 2LNDA 2AA3A 3FAKA 1KOFA 2TECE 4MS1B 3VJMA 2ZI4A 3LQKA 1MHPA 3CTMA 3IVGA 5AOBA 3HR7A 3MWYW 1COZA 3ZCRA 3QLVC 1NQ5A 1VE3A 2E4YA 3K2EA 1WM1A 1J5EB 2QRQA 3KKPA 1Z3IX 1NY6A 2FKAA 1XZDA 1R4AA 4MWEA 4W5WA 2IWRA 3UCEA 2ORED 2L8NA 3NALA 2R7NA 1ZXLA 1OBVA 2C1ZA 4G0OA 5CEFA 1QTRA 4R0MA 4FWTA 3FHTA 3A9ZA 1DV1A 2ID7A 3C7AA 5JLJA 4MVJD 4DWWA 2PT7A 4DM7A 3L8YA 4KN8A 1H94A 3KD2A 3OZCA 3QVTA 4HNVA 1CF2O 1E9AA 2R6GA 1PQ4A 2QLMA 3G1UA 2XH8A 1YR6A 3JVUA 3RVNA 4LSMA 3KTAB 2YNMA 1L8LA 2BEKA 4KN9S 3CUVA 5FOWA 3F7TA 2H8KA 3HCRA 4EKDA 1DLJA 1HZZA 4P4SB 2PAFA 3FVTA 3GRRA 3DV2A 3FLAA 1BWPA 4MW0A 1W7AA 5EGNA 2QMYA 2ZWOA 4N0DA 1S1CA 4J3FA 1PZGA 1R15A 2QM3A 1I94B 2Q5HA 3W9SA 1BDBA 1J06A 3G7NA 3VR5A 1GIAA 1SC1A 1IZ9A 5HJEA 3N0TA 4Z7QB 3N76A 4UM9D 2EATA 2JCXA 3GEDA 2XT9A 3QQ6A 1G18A 3AZOA 2WIGA 2D4HA 4OH7A 4XARA 4JI2B 4WZBE 4ALNA 5FEUA 3I34X 3E2PA 3SKVA 3OIUA 1QRRA 1W36B 3ZWBA 3AHHA 5IBRA 3RCBA 1U4NA 4O2RA 4GUAA 3H0EA 5B3JC 3TQHA 2VK2A 4L07A 5TPZD 3F4BA 3CRVA 3NO4A 2YY5A 3Q6NA 2O1XA 1K8ZB 3ZVNA 1AH2A 1OJLA 3NR2A 3NHSA 1BYUA 1IUPA 2UDPA 3U44A 2FDCA 4OHBA 3BDAA 2NU8B 4EUFA 2RSLA 3U3WA 1TYEB 4MA5A 3GGSA 1J49A 4M76B 2MR5A 4REOA 5F78A 3UAVA 3OT1B 4Z54A 5HFAA 2PPLA 3AHDA 1KJWA 2BP7B 2P2NA 4UVHA 5G4KA 3TDKA 3DDHA 2EP7A 4WXPA 4II2A 4A6XA 1HQDA 3NQ41 4WCDA 5HEKA 4TMKA 3UMCA 1P7ZA 4RPHA 4C87A 3I32A 4YP7A 4I8IA 1AN0A 2Z4SA 3U1TA 1DTWA 1JB1A 1SUDA 3Q12A 3ZJ4A 2IPLA 1C7JA 4H1WA 3OFNA 1UT8A 1I6MA 3M2PA 2DTDA 3OJCA 3TG2A 1PV4A 1ZOOA 1PWXA 2QTWB 4FD3A 1OIVA 5CTAA 4ZO7A 4JQYA 4E08A 4MQEA 1YS1X 2XCUA 4ARSA 1TK3A 2IZZA 1UEIA 5DX0A 4MS1A 4UNRA 5FWYA 4NE7A 3ZBUA 1L1EA 2EVWX 4ZCPA 2QPLA 4YRAA 1OX5A 1UAGA 3TSAA 1RJ9B 3UM9A 3PTAA 1IUNA 4X1YA 2Q4EA 5ILGA 3CW9A 1EX7A 4J2TA 1RS0A 5AM0A 3L46A 2PVCA 1IWBB 3IKVA 4KE9A 4S2EA 3PQ6A 1DPGA 4DF3A 3IAXA 2J3HA 3LSYA 4BAUA 1EM8A 4HL6A 3MINB 2O38A 4OA8A 4UHDA 3W2GA 3U09A 3BCSA 4LDZA 1BS2A 4Q1CA 5AW2A 2JGDB 3W4IA 4DLKA 4OUDA 1EEHA 4DEYA 1U9IA 2FOLA 3UMFA 4BTEA 4LFBB 2NSYA 4EVRA 5DT9A 3M1AA 1DOAA 1OILA 3SHVA 1ZN7A 2O05A 4G8JA 4EHLA 1QIKA 2FEOA 2IEYA 3QVKA 4KJZA 5ERXA 1YBHA 1KYTA 3E5HA 4HGYA 4UPDA 1CV2A 3BXOA 4AUEA 5BNFA 2HGSA 3DV0B 2W5UA 3I9LA 3Q6MA 4FXOA 2VDQB 4D4GA 1YVPA 5IKXA 2YUTA 2Y6VA 4ARAA 3AY7A 2XHZA 2X40A 3INYA 2WHRA 2ZBRA 3HBLA 1ZUIA 1VB3A 3D1JA 3GP3A 3KVYA 2PSEA 4HJXA 5E7JA 3VR2A 3C41J 4D8TA 4DLPA 3A2NA 1F5SA 2XMDA 4WWHA 1WXXA 2QMHA 4JGBA 4R16A 1JG2A 2KI5A 3QKWA 2V5UA 4CG2A 2ZREA 1O97D 4I9GA 1XK6A 1Y6GA 1GWNA 1PU2A 3P20A 3NP9A 3T5PA 1UBCA 1HFWA 3PJFA 1NJGA 1IDN1 4LCJA 3RVRA 3TI7A 2EFEB 2IKQA 5K45A 2G0NA 3UW3A 1KEEB 1NBMD 4IMIB 1ORRA 1NRIA 4PU7A 2DQSA 3LHDA 3QUQA 2P6NA 4CKEB 3LYUA 3U44B 3GWGA 3N2GB 2WWFA 4OL9A 2A0KA 1JG3A 2XRFA 3ESRA 1XF1A 1Y8AA 4GNKA 4F1JA 2IV1A 5HS6A 2IUUA 1OT5A 3WYAA 3DD1A 10MHA 5KX5A 8ATCA 5E3HA 1X1CA 2FMHA 3UKDA 1QDUA 4QULA 2VHYA 4BFUA 1Z4QA 1TW3A 2DX7A 2NUPA 2P9ZA 2GYVA 3OX2A 5L3SB 3A6KA 3ZQ4A 3KJNA 1H2WA 3WA7A 1P2UA 1YRYE 1TRHA 3QWIA 3OA2A 4LYDA 1F4VA 2IPOA 4R1OA 3D1LA 3F1LA 4Y2HA 1Z9BA 2HYDA 4NHEA 3RU7A 3H2SA 4GKBA 3GZDC 4BTLA 4L72A 1W85B 1D6NA 1MAUA 2J9RA 1TM3E 2RHGB 2Z6AA 2WJAA 1IN1A 1IZ0A 1QQAA 3EGDB 1U8CB 1W2WB 2VJCA 4IDOA 4J2HA 2JK0A 5TB5A 3RE1A 3I2FA 3AG5A 3STWA 3TWOA 4CUJA 2E4XA 2G9QA 4P4GA 2GBPA 5EWJB 1JG1A 1DAGA 3S2YA 3TD6A 4IHKA 4ND5A 4XR9A 4X71A 4QGBA 3NFYA 4IJ5A 2ZJ0A 1UR5A 5HM8A 221PA 2A4MA 4X92A 3SEFA 1DHRA 1PUXA 2R47A 3H6GA 4CTMA 1XJWA 3C6MA 4LZZA 2GPYA 4DYVA 2ZUEA 3B1VA 1T8WA 1U94A 2GF0A 1Q2XA 4TWZA 5F7ZA 4P53A 3OM9A 1QORA 3I12A 4IDEA 4WZBB 1OSNA 4UHEA 4CDRA 2W4IA 1UKVY 3M1YA 2UZ4A 2GILA 3PUIA 3ZCTA 1QHEA 2HCNA 1XLTC 4LXHA 3GLHB 2VZ0A 3W7AA 4J7CA 1YJ5A 1US8B 2IVGA 2GNAA 2HSDA 1U5BB 3GNLA 5FB3A 3DCIA 3R44A 4AZ0B 3MXOA 2PX2A 1NVVR 2EHDA 3TB6A 1YVDA 1DXOA 2PJDA 3A9TA 1CHNA 3PVCA 4O2BB 1QJCA 1FX0A 1DRVA 3L7BA 4DWOA 1BU8A 3WDMA 2TMGA 3MTEA 2M6SA 1EJ2A 3SYTA 5A04A 4HGQA 2OILA 2ORVA 3PA8A 2NN3C 2A35A 4COOA 4YCJA 3RUCA 5DTIA 1BX3A 1UOEA 3AJEA 3NCHA 1WZ2A 1Y9QA 1P1KA 2I54A 4LOAA 4U7DA 5CFRA 1T0JB 1KRXA 2HPVA 3FF1A 4F6LA 3OQBA 1OV6A 2ODQA 4D46A 2UXCB 3SZUA 1V1RB 1G3QA 3MELA 2XWQA 3SGLA 1EFTA 1N6KA 5AVOA 2WV7A 2ZITA 4RPJA 2O59A 4DT1A 2RHRA 1E9CA 5EJ4A 5K6RA 5AYVA 3QEKA 1VI5A 1VPTA 2PT6A 4LXGA 4ZVVA 2QQ5A 4B48A 4YLYA 2V03A 3H9EO 5A9SA 1N2ZA 3DZFA 4P3KA 4Y1EA 1Y98A 1NULA 1LJUA 1PT7A 4NWIA 5E7QA 3VU0A 1FDTA 2ZSAA 1U3CA 3MLEA 4FOSA 4UQPA 3ZY5A 5H8WA 1B6RA 2VJOA 2WJ6A 3VH4A 1GKYA 3ZDYB 3PUKA 4Z0HO 3ICQB 3QZUA 4ZREA 3VWSA 3NWJA 3R7WA 5DRYA 2J3QA 5FPKA 2P6MA 4O4IB 5D01A 5FRDA 3UF0A 4BNHA 2HFZA 1RQXA 4KUHA 3FNIA 1XPOA 2FK7A 5ARDA 3RNLA 2QKYA 4FHZA 2D5CA 3PI7A 3SBDA 5KMGA 3UWOA 1SAYA 3TCXB 3D2LA 1H05A 5T57A 2QX9A 2G1KA 3PE6A 5MN4A 4Y2RA 4DA7A 3DL7A 3JZDA 2JGFA 4HVCA 3BOSA 2W2XA 1NF8A 2DM6A 1DEOA 1CT9A 1U98A 3IAS1 1X1RA 1D2RA 3ETDA 1EB8A 3KPYA 1CUJA 2VA9A 3EGDA 3ETCA 4UXIA 2ZT7A 3RRZA 1Z8DA 2JRLA 4IIJF 4R68A 4EZEA 4LGMA 4E6EA 4GLLA 2QZZA 3HGMA 1K97A 3B82A 4LEIA 1DUVG 3R40A 5BY2A 4KPYA 4B7XA 4HNRA 1NX6A 3FWNA 3QXCA 3L7KA 1UMKA 1ZRMA 4PZLA 4EPRA 4YJHA 4EGJA 2O8VA 2WSYB 3KTAA 1ZHOA 1SQSA 1BGVA 3ESAA 5CW2A 3TXXA 4KR7A 5KQMA 1YTUA 2DUNA 1NTRA 2CKMA 3HYRA 1FXWF 3ANMA 1R88A 2WT9A 3HUEA 3Q1LA 3V2GA 2I4OA 2RBGA 3EFHA 3ABSB 1YCFA 1IWOA 1KNQA 2DH5A 4D41A 1T9ZA 5FUMA 5DNDA 5FA8A 3VGJA 2QAJA 2RKWA 5A3RA 5IXJA 1ZH0A 2DT5A 2YV1A 3E22B 4PNPA 1N33B 2LPMA 4TMTA 1KO8A 2O14A 3VR4H 2BELA 2DY1A 2Q8QA 4UASA 5K0BA 2ZIXA 1II8B 1TM2A 3ABQB 1A8IA 1CQIA 3G8DA 3HL0A 3RHTA 4BJ5A 1F7VA 4F8YA 4NVRA 1LTQA 1E20A 3FNFA 5FFNA 4ZOCA 1CRWG 4CCAA 4OQMA 5TGDA 3V8VA 4ZQHA 4EQ6A 1DS6A 1SY7A 2BGMA 1QZXA 1JZTA 1JXMA 3HRHA 4KRFA 4GT1A 1DAIA 4I99A 4UVIA 1H1LA 1DG1G 2FZ5A 4HYYA 1DCMA 3DC7A 4DYDA 2J3MA 3RANA 3H11B 5BSHA 5JC8A 2G88A 5AJVB 4GUDA 4MO9A 3HZRA 4MROA 4AP9A 5BXQC 2VP3A 5LNK6 3KL2A 3TIFA 2QGZA 4FX5A 1YNOA 2C9YA 5G0VA 2CNDA 2DYKA 2HREA 2VOEA 1AXRA 3MJSA 3UBTA 4GR4A 2VJMB 1QIGA 3G68A 3B6JA 4G5OA 4E32A 2YHIB 1S7EA 4NOLA 5SZJA 4B9EA 1DNPA 1CD5A 2CUKA 4OJNA 3UFXA 2JZNA 2PX6A 1ZJZA 1NEQA 1RZ3A 3BMCB 3RIEA 2LRHA 2QM7A 3P0HA 5AW6A 4NCNA 3X1YA 1AKWA 1BS9A 4YBZA 4D5EA 4Z86A 1P2BA 4N3NA 1KEUA 3E4DA 5JAUA 2XLBA 3MERA 1SU7A 1ZK4A 3H42B 4HUTA 4GOJA 1V25A 1KQGA 1B6TA 3S2EA 1D2AA 3FPAA 1AMOA 4O2AB 4C01A 5ALMA 4IDDA 4POAA 2FPRA 1UC4B 4N0MA 4A2CA 3AU9A 1DQRA 3C4VA 1Y6ZA 3E9EA 4LY3A 4BFSA 3MCVA 4RHTA 5K4GA 3AB8A 1CUDA 3O26A 4S3MA 4BRSA 1FQOA 5F1YA 3X1JA 1WW8A 1LX7A 2R86A 2W4MA 4JKYA 1X7XA 1HE3A 2PZJA 4GPBA 4PC7A 4LPKA 3PICA 3PRKE 4PIVA 4RTJA 1YJCA 4QUIA 3C3BA 3PXGA 2C9DA 5FYDA 1YZLA 3FMIA 4OY3A 2OYCA 3BIFA 3F47A 1O94A 4NJMA 1XEXB 1V39A 4BCCA 1LS6A 1WF6A 2C7RA 3RKSA 3GVXA 1FJXA 3LTEA 2AMFA 2QRVA 2YRWA 3G2LA 1ZGGA 3QEMB 2IZ7A 4PQRA 4JEIA 2O2CA 1KORA 4KACA 2MT9A 1H6CA 5CMLA 1VSVA 4ND6A 16PKA 1TC2A 2JEZA 1ZU5A 3NTQA 2ZUDA 3FZNA 2KW5A 3S8YA 1U3VA 2H5JA 4QUGA 4A3SA 3HN2A 1H93A 3D2BA 5KWJA 2BGUA 2V0GA 5FPHA 3IIKA 3RJTA 4OGWA 4MVXA 4HB0A 4G97A 4WHMA 3TKAA 2PDAA 1IHOA 3KJIA 1B4DA 1UMCB 1RYNA 4ZI5A 4L2IB 3SZGA 2JLUA 1RACA 4TWAA 1E6EA 3RLIA 3HABA 1YKFA 2BFBA 1IY8A 4LVCA 4C4OA 2I4MA 1TLTA 2B94A 4K2HA 5KNCD 5HRUA 2O8EB 4CV2A 1DB3A 1T6ZA 3P2KA 2DUUA 1F3LA 1DKQA 2Y68A 3OY7A 1WIZA 3MVEA 4ZJPA 1FU4A 4Y30A 1A04A 4N7JA 2WTBA 2IITA 4CM4A 1MW9X 2DPLA 4WY8A 2R6FA 1L2TA 4PRYA 4TKMA 4TSRA 2MSDB 2AWOA 2GGSA 3DR5A 4QFCA 4IV8A 4M0CA 3UJ8A 4FMCB 1DBQA 5AHWA 3LQ1A 3CJTA 1XF9A 2EZTA 4Z7NB 1SXJA 3E9MA 1NF9A 4PINA 1Q83A 3GFBA 3ZEAA 1SQ6A 4X1IB 3SFTA 4C0QC 3WQHA 4K9KA 2Q41A 1RM3A 4FHEA 1BMDA 2BI4A 3C45A 1ZJ4A 2IUEA 2W6JD 3DL0A 4PYOA 5E9QA 2VHVA 1H2AS 1GPDG 3AUXA 3V7YA 4UTRA 1W85A 4BN4A 3JQQA 1BS1A 2CLLB 1JE1A 3CIOA 2ODBA 4H4CA 4QE3A 2PX0A 3V5NA 1KI2A 2RGCA 2R8OA 2I6GA 3DC2A 3T0IA 3ZYCA 1R4NB 4HAYA 3Q98A 2P0YA 4F5WA 1JEYA 2GMWA 4ARZA 2XYQA 3HDHA 2FPGA 1V3UA 3CEMA 4H1UA 4B75A 3RAPR 2JA2A 5D87A 1DAPA 3OUZA 1W52X 3AM5A 1TCUA 3NTUA 1C1HA 4ZOLB 3WRXC 2C2ZA 4JJGA 4UCWA 1JKJA 1WNTA 3RS5A 1N5OX 2DQYA 3QF4B 4NATA 4Z5XA 3BT7A 3ENVA 4RD3A 1NW9B 2IPNA 3MK31 3S4YA 3V4ZA 4OQXA 4QUJA 5EUMA 5J2TF 5HZGA 1G3RA 1OX4B 3B1YA 5ALOA 3G0DA 1F2UB 1BN6A 1U5CA 4QOJA 1XTKA 5DCYA 4BVBA 4Y9RA 4AZ0A 2AOWA 2KB0A 1GKLA 4I4CA 4RHXA 4Y2TA 2P0EA 5BT9A 1U6KA 1Q74A 5F1OA 4M7PA 1G9XA 2QN2A 3PHHA 3E9NA 5CLHA 4WJKB 3SYRA 3ZXYA 4AN0A 4DV4B 1UANA 4O33A 1U2QA 2JVLA 2BFAA 5ER9A 3RF7A 3WRYA 5KQSA 4AB1A 3BMOA 3QWFA 3KJZA 3NUGA 3SY8A 1B26A 2Z08A 2UYGA 4WLEA 3EBOA 1VLLA 4HUQA 2ECOA 4NMWA 3H87A 4R05A 4ENQA 1R50A 2AR7A 3VRHA 5DBHX 4B0OA 4QXPA 2G67A 3JQ7B 1GSHA 2BISA 3AYXB 5E2IA 3TNLA 1JHXA 2E85A 4KOEC 4EF6A 2IKSA 4JLAA 1O96B 4H1TA 4EKGA 1Z13A 2AKAB 5K0CA 2FRVA 1K88A 3ORFA 1QK3A 4AUKA 3PGA1 1WKBA 4Q4LA 3SQXA 2ZJ1A 1PT8A 3G3EA 4B3FX 1N2BA 1ECCA 1KZ1A 1TZBA 2VXBA 1E79D 1LTHR 1E2KA 1NYRA 3EMDA 3F4LA 3P9IA 4J43A 3KQUA 3JQCA 4NBVA 2C0CA 2P67A 1C3OA 2XSZD 1O6FA 3SSNA 1KU6A 2XE8A 2D1TA 3DO5A 3KDPA 5FORA 1MOPA 3CF6R 4BYMA 1ZSNA 2AYYA 1P2FA 2XUAA 4R1PA 1TO1E 3GDGA 1PLKA 1DFGA 4JI8B 2P1RA 4XPIA 4BMNA 5TVGA 1B6GA 5CCBA 3TF5A 2AL7A 2QJFA 3DMTA 1LK0A 4U6QA 2DRIA 4PAOA 2XEDA 1BA2A 2HSEA 1Z2OX 4FCWA 4KTVE 3REFA 4GPZA 1UL1X 3RNOA 3WIOA 1T35A 3B78A 2YWFA 4GPEA 4X84A 1J22A 1Z35A 3KJEA 4GVPA 6REQA 2P3LA 5EGSA 1ZJ5A 2ZJ4A 1XQYA 3G2KA 5IT4A 5F5LA 3B20A 3FMGA 1DO8A 3UMYA 3UTCA 1XZGA 3U4AA 5K5EA 3EA5A 1A5AB 2PSJA 1QM5A 3GJYA 1QP4A 4LOIA 1NLYA 2WVHA 2XMBA 4K1LA 2R6HA 4ZD6A 3CVWA 2YQZA 3LBNA 4MK4A 1ADRA 4HY3A 3TPCA 1P9WA 1A8HA 4NDWA 3ZQKA 2MDTA 4XX0A 3GQBA 1N78A 3L07A 2JASA 4YROA 2F43B 3WGKA 3WKDA 2P7IA 2IHKA 5IT0A 5B3JA 2REQB 3IIJA 2PQMA 7AT1A 4LN1A 2QSZA 5DYIA 1LBTA 3INTA 3VPCA 4J0JA 1KJJA 1VJRA 4OFXA 2CFIA 3V8EA 1M0WA 1FP6A 2PUVA 4K8RB 3LFHA 1GZ3A 2FZVA 4IYRA 4CM3A 1INLA 1N7JA 2WTEA 3WC4A 2P9HA 2BI7A 2YWRA 4OI0A 3PFWO 1WZEA 2FX3A 5KKAA 4B84A 4V3BA 3TDNA 5ITVA 4PXSA 4U2BA 4RV5A 4YJ2A 3D54D 3MCWA 5I9NA 1XMQB 3HY6A 2IL1A 1SA0B 3GBSA 3IOCA 2XUGA 4HNAB 5TPWB 3A9RA 3TSOA 4E07A 3U3OA 4UM8B 3JWEA 1KZGB 5JUWA 4Q3DA 1DQNA 1UJ5A 1FQJA 1SB8A 1S3IA 2AQHA 1OY1A 2BMJA 1D6SA 2BKVA 2W2OA 3AB7A 5D5HA 3WL7A 1U0SY 3BD9A 1WUYA 1JALA 2FR1A 2AF3C 1RXYA 5LLSA 3VU8A 4BVKA 4F3YA 4XSVA 4EQ6B 2VRBA 1W4ZA 4JJZA 1W4AA 5FYQA 1PRAA 4CMKA 3E82A 3EXHB 1YCDA 2H1HA 4IUDS 3PEYA 3T3MB 1M34E 5CLQA 3G17A 3B2EA 2D13A 1BRTA 1NF3A 2R87A 4NAVA 4C0JA 3TSCA 3V7WA 4POOA 1MNQA 2Z2JA 4BFXA 2HWUA 4HH1A 3IAEA 4G4JA 4V02A 2X0RA 2W2KB 2V54A 1RPJA 4C3ZA 1XZJA 1E3WA 3LW7A 1O95A 2W6IA 3B1FA 5DIFA 1U9ZA 3LUKA 1Q19A 1EX9A 4D8YA 1ZXBA 1E3MA 4Z4HA 2I6QA 4DJDC 2JDIA 3KUDA 4IDPA 3CLUD 4E4TA 2EKQA 4ZO4A 2J6BA 2O57A 2NZXA 4G1UC 4HEA1 4JJEA 1F6DA 1EDEA 1WETA 4IXWA 4B35A 3I8SA 5A4AA 5KNCH 1Y8QB 4A15A 3LHSA 2EOAA 3VPFA 1FXWA 4W5QA 4FEEA 3C6XA 1ADYA 1ZGAA 4RCZA 1COWD 1I3OA 3N3BC 5KAPA 1JVNA 1OBOA 1JL3A 3FDFA 3OE7A 4XZ3A 3WK9A 4PYIA 2EJVA 4MZDA 4U6NA 4OMDA 4H35A 4DCVA 3T8YA 4YJKA 2LYKA 3RQIA 1NERA 1H2FA 2Y2VA 2Q5IA 4Y0NA 1QB8A 1OLXB 2AXPA 2PTGA 2SECE 2XMRA 4TLLB 3GDWA 1FF9A 3T94A 2Z2KA 4C6SA 2VFAA 5FPPA 3I2IA 1W44A 4W63A 2L42A 1NBIA 2OHVA 3RGWS 2TYSB 1MW8X 3EPHA 1DGQA 4B3HA 4MQUA 4LJKA 4WFKA 1UOOA 1CE8B 2UZ1A 4LAFA 3ZCPA 5A4MS 4RMNA 1QS0B 2JFYA 1H2BA 5FOSA 2DE0X 2IYLD 3DXZA 1XJ5A 3A4YA 1Y3HA 3OTQA 5F7OA 2B30A 1DRUA 4AKIA 3DE4X 2C4MA 4OBMA 5TMEA 4MVJA 3TEMA 4YT4A 3D81A 4Q4AA 4BWFB 3L1UA 4H27A 3DEAA 2C7QA 5BSTA 3PFHA 4O29A 1NG1A 3ZH9B 1LCDA 3WNBA 1MZPA 1P45A 3NAZA 4O3FA 5HK8A 2HIMA 4JI3B 4B6GA 2J5RA 5JANA 2Q2NA 2AXUA 1QFXA 5G0SA 1EHIA 5DI3A 1O94D 1WDWB 3O92A 3ZNNA 2CSXA 4D6YA 2VQSA 3SKXA 3KZCA 3OY2A 4LRUA 4XKJA 4WLUA 1ZNQO 3HFSA 3BCRA 3GVCA 4HMOA 4PAWA 3FBWA 4BKUA 1YK1A 1ZD5A 4QDJA 5CH5A 3R8FA 3MTBA 4DJJA 5IJZA 5E6SB 4BWVA 1WVIA 5B4TA 2FNAA 2HA4A 2K7FA 3QFHA 4UTOA 1LLDA 2RONA 2GK4A 1AN9A 1C7FA 3PC4A 2PNFA 5H3CA 4BL5A 4E14A 5GZ1A 4EA8A 1C0KA 2L49A 3K20A 5EHQA 4JVMA 4PYMA 1Z7EA 4NY1A 3ANTA 4OB4A 4UNSA 4CQLB 1W0JD 1DWUA 2WF6A 4FZVA 2FHPA 1OC2A 5I7AA 2H8GA 3Q5GA 1W0CA 4D9NA 3BMNB 3NX4A 4KI0A 1L5RA 4R2WA 5EKDA 3ZY2A 4CHTA 4LRWA 3PUZA 3KOOA 1NW4A 2CLMB 2O7SA 3JZFA 3R1IA 4OXIA 2X4DA 1YI1A 2PYDA 2Q0SA 4XX1A 5FBLB 3NLLA 3KOMA 4O3MA 2O54A 1HX7A 4E2WA 4OU5A 1SKMA 2HO5A 3UAZA 4RJIA 5KC8A 1TTTA 1A5SB 1SHZA 5AVUA 3P0IA 5FQNA 1JJVA 4LPSA 1G4UR 4M3NA 2ZSDA 5DBOA 5JMPA 3LECA 2ZSKA 3Q7SA 4D79A 1PP4A 5B1SA 1W25A 4UQOA 1CUWA 2H29A 3R5XA 2D6FA 3I9KA 3CQ9A 3KELA 1J8VA 4AZ3B 4TM7A 2GJ8A 1U8AA 5JXIA 2P4SA 3L8HA 5TF0A 1K5HA 1ADFA 4DA9A 4F7WA 1ZBDA 1XYVA 2PUWA 4AFNA 2H4WA 4E2FA 4HVLA 1U2DC 1JHVA 2RJNA 2V6GA 3HYNA 1IHUA 1E2GA 4I55F 4IBOA 1ZW1A 2WIFA 4R81A 3K8ZA 5EXSA 3W3AH 4EL0A 5LZ7A 1EDOA 1AMUA 4XD7A 2ZIGA 2Y8EA 3L84A 1K5GA 1WUTA 1JKJB 2P9FA 5KJCA 4P5EA 4JUFA 2YXNA 4ROSA 1EUCB 4GHJA 2OMKA 5LP1A 4MS3A 4ZZ0A 4IIXA 2CVQA 3B51X 3PNOA 4X8LA 1CUZA 5CYFA 2I22A 1UMBA 2IRWA 1RHKA 1YMUA 3DZJA 3JALA 4MW7A 3RRFA 4BNJA 4WLOA 4Q2JA 4YUYA 1A72A 1BJTA 3BZBA 2LV8A 1YO6A 1SG0A 1XLUA 4UREA 4ZC1A 5JSZA 1ACLA 2ES4A 1AHPA 2A1TS 3CPSA 3TTSA 1P1IA 1ZM7A 1SKYB 2A58A 1O1YA 1NMXA 4ILKA 5A4KA 1DAEA 1U2DA 3FR8A 4WFIA 1M2OA 3S7TA 4Q3OA 1FFAA 2RGBA 3BTVA 1CEQA 5T6BA 3S2FA 2R97A 3TFWA 3VAAA 3AJ9A 2YCBA 3B60A 4GR9A 4TXNA 2FOXA 4JLMA 1ECBA 5J3JA 3ILXA 1CZNA 3D6JA 5LBIA 5HRCA 3GCGA 1ORWA 1MXFA 1N8NA 2QZPA 4YXFA 1S8OA 3MIIA 2UAGA 4HFMA 3L1KA 4MW6A 4BO4A 2B4RO 4LF4B 1Z17A 3GLUA 1ZOPA 3MFQA 4O2LA 4PCAA 1I2BA 5BUSA 4KHZA 3FD8A 3JD1A 1T3LA 4KK4A 2RK4A 4MPPA 4ZI3A 3UC5A 4NDAA 1XRQA 1IC8A 4X4BA 1BW9B 4QDUA 3V00A 5BNTA 2CT8A 1PL6A 3ZGLA 3C3KA 3NG1A 5B4VA 2D0OB 3L0PA 3OTOB 5LC1A 3K3PA 4LVUA 1AHNA 1BCRA 1YB5A 3AEYA 1AZWA 4KMRA 5T4HA 5LLDA 1VKNA 2PD4A 3ANLA 4QATA 5JXHA 4CEIA 1F1BA 4H08A 5AVWA 1FUUA 4REQA 5FNVA 3U16A 5A9TA 4EJSC 2X3YA 4F93B 4LFAB 2O6HA 5IMBA 1JPJA 3GNSA 4B74A 1RXIA 2GUGA 3I0ZA 3VR4D 3NUQA 4C0SA 3AW8A 4DCGA 4WAUA 2YVAA 3KQWA 4NCKA 1NBEA 1ESNA 4E7PA 1K8XB 1QBGA 2HY7A 3FSGA 3QVUA 2LR0A 5F5NA 3IPXA 1ZVVA 4AT1A 5TIIA 3L7LA 4WZAE 4ZYVA 2O8CB 2CFRA 4L7VA 1QFJA 1N5MA 3A6JA 3EZYA 1FSZA 2ZRCA 3GRZA 1QH8A 1RWMA 1S7GA 1Z12A 4LJ6A 4B8ZA 4F60A 4TXJA 1VZ3A 2ONKA 5BSWA 2IYNA 5JZBA 3TIXB 1X14A 4LNUB 4DPLA 2ZRKA 3L4EA 4EMBA 5JCZA 5HFJA 5A7HA 4G5YA 4B6EA 1OCTC 1OPRA 2REQA 3MNFA 4CT0A 1P0PA 4Y6RA 3ECCA 1Z4JA 4Q7JB 1N2IA 3LUFA 4QBTA 2CF5A 3AVQA 3AEKB 1TFUA 1WHTB 3N8NA 3OJEA 2FVYA 3TKYA 4DWVA 3ZHVA 3GCXA 1M72A 2A9RA 1V16B 3DYIA 2G0AA 1ZAYA 3IV7A 4IRXA 4O4IF 3KR0A 1Z28A 4RD4A 4RFSB 1U7OA 3KOXA 1QQ7A 5A0FA 4M0KA 2WYIA 3HLTA 4NU6A 4W1PA 4Z0NA 4D0RA 2JA1A 2ZPAA 1C9DB 1K4KA 1W5EA 3Q9NA 1YUNA 4FMBB 3EXEB 5CFQA 4HN4B 4B3TB 3UJDA 4WBSA 1IMOA 1ZINA 3O4IA 1XPUA 1KMHA 1KHHA 1QCYA 1TAQA 3QU5A 4HAZA 2RKBA 2HWKA 4JJIA 1WLYA 1ZMTA 2BUCA 2MJLA 2BE9A 4FIZA 2PXEA 2X15A 4Z8YA 3MILA 4MV0A 5EESA 1FUIA 2BUBA 1PFQA 4RSGA 1RI5A 4XJXA 4CKBB 2XYVA 4WACA 1KK2A 4JYPA 3ZD8A 3JQDA 4X45A 4GVLA 5BYKA 5J47A 3PRHA 4MPJA 4YRFA 1E9DA 4P80A 1RYDA 3M6IA 5IH7A 3UGTA 1Z82A 5K3AA 5K8LA 1JAHA 5DISB 1E1QD 2NU6A 2YJ4A 4A8TA 4MO2A 2R25B 3KCNA 5ALPA 4FMPA 4PR3A 2JGMA 2PZEA 3IPYA 2ZQZA 2WUDA 5COAA 1UWKA 4DJTA 3I62A 1BJKA 1XWIA 3C6QA 3IT3A 2WBLC 3LJKA 2AOTA 1G64A 2JI6A 3ZV3A 2GK6A 4P93A 3SZLA 3ZX5A 1FFHA 4AG5A 1XCBA 3DVLA 4WA8A 3KB6A 2P0AA 2F3UA 5AVJA 4ILEA 3I73A 3HKDB 4Q4CA 4I08A 4CFZA 5F9MA 4ZZ1A 3TEFA 4YCLA 3B5JA 3U3ZA 3OLYA 1XRJA 2XR1A 3AEUB 5DLPA 5KQLA 1BFKA 4OKNA 5DXAA 3AEQA 5DEOA 2AC2A 2NU8A 3PLAE 3FCOA 1E63A 2ONCA 1NFRA 4WKCA 5AVYA 1WF3A 1HT2E 2CLDX 1N5RA 4FSDA 4FWIB 2HXGA 3T5DA 1FMFA 1U7TA 2IOQA 2PRSA 1IG3A 3IPAA 4D97A 1CXZA 1HWYA 3RASA 3THWA 3SCGA 1TA4A 1JU3A 3KK0A 4MICA 1IIBA 1P1JA 4MI9A 1ZVJA 3S29A 5IMSA 2I76A 1I7PA 2DVMA 3QMWA 1F9EA 3UUGA 1UADA 4HRAA 3IBCA 1IXRC 4P08A 3UA3A 3PR3A 1G6KA 2WKRA 3BL5A 3FVRA 3PV0A 1XPRA 1QHYA 2C96A 2VH2A 2W6PA 3NYIA 1THZA 1YMVA 2SKEA 3A6FA 2ZE7A 3RS3A 1RRVA 3AZQA 2JHFA 5U4QA 2GDZA 4BP8A 5KDDA 3CFYA 1P33A 4C89A 3N7TA 2BSAA 4ZVOA 5I01A 2QG9A 3DE6X 1SG9A 3QRWA 5LOVF 2QVZX 4KBYA 3RF6A 4ARVA 1XTPA 1CUBA 4PPGA 3ELWA 3B38A 2BTEA 4QQ8A 5DSTA 4DIKA 4X3CA 5DB4A 1AT1A 2EKLA 3W7VA 4EVQA 4R3NA 3VHQA 1KVTA 1KO7A 1NLFA 2DUMA 2I5PO 2JVJA 2RI6A