1BDTA

Wild type gene-regulating protein arc/dna complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
52
structure length
52
Chain Sequence
MKGMSKMPQFNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Origins of DNA-binding specificity: role of protein contacts with the DNA backbone.
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*TP*AP*TP*AP*GP*TP*AP*GP*AP*GP*TP*GP*CP*TP*TP*CP*T
total genus 16
structure length 52
sequence length 52
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03869 Arc Arc-like DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1bdtA00
2CPGA 1MYKA 1QTGA 1BAZA 1U9PA 2AY0A 2JXGA 1PARA 2CADA 2HZAA 2BSQE 2HZVA 1P94A 2WVDA 2CAXA 1ARQA 2K29A 2WVBA 2K5JA 2H1OE 1MNTA 1X93A 2BJ1A 2BJ7A 2K9IA 2BA3A 2JXIA 3VEBA 1BDTA 1BDVA 2WVFA 2BJ3A 2WVEA 2K6LA 1MYLA 2KELA 2GPEA 3H87C 2RBFA 1B01A 1NLAA 1B28A 3FMTA 2WVCA 2BNWA 2CA9A 4HV0A 2BJ8A 3VW4A 4ME7E 4FXEA 3VEAA 3FT7A 1EA4A 1IRQA 1ARRA 3GXQA 3QOQA 1Q5VA 2BNZA 2K1OA 3OD2A 2BJ9A 2JXHA 3LGHA 2CAJA 4D8JA
chains in the Genus database with same CATH superfamily
1U9PA 2Q2KA 2JXGA 4QPXA 2K29A 2WVBA 1X93A 3VEBA 2JBVA 2K6LA 1MYLA 2KELA 4MJWA 1NLAA 1SIWA 3FMTA 1SH2A 4NRUA 4ME7E 4FXEA 3QOQA 2KKEA 3IR7A 3NAHA 1MYKA 1SH0A 2AY0A 2WVDA 2UUWA 2BJ1A 2BJ7A 2BA3A 4NRTA 3BSOA 2B43A 2WVFA 2H3AA 2WK4A 2GPEA 3H87C 1B01A 4LRVA 2BNWA 2CA9A 2BJ8A 3VW4A 4O4RA 1EA4A 2KOEA 3UQSA 2K1OA 3SFGA 2BJ9A 3LGHA 2BSQE 2CPGA 1QTGA 1PARA 1SH3A 4LQ3A 1Q16A 3NNEA 1BDTA 3H5XA 1BDVA 2BJ3A 2WVEA 3UPFA 2RBFA 3LJPA 4LQ9A 1B28A 1OG7A 3G5OA 3QIDA 4HV0A 1ARRA 3GXQA 2JXHA 2CAJA 3VEAA 2AN7A 2HZVA 1BAZA 3BSNA 2CADA 2HZAA 1P94A 3UR0A 2ADLA 2CAXA 1ARQA 2K5JA 2H1OE 1MNTA 2K9IA 4AAIA 2JXIA 2WVCA 3NAIA 3NO7A 2CKWA 1OHNA 3FT7A 1IRQA 2UUTA 1Q5VA 3H5YA 2BNZA 3OD2A 3SFUA 2A2BA 4D8JA
chains in the Genus database with same CATH topology
2CPGA 1MYKA 1QTGA 1BAZA 1U9PA 2AY0A 2JXGA 1PARA 2CADA 2HZAA 2BSQE 2HZVA 1P94A 2WVDA 2CAXA 1ARQA 2K29A 2WVBA 2K5JA 2H1OE 1MNTA 1X93A 2BJ1A 2BJ7A 2K9IA 2BA3A 2JXIA 3VEBA 1BDTA 1BDVA 2WVFA 2BJ3A 2WVEA 2K6LA 1MYLA 2KELA 2GPEA 3H87C 2RBFA 1B01A 1NLAA 1B28A 3FMTA 2WVCA 2BNWA 2CA9A 4HV0A 2BJ8A 3VW4A 4ME7E 4FXEA 3VEAA 3FT7A 1EA4A 1IRQA 1ARRA 3GXQA 3QOQA 1Q5VA 2BNZA 2K1OA 3OD2A 2BJ9A 2JXHA 3LGHA 2CAJA 4D8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPG A;  1MYK A;  1QTG A;  1BAZ A;  1U9P A;  2AY0 A;  2JXG A;  1PAR A;  2CAD A;  2HZA A;  2BSQ E;  2HZV A;  1P94 A;  2WVD A;  2CAX A;  1ARQ A;  2K29 A;  2WVB A;  2K5J A;  2H1O E;  1MNT A;  1X93 A;  2BJ1 A;  2BJ7 A;  2K9I A;  2BA3 A;  2JXI A;  3VEB A;  1BDT A;  1BDV A;  2WVF A;  2BJ3 A;  2WVE A;  2K6L A;  1MYL A;  2KEL A;  2GPE A;  3H87 C;  2RBF A;  1B01 A;  1NLA A;  1B28 A;  3FMT A;  2WVC A;  2BNW A;  2CA9 A;  4HV0 A;  2BJ8 A;  3VW4 A;  4ME7 E;  4FXE A;  3VEA A;  3FT7 A;  1EA4 A;  1IRQ A;  1ARR A;  3GXQ A;  3QOQ A;  1Q5V A;  2BNZ A;  2K1O A;  3OD2 A;  2BJ9 A;  2JXH A;  3LGH A;  2CAJ A;  4D8J A; 
#chains in the Genus database with same CATH topology
 1U9P A;  2Q2K A;  2JXG A;  4QPX A;  2K29 A;  2WVB A;  1X93 A;  3VEB A;  2JBV A;  2K6L A;  1MYL A;  2KEL A;  4MJW A;  1NLA A;  1SIW A;  3FMT A;  1SH2 A;  4NRU A;  4ME7 E;  4FXE A;  3QOQ A;  2KKE A;  3IR7 A;  3NAH A;  1MYK A;  1SH0 A;  2AY0 A;  2WVD A;  2UUW A;  2BJ1 A;  2BJ7 A;  2BA3 A;  4NRT A;  3BSO A;  2B43 A;  2WVF A;  2H3A A;  2WK4 A;  2GPE A;  3H87 C;  1B01 A;  4LRV A;  2BNW A;  2CA9 A;  2BJ8 A;  3VW4 A;  4O4R A;  1EA4 A;  2KOE A;  3UQS A;  2K1O A;  3SFG A;  2BJ9 A;  3LGH A;  2BSQ E;  2CPG A;  1QTG A;  1PAR A;  1SH3 A;  4LQ3 A;  1Q16 A;  3NNE A;  1BDT A;  3H5X A;  1BDV A;  2BJ3 A;  2WVE A;  3UPF A;  2RBF A;  3LJP A;  4LQ9 A;  1B28 A;  1OG7 A;  3G5O A;  3QID A;  4HV0 A;  1ARR A;  3GXQ A;  2JXH A;  2CAJ A;  3VEA A;  2AN7 A;  2HZV A;  1BAZ A;  3BSN A;  2CAD A;  2HZA A;  1P94 A;  3UR0 A;  2ADL A;  2CAX A;  1ARQ A;  2K5J A;  2H1O E;  1MNT A;  2K9I A;  4AAI A;  2JXI A;  2WVC A;  3NAI A;  3NO7 A;  2CKW A;  1OHN A;  3FT7 A;  1IRQ A;  2UUT A;  1Q5V A;  3H5Y A;  2BNZ A;  3OD2 A;  3SFU A;  2A2B A;  4D8J A; 
#chains in the Genus database with same CATH homology
 2CPG A;  1MYK A;  1QTG A;  1BAZ A;  1U9P A;  2AY0 A;  2JXG A;  1PAR A;  2CAD A;  2HZA A;  2BSQ E;  2HZV A;  1P94 A;  2WVD A;  2CAX A;  1ARQ A;  2K29 A;  2WVB A;  2K5J A;  2H1O E;  1MNT A;  1X93 A;  2BJ1 A;  2BJ7 A;  2K9I A;  2BA3 A;  2JXI A;  3VEB A;  1BDT A;  1BDV A;  2WVF A;  2BJ3 A;  2WVE A;  2K6L A;  1MYL A;  2KEL A;  2GPE A;  3H87 C;  2RBF A;  1B01 A;  1NLA A;  1B28 A;  3FMT A;  2WVC A;  2BNW A;  2CA9 A;  4HV0 A;  2BJ8 A;  3VW4 A;  4ME7 E;  4FXE A;  3VEA A;  3FT7 A;  1EA4 A;  1IRQ A;  1ARR A;  3GXQ A;  3QOQ A;  1Q5V A;  2BNZ A;  2K1O A;  3OD2 A;  2BJ9 A;  2JXH A;  3LGH A;  2CAJ A;  4D8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...