1BE3D

Cytochrome bc1 complex from bovine
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 61
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1be3D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1be3D01
1GKSA 5GTHV 3WFBC 4KMGA 1LS9A 1CSVA 1DVVA 3O0RC 1I8PA 1R0QA 3ZOOA 3DMIA 1CEDA 2C9XB 1S5LV 4RSZA 3WFDC 4EDFA 1C6OA 3C2CA 1CYJA 1I54A 3KZIV 3PTZA 3GW6A 1HH7A 4P4QB 1FI9A 1NNOA 3CX5W 3OA8A 3NBTA 2YQBA 4H0KA 1CXCA 3ZIYA 2JTIB 4O1WA 3O1YA 2A06D 2QJYB 1BCCD 3L70D 4RJTA 1GIWA 1MG3D 3SLEA 3WU2V 4FB1A 3GG2A 2VHDA 4PW9B 4AANA 2ZZS1 4DY9A 1GU2A 2BLFB 1HROA 1CTZA 3RN1A 1EB7A 1KB9D 1FI3A 4WQ9A 2BCCD 1YNRA 5CIDB 4IL6V 2FRCA 1H32B 3DR0A 4FA9A 4LJIA 1C7MA 1GDVA 4Y5RA 4EIFA 2B10B 4WQDA 1DW2A 5GTIV 3VYMA 3ZOYA 1AOFA 1RAPA 5DJQC 1HCMA 2EXVA 1OAEA 4H0JA 5CIEB 1C6SA 1YIQA 1DW1A 5TJHA 2V08A 3VMAA 1IO3A 3SVWA 2RMZA 1CIGA 5AURA 1FOCA 1N15A 1KB0A 4L1QA 3DP5A 1FCDC 1N9CA 3A0HV 1NU1D 1ZRTD 1DW3A 3ORVA 2GIWA 1YTCA 1H9XA 1H1OA 4FA5A 2Q3EA 1AOQA 3L72D 1CRGA 4GEDB 1CIHA 2ZBOA 2B12B 1NIRA 3L4MA 2AXTV 2QJPB 2ZXYA 5C0ZA 1W5CT 2HV4A 4AALA 2B11B 1I6EA 4EIEA 3CYTI 4WQEA 1IZL0 4Q5PA 1E29A 1CRYA 1L0ND 1VYDA 4NFGB 1CRCA 2FWLA 4U3FD 1KIBA 1CHJA 3HQ6A 4WQ8A 1L9JC 3NWVA 2I8FA 1QYZA 2B4ZA 1CSXA 3CWBD 1CIEA 1KX7A 2KNCB 2GC7D 3VNWA 2YCCA 4EICA 451CA 3HQ7A 3ZCFA 1C6RA 3PXWA 5DJQB 1E8EA 2N9JA 4QAOA 4L3GA 1C52A 2V07A 1NMLA 2JQRA 1C2NA 4MU8A 1KYOD 5KAIV 1YEBA 1U75B 1CIFA 2OZ1A 3CXHW 2GB8B 1ETPA 1I55A 5CICB 1CC5A 3NBSA 2AIUA 1YFCA 2N18B 1W2LA 5KAFV 1E2RA 1A2SA 2FYNB 1CYCA 4XXLA 4A7PA 3L71D 2XTSB 1YEAA 2CA4B 3PHLA 5CIBB 1PP9D 3RMZA 3WUIA 1HZUA 5CIGB 2O3JA 3A9FA 3OCDA 3TDKA 1I5TA 3PLNA 3L75D 4WQBA 1CRHA 4FANA 1IQCA 2C1DB 1SQVD 1WVEC 4XYDB 3H1KD 5C9MA 5IY51 1JDLA 3OCDB 3WFCC 2AI5A 1NTZD 3L73D 3WC8A 1SQQD 1J3SA 2CA3B 3O5CA 2BH5X 1A8CA 2Y0CA 2MTAC 1QKSA 1CXAA 2C1UA 3ZBMA 2QG4A 2IBZD 1C75A 4FA4A 3JBTB 4V2KA 5DF5A 1DT1A 1CTYA 1QL4A 1C2RA 3MK7B 3CU4A 1LC1A 1HRCA 2CE1A 4AAOA 2BCNB 1CRJA 4K3IA 2QJKB 2ZONG 1M70A 2N3YA 1N90A 1CSUA 1LC2A 2B0ZB 2PCBB 3ITKA 1N50A 1H33A 3M97X 1NMIA 1BL9A 2C1VA 2GC4D 1LMSA 1BE3D 4D6TD 2L4DA 3H1ID 1RZ5A 3L4OA 3VRDA 3H1HD 4O1QA 1K3HA 2Y0DA 1KV9A 5B66V 3PH2B 1CSWA 3X39A 2N18C 1S6VB 2MHMA 4PJ0V 1DVHA 1DW0A 1PPJD 2C1DA 4PD4D 3H1LD 2BPBB 5CIFB 1GQ1A 3PXSA 4YE1A 1IRWA 4L3HA 1L9BC 1FHBA 1HJ5A 1FI7A 3CP5A 1HJ3A 1H31A 2ORLA 2PACA 2K9JB 2PCCB 5EXQA 2D0WA 3SJLA 3TF5A 1QL3A 2DGEA 4UB8V 2D0SA 3SWSA 2CXBA 1WEJF 2YK3A 1ZZHA 3SXTA 3OA8B 1H33B 1U74B 5H2FV 3HQ9A 1H9YA 4FA1A 1YCCA 2ZOOA 4WQ7A 5DFSA 1MG2D 3CXHD 3ZOWA 1H32A 1A56A 1IRVA 3FWLA 1CTJA 1OCDA 2FYUD 4WQCA 5B6QA 4PWAA 3WFEC 1YICA 3PRJA 1HZVA 5KKZB 1B7VA 1F1CA 2N3BA 1CCRA 3ZOXA 155CA 2KS1A 2DVHA 4AX3A 2BGVX 1L0LD 2RN0A 2C2CA 5CIHB 1RZ6A 5KLVD 4J20A 3A0BV 3KHUA 1NTKD 5B5EV 4N0KA 1HJ4A 1M60A 4FAVA 4JCGA 1RAQA 2N9YB 2LIRA 1EZVD 2BH4X 5CYTR 4UB6V 1CRIA 1GJQA 1CHIA 1CYIA 1SQXD 2CE0A 3CX5D 5KLIB 3BCCD 4EIDA 1BGYD 2JWAA 1NTMD 3H1JD 1P84D 1CORA 1CO6A 2Y0EA 3HQ8A 1CHHA 1CNOA 1I6DA 1LFMA 1KX2A 5E79V 1M6ZA 3PXTA 2N9IA 351CA 4AAMA 1DIIC 2OZ1B 1COTA 2LITA 1QN2A 3RLMA 1CCHA 1K3GA 2YIUB 1AYGA 3O20A 3TGUD 3L74D 1SQPD 2L91A 2C8SA 1AKKA 3RN0A 1SQBD 3TYIA 1FJ0A 5TISV 1DIQC 1F1FA 3MK7C 1H31B 1I8OA 1KYOW 4GYDA 1MZ4A 4WQAA
chains in the Genus database with same CATH superfamily
1IFIA 5GTHV 2FYUJ 2ZT9D 4KMGA 3M0AA 3WUUA 1GW4A 5H2FE 3ZOOA 4PJ0E 1N73A 1FZCA 1W2EA 3RL0B 1CEDA 2YO3A 1M1JC 5KAFE 1S5LV 1C6OA 1D7MA 2QM7A 1I54A 3KZIV 1Q2NA 3CWBG 1YTZT 1FI9A 3AE8C 2I1JA 3CX5W 3BASA 1NTKJ 2QJYB 1GDTA 1BCCD 2GUSA 1EDKA 3SLEA 4FB1A 1SS1A 2FXMA 1FZEA 1EQ7A 2AXTH 2NPSB 3RN1A 1EB7A 1KB9D 3I56P 2WMMA 3JCUE 3RGUA 1YNRA 5CIDB 3DR0A 1H32B 2QJYC 1S1CX 4EIFA 1FJPA 1N7SD 5GTIV 3VYMA 4IL6E 5H2FH 3L72G 1T6AA 1SFCD 4H0JA 3CCUP 1DW1A 3B5NC 2V08A 1IO3A 3SVWA 1KYOH 1CIGA 5AW5B 1VF5B 2WTYA 2RH0A 2HPCA 2N1TD 2MJZA 1NU1D 1DW3A 1BGYJ 3AE1C 4FA5A 2WSSH 1JMMA 1AOQA 3CWBE 4GEDB 1CIHA 1RE3C 2KSEA 3MGNA 3H1JG 4PV1B 2PRRA 3L4MA 3FXEA 4LGDE 2AXTV 2OYHC 5AW6B 3Q2YA 2NZ2A 4ASWA 2B11B 1SQXG 5AVZB 1KILA 1SVFA 3CCLP 3U1AA 4Q5PA 2G8YA 3P8CD 1E29A 5AW0B 1ZMEC 1A02J 2Q7CA 1IFNA 1NTKE 1FU1A 4OGQB 2QRXA 3H1LG 2B4ZA 3NTNA 2KNCB 1OFCX 3Q5RA 2BCCE 1OW8A 4YTPC 1PPJE 1Z56A 1BSHA 2OZ1A 1BE3G 3N4XA 1SQQJ 1H8AA 4U3FJ 1GZLA 2N18B 1Y8AA 2W6BA 1SFCB 2BEQD 2FYUG 5KAFV 5BU8B 4K3AA 3RK2D 3W68A 1E2RA 1A2SA 3M0DC 4XXLA 4GIFA 3H1KE 2IPPA 1PP9D 1HZUA 5CIGB 1FAVA 5AW1B 2FYZA 3OCDA 3AEGC 3L75D 4WQBA 1VF5D 3LIEA 1NU1K 3MIWA 5CCHD 1SQVD 1M56D 1NTME 5IY51 1T8ZA 1NTZD 3WC8A 1SQQD 5APTA 4IOIH 5TISE 1KZUB 5KLVJ 1CXAA 4Y28J 2IBZD 2ZYGA 3BATA 4H44D 2KLUA 1DT1A 2C9LY 2WSCH 1QL4A 2E5YA 2J59M 2Z5IA 5APSA 3T97A 2BCNB 2IBZE 1Q86Q 4Y99C 4WB4A 3G3ZA 2B0ZB 4HB1A 3VP9A 1N7SB 1VQ8P 4H0LC 1H33A 3H1KJ 3M97X 1NMIA 2GC4D 5AVVB 2L4DA 4NPFX 1RZ5A 1EDLA 1L0NJ 1MFZA 3F5HA 1VQKP 3HUSB 5KLVE 1QGKB 5AW9B 2E74B 3CLQA 5AW8B 1DEEG 1L0LE 4CPGA 2FBWC 1J1DB 2OQQA 5KTBA 2N1TA 1S5LX 1PPJD 1GMJA 3H1LD 5AW4B 2BPBB 2KZJA 5CCHA 1LT1A 3TK1A 1GQ1A 4YE1A 3HUSC 1YHQP 4L3HA 5KLVG 2HODB 1S4XA 1CI6A 3H1IE 1LTIC 3CP5A 1HJ3A 1H31A 1EXIA 3M91A 2PCCB 2D0WA 1QL3A 4I2LC 3SWSA 3R4YA 2KS1B 3V2RA 3AE3C 3OA8B 1U74B 4BXLA 1FE6A 2HODA 2WSEH 5H2FV 3TSIA 4FA1A 2E76B 5AVTB 1R8EA 1N2DC 1XTGB 3CXHH 3V5BA 5DFSA 1MG2D 2P7JA 3CXHD 3ZOWA 1NVOA 2W6JH 1K04A 1BDCA 3FX0A 1IRVA 1CTJA 4RO0A 3Q5SA 1YICA 2E42A 5KKZB 3OJAB 3WU2E 4GDOA 2KS1A 3Q1MA 2ZXXA 2RN0A 3BCCG 3V6IA 3H1HJ 2W90A 3GF7A 4AUWA 4PD4H 5CBOA 1J2JB 2OTJP 3AE7C 4JCGA 1JY3N 1RAQA 3KZIE 1VQ4P 5AW2B 1EZVD 1YQ3C 2KYVA 1J1DC 3B5ND 3LIDA 2K9JA 1SQQE 2IX7C 4ZNCA 5AVRB 3BCCD 3L75J 1BGYD 2JWAA 1FOSE 1P84D 3Q3DA 1ZW0A 1KX2A 1JMBA 2OYIC 2WITA 4H13D 3PXTA 1JY3O 2B89A 1NJIQ 1JCDA 1K3GA 3O20A 3TGUD 3L74D 2A45H 5KAFH 1L2PA 1AKKA 1RE3A 1SQBD 1S9KD 2A45G 1I8OA 3H1JJ 1KYOW 3MUDA 2OTLP 2O01J 1MZ4A 1GKSA 2IBZG 1LS9A 3L74J 1BGYG 3L75E 1DVVA 1EDIA 3MTUE 1I8PA 1R0QA 3AE2C 3DMIA 3SWFA 2IZ0A 5APQA 1YYCA 2IYOA 2FYNC 2IFNA 1SFCC 3GHGB 1CYJA 1L0NG 1BSNA 1MZ9A 1HH7A 1NNOA 1N8RQ 3NBTA 3L36A 2A06D 1LWUA 1M7LA 2IBZI 3H1KG 2QVAA 3EQ2A 3HE4B 3LW5J 1URQC 3GG2A 2N1TB 4PW9B 4H44B 2YKPA 2ZZS1 3L71G 4BRYB 4DY9A 1SLQA 4LLHA 1HROA 2J5UA 2M5AA 3H1HE 1URQA 1L0NK 1L0NE 1WMKA 1CTZA 3A0BE 1URQD 4WQ9A 1NYHA 1E79H 3EFFK 4LJIA 2H7HA 4HYTB 2B10B 3CCEP 2KB7P 1CSBA 2Z5HA 1HGZA 1HJBA 3CCVP 3D70A 5CIEB 2JR8A 5TJHA 1KTMA 1FZCC 3S1KA 2FXPA 3AE5C 3SWKA 5CCGC 3NMDA 1FCDC 3A0HV 2JKVA 1KQLA 4L75A 3L72J 2E43A 3MUDC 1GK6A 2Q3EA 3L72D 1VQ6P 2QE7H 1X9VA 3FWNA 2QJPB 2M8RA 3O8ZA 1W5CT 3MP7B 2QJPC 4EIEA 2WT7A 3SFDC 5TISH 2ZT9B 1WRGA 4NFGB 2LXBA 3HQ6A 1K8AQ 2AEFA 2WSFH 4OGQD 1DIPA 2I8FA 2P1JA 1QYZA 5CCGA 1JB0J 4DCKA 1PL5A 1CIEA 4PV1D 1ZP0C 4OGQC 1YJNP 4EICA 3HQ7A 1VF5C 4QAOA 2KK7A 3H6PA 1LWUC 1E5WA 4D6TJ 3D6ZA 2L5GB 3D71A 1C2NA 4Z1MH 1KYOD 5KAIV 4H0LB 2LR2A 3CPWO 1CIFA 2FFDC 1SQXJ 3NBSA 2FFDA 2JDIH 1CYCA 2OARA 1RQUA 5AVXB 3L71D 2XTSB 1YEAA 2V7QJ 1H88A 3WUIA 1FC2C 4GODA 1I5TA 3WUTA 1LT9A 2XKMA 4W7YA 3A5TA 2D2CD 2OYOA 2C1DB 1NAYA 1JDLA 3B8EB 1CW5A 3WFCC 4TLFA 2WPSA 3L73D 2OYIA 4MN4C 1J3SA 3AE6C 1OW7A 4RESB 1G1JA 5AW7B 2BH5X 1LTJA 2KLVA 2K37A 1JUNA 1HUCA 1LTTC 3L70E 2QG4A 4FA4A 2N9BA 2YNYA 1CTYA 2O1KA 4D6TG 3E1IA 1LTSC 1SQPK 5GTHH 3CU4A 3M9BA 3M9HA 5BVZA 4AAOA 3A0BH 2HYNA 1RY3A 2G3AA 1OVUA 1CRJA 2QJKB 2ZONG 1M70A 2N3YA 3H1IG 1RF0A 1LC2A 5DJTB 1USDA 5KLVK 2PCBB 3ITKA 1S5LH 1N50A 1KILE 4I1LA 3CX5I 2R3CA 1P84I 3H1ID 4GT1A 1NGMB 3VRDA 3G71P 1K73Q 1K3HA 2Y0DA 2A45I 1AQTA 5B66V 4DT0A 2W83C 4C7NB 4XA4A 3B4SA 5B66E 1FZGA 2R5DA 2NPSD 3RK3E 1S6VB 1NTZE 2MHMA 4PJ0V 1DVHA 1GD2E 1KB9E 2YMYA 5CIFB 3FXDA 1AA0A 1RQVA 3PXSA 4KJMA 1NWQA 1L9BC 4N78D 1FHBA 5GTIH 1ZV8A 1PP9G 4HH2A 3V2PA 1AQ5A 2KUBA 2ORLA 2PACA 1HJ0A 1GU4A 5EXQA 1ZR4A 2E75B 3G4SP 2W8ZA 3TF5A 1L0LK 1G1IA 1U57A 4EI2A 4HKZH 1AV1A 1GW3A 1ZZHA 3KZIH 1BCCJ 4KHXA 2Q6QA 1H0TA 1H9YA 1LWUB 2RKLA 3NXSA 4WQ7A 4AQRD 1YI2P 1NHLA 1KFNA 2C0WA 5B66H 1OWAA 3HE5A 1S72P 1H32A 2J58A 3H1LJ 1M1JA 3FWLA 3S4RA 3UIAA 4WQCA 5B6QA 4PWAA 4XE5B 3VP8A 1M8OB 1B7VA 1H0TB 4EIJA 155CA 2DVHA 4ZKPA 4PV1C 3MHVA 4H0LD 2BGVX 1RZ6A 1BCCE 2AXTE 1DX7A 1HJ4A 3CCMP 1M60A 1FDIA 4WY4A 2E74C 3C1LA 2HPCB 4K35A 1J1EC 3C9IA 2ZVOB 2BH4X 3SFEC 4LC1A 5CYTR 3S9OA 1XTCC 1GJQA 1CYIA 1SQXD 3IF4A 3KXDA 2CE0A 3OAKA 2WPVB 1BCCG 4OH8B 4DOJA 2NPSA 1CORA 2Y0EA 3RK3C 1CNOA 1PGOA 3O6QA 1SQBJ 1RHZB 3N7NA 351CA 4BWNA 1A02F 5APUA 3V2NA 1CCHA 1OW6A 1S2EA 3P8MC 1EC5A 4N6JA 1OIPA 3T97B 1VQMP 1KMIZ 1SQPD 3II6A 2FY8A 2L91A 1PGQA 3CC7P 1AVYA 2Q3IA 1DIQC 1SQPJ 1H31B 5KAIH 4GYDA 3WMM0 2KOGA 1RH5B 2YMKA 1OMIA 1VL2A 1VDFA 1DD4A 4TT3H 3O0RC 1MFTA 2IYPA 4QMAA 1HWTC 3E1RA 2WPRA 2V4HA 2C9XB 4RSZA 4EDFA 1EZVI 3PTZA 3BRVB 3GW6A 2YKQA 5C39A 1KC8Q 2CK3H 3OA8A 2W27A 2YQBA 1CXCA 1KILB 3ZIYA 4O1WA 1CZQA 3CC4P 3H32B 3MD0A 3OW2O 4RJTA 5CHXA 3WU2V 2DW3A 4B86A 1RF1A 4AANA 3H1IJ 2XV5A 1JTHA 1QL2A 4C46A 1G2CA 4AYCA 4PD4E 4JYCA 1FDMA 2E5TA 2FRCA 4FA9A 1C7MA 2HFED 5GTIE 4GOEA 4Y5RA 1KQFB 3CCJP 1DW2A 3ZOYA 3OA7A 1AOFA 5AVSB 2E75D 1OAEA 5B5EH 5E79E 2YIUC 1AJYA 5BU5A 1Y9BA 3VMAA 2WT7B 2PAJA 4UB8H 2WZ7A 1YQ4C 1VQOP 1N15A 1KB0A 2OTKE 2D2CC 3DP5A 1ZRTD 2GIWA 1H9XA 1H1OA 2O01H 1FZFA 2XU6A 1ZLLA 3L70J 3IN6A 2OYHB 5GTHE 1NTMG 1NIRA 4N78E 1MKMA 2GM4A 4L73A 2ZXYA 1FS0E 5C0ZA 2B88A 3VMXA 2BCCG 2B87B 3A2AA 3RK3D 1NH4A 2AEMA 1IZL0 5L8RJ 2JWDA 4R4MA 2E74D 1FBMA 2Y9YA 3L4FA 1PPJG 1L0ND 3JC22 2AXCA 3VMYA 1VPCA 2FWLA 3L75G 3USSA 1CHJA 4WQ8A 1X8YA 4NPDA 3RL0D 1L9JC 1RF0C 1NKNA 1LP1B 1KX7A 1ZOYC 2GC7D 3GMAA 3A0HH 4UB6H 1C6RA 4HJGH 1NTKG 3PXWA 1E8EA 4O9BA 2E76C 1C52A 2V07A 3CMAP 4W80A 3CWBJ 3TGUG 2FYUK 2K88A 2SPZA 1YIJP 1KV4A 1U75B 3CXHW 4IFFA 2QJKC 1ETPA 1SQXE 1I55A 5CICB 1QVFO 1CC5A 4WVZA 1YFCA 4OWFA 2WQYC 5B5EE 4N3YB 1W2LA 5K5GB 1L4AB 2FYNB 1HTLC 3AEAC 1JY3P 1SQPG 2WVRA 4A7PA 3K5BA 3PHLA 1P84H 1SQVG 2O3JA 2KIKA 3HD7A 3Q5PA 3A9FA 3TDKA 2W6AA 1GL2A 3PLNA 5KJ7A 4FANA 1IQCA 1IZNB 1TU3F 1HBWA 3PH0A 2QA4P 2AEJA 3CCRP 5C9MA 3VTPC 3L35A 3OCDB 1DH3A 1T2KC 1GTWA 2E75C 4PD4I 2CA3B 4WBAA 3VOPA 3O5CA 3EWKA 3HE4A 1ZRTE 4IL6H 1EZVE 3VN0A 1A8CA 1QKSA 1L4AD 3RK2B 1KYOI 1L0LG 2A06G 3TGUJ 1C75A 5KAIE 1C2RA 3MK7B 1R5LA 1S3JA 2LXCB 1LC1A 1HRCA 2CE1A 1BGYE 3L71J 1QX8A 1M90Q 4IL6X 1WT6A 1N90A 2R3SA 1CSUA 2H88C 2KI7B 3LW5H 3ABVC 2WSEJ 1BL9A 1MUUA 1R5SA 1BE3D 4ZMDA 4D6TD 3HRNA 1VQLP 1DEBA 1ZR2A 3L4OA 2IFMA 1SQVE 4WY4C 5AW3B 1JY2P 2QSIA 4JF7A 3PH2B 3HD7D 2FFDB 1NTMK 1Y47A 3I55P 3MZWB 1KORA 1OVVA 2FXOA 2N18C 3TNUB 2PFXA 1DW0A 4DJGA 4EYYQ 1LT9C 1NOHA 2I1KA 4JYBA 1IRWA 3A7OA 2OYIB 1HJ5A 2IDBA 5M1BA 3M0DA 4C7NA 1SQXK 2K9JB 1GU5A 1PIXA 3L73G 2DGEA 1K9MQ 3GHGA 1YBKA 4UB8V 1SP4A 4I6MC 3H32A 3RL0g 2MKVA 3CL3D 1IFMA 4UB8E 3SXTA 2FYUE 1CI6B 1KD1Q 3HQ9A 2D2CB 1JY2N 2E76D 2ZAEB 1LTGC 1M1KQ 3H25A 1LJ2A 2ZYDA 1EDJA 4YPCA 1KFMA 4BRYA 1JOCA 2CPSA 1NU1G 2POHA 5CJ0A 1OCDA 3CCQP 2FYUD 3L73E 3W67A 4W7ZA 1NTKK 2N3BA 3JSVC 5CCGD 1S5LE 1PFIA 3HUSA 1L0LD 4U7JA 5CIHB 5KLVD 3P7KA 1SFCA 3AEDC 2PGDA 1NTKD 1GK4A 1AFOA 4FAVA 1VQNP 2C9NY 2LKMA 1JEKA 2LIRA 1M57D 2OYHA 2BASA 3AEFC 3KDPB 2C0XA 2XNXA 3R2PA 1ZXGA 1CHIA 1W2BO 2NPSC 3ZDMA 2JP3A 4EIDA 2ZYAA 1Q90D 1NTMD 1URQB 3VYIA 1KYOE 3HQ8A 2H43A 1I6DA 2I8DA 1LFMA 1M6ZA 4AAMA 3AE4C 3QWOC 2ZXEB 2LITA 3FGAD 3C8VA 3L73J 1K05A 1PP9E 1QN2A 1NAFA 4PJ0H 2YIUB 3L74G 1AYGA 1MV8A 3AE9C 4I7ZC 2C8SA 2YKOA 3TYIA 1BE3J 1NU1E 1PGJA 1SQBG 1FJ0A 5TISV 1F1FA 3MK7C 3HD7C 1KB9H 2V7QH 4WQAA 3A3YB 2H89C 4U3FE 3WFBC 2ZVNB 1T2KD 1CSVA 2JEEA 1JTHB 3L72E 2IZ1A 1N7SA 3BRTB 2QEXP 1OZHA 1L4AC 3WFDC 3C2CA 3KYQA 1LNQA 4ZKUA 3IFMA 1EZVG 2Z4EA 4P4QB 4WWIA 2HG5D 3CX5H 4IFMA 4H0KA 1FDOA 2JTIB 3O1YA 3CI9A 1W5CE 3L70D 1GIWA 1MG3D 2R5BA 3AEEC 3TNUA 2VHDA 1EXJA 4IFDK 1RF1C 1GU2A 2BLFB 1Q81Q 2P58A 3H1HG 2JO1A 2VRSA 3U59A 1N73B 3BCCJ 1GL2B 1FI3A 4NPEA 2WSFJ 3P8CE 4RKUJ 2ZT9C 1ZN5A 2BCCD 4IL6V 3V2QA 1GDVA 4WQDA 3L70G 3RBZA 2P2UA 5APYA 1RAPA 5DJQC 1PV3A 1HCMA 2EXVA 1RF1B 5AVQB 1C6SA 1YIQA 1RE4C 4D6TE 4L76A 2RMZA 3JCUH 5AURA 1N86A 1SQBE 1FOCA 1PGPA 1YJWP 3PP5A 3TGUE 4L1QA 3H1LE 3RL0C 1N9CA 2OGUA 3ORVA 2ZFCA 2Y9ZA 3D0WA 2YXQB 3A0HE 1YTCA 2P10A 1T3JA 1IFPA 3IAOA 1FOSF 1CRGA 5CCHC 2ZBOA 2B12B 2WWWA 1PZQA 2A06E 3B71A 3RBXA 1YTZI 2GA1A 2H8PD 1IK9A 1VQ5P 4GOFA 2HV4A 1NTZJ 4AALA 2JJLA 1SQQG 5APVA 5AVUB 1DD3A 3M06A 4U3FG 1I6EA 1KQSO 3CYTI 1X79B 4WQEA 2KNCA 1FZAA 2ZJSE 1CRYA 3G6EP 1VYDA 4YXDC 1CRCA 1HVVA 3G9RA 4U3FD 2XZRA 1KIBA 4H13C 1P84E 4EOTA 1JY2O 1NTZK 3VMZA 2B87A 3NWVA 1SQQK 1CSXA 3CWBD 3VNWA 2YCCA 2QIWA 2PP6A 451CA 4I7ZB 3ZCFA 1NKZB 3B5NA 2ITAA 2R44A 3IR9A 5DJQB 2N9JA 1QEXA 4JPZB 4L3GA 2R32A 1N7LA 3O6QB 1NMLA 5CMZA 2JQRA 2K1AA 4MU8A 1LGHB 1YEBA 3E7KA 3WU2H 4KT0J 4JQ0D 1IFJA 2GB8B 1JCCA 1IO4A 2AIUA 2KZIA 3V4QA 4GKGA 2M5AB 3D6YA 1NTMJ 1FJKA 1VQ9P 1VQPP 2Q9IA 2CA4B 5CIBB 3RMZA 3EFGA 1IFDA 3GLMA 1VQ7P 1CRHA 4DZOA 2KSJA 2NRGA 1IC2A 2N1TC 3GHGC 2P67A 4UB6E 1WVEC 1IJDB 4XYDB 1X22A 4XFJA 3H1KD 1L4AA 3HTKB 1N73C 2AI5A 1AVOA 3CX5E 1KILD 2BEZF 1HF9A 3AECC 3CD6P 1SQVJ 2Y0CA 4OVNF 2MTAC 2C1UA 3RK3B 3ZBMA 3NFQA 3JBTB 4V2KA 5DF5A 2O1JA 1H89A 2Q5UA 2UWJE 1UIXA 4K3IA 5KKZC 3P32A 5APWA 2HLOA 1L0LJ 1SQPE 2WPQA 2C1VA 1U7JA 1LMSA 4M3LA 1USEA 3H1HD 3TYYA 3KPEA 4O1QA 1BE3E 1KV9A 1NU1J 1KN7A 2M3BA 1CSWA 3X39A 5AVWB 1KB9I 3HTKA 1LT9B 2CPBA 1NTZG 5EFWB 2YXRB 2C1DA 4PD4D 4H44C 2M3EA 3KQGA 3CC2P 2O01N 3SWYA 3QH9A 1LTJC 2B9BA 2QM8A 4WY4B 1FI7A 5APXA 4L74A 1KQGB 3L37A 3V4WA 3SJLA 3WUVA 2D0SA 3AEBC 1LP1A 2CXBA 3SSUA 3HD7B 1SQVK 2FKWB 1GL2C 5KJ7C 1FZCB 4H13B 1WEJF 2YK3A 1S9KE 1IK7A 1H33B 3F89A 3L74E 1YCCA 2ZOOA 1GL2D 5KJ7D 2Q1KA 1JO5A 1BDDA 1G2CB 3CMEP 5DJUB 3B5NB 1A56A 1N7SC 5E79H 1SQBK 1Q7YQ 1NO4A 1LTAC 3WFEC 3PRJA 3BCCE 1HZVA 1YITP 1F1CA 1CCRA 3ZOXA 1J1EB 1U7MA 3CXHE 1JM0A 1T3UA 4AX3A 1HGVA 2GUVA 4YXWH 2C2CA 4J20A 1KILC 3A0BV 3KHUA 2BCCJ 1QLED 3GF3A 5B5EV 4N0KA 3CCSP 1QL1A 4R4LA 3I5CA 1JNMA 2N9YB 5CBNA 4C7RA 4WY4D 4ASVA 2WSCJ 2KP8A 5KLIC 1UIIA 4UB6V 2XNDH 5AVYB 1CRIA 1OVRA 4JBZA 1QVGO 3CX5D 5KLIB 1FZBA 3H1JD 2KXPB 3RK2C 1CO6A 1LTJB 3H1JE 1OX3A 1CHHA 1OXZA 2HR3A 1YJ9P 2K9YA 3CXHI 5E79V 3M9QA 2N9IA 1X0TA 4Y99B 1Q82Q 1DIIC 2OZ1B 1COTA 1HH0A 2XDJA 3RLMA 2K3RA 1PP9J 2M0BA 1RE4A 3L71E 3BVHA 3HE5B 3RN0A 1LTBC 1M1JB 2YO2A 5CJ4A 3U1CA 3PJSK
chains in the Genus database with same CATH topology
1GKSA 5GTHV 3WFBC 4KMGA 1LS9A 1CSVA 1DVVA 3O0RC 1I8PA 1R0QA 3ZOOA 3DMIA 1CEDA 2C9XB 1S5LV 4RSZA 3WFDC 4EDFA 1C6OA 3C2CA 1CYJA 1I54A 3KZIV 3PTZA 3GW6A 1HH7A 4P4QB 1FI9A 1NNOA 3CX5W 3OA8A 3NBTA 2YQBA 4H0KA 1CXCA 3ZIYA 2JTIB 4O1WA 3O1YA 2A06D 2QJYB 1BCCD 3L70D 4RJTA 1GIWA 1MG3D 3SLEA 3WU2V 4FB1A 3GG2A 2VHDA 4PW9B 4AANA 2ZZS1 4DY9A 1GU2A 2BLFB 1HROA 1CTZA 3RN1A 1EB7A 1KB9D 1FI3A 4WQ9A 2BCCD 1YNRA 5CIDB 4IL6V 2FRCA 1H32B 3DR0A 4FA9A 4LJIA 1C7MA 1GDVA 4Y5RA 4EIFA 2B10B 4WQDA 1DW2A 5GTIV 3VYMA 3ZOYA 1AOFA 1RAPA 5DJQC 1HCMA 2EXVA 1OAEA 4H0JA 5CIEB 1C6SA 1YIQA 1DW1A 5TJHA 2V08A 3VMAA 1IO3A 3SVWA 2RMZA 1CIGA 5AURA 1FOCA 1N15A 1KB0A 4L1QA 3DP5A 1FCDC 1N9CA 3A0HV 1NU1D 1ZRTD 1DW3A 3ORVA 2GIWA 1YTCA 1H9XA 1H1OA 4FA5A 2Q3EA 1AOQA 3L72D 1CRGA 4GEDB 1CIHA 2ZBOA 2B12B 1NIRA 3L4MA 2AXTV 2QJPB 2ZXYA 5C0ZA 1W5CT 2HV4A 4AALA 2B11B 1I6EA 4EIEA 3CYTI 4WQEA 1IZL0 4Q5PA 1E29A 1CRYA 1L0ND 1VYDA 4NFGB 1CRCA 2FWLA 4U3FD 1KIBA 1CHJA 3HQ6A 4WQ8A 1L9JC 3NWVA 2I8FA 1QYZA 2B4ZA 1CSXA 3CWBD 1CIEA 1KX7A 2KNCB 2GC7D 3VNWA 2YCCA 4EICA 451CA 3HQ7A 3ZCFA 1C6RA 3PXWA 5DJQB 1E8EA 2N9JA 4QAOA 4L3GA 1C52A 2V07A 1NMLA 2JQRA 1C2NA 4MU8A 1KYOD 5KAIV 1YEBA 1U75B 1CIFA 2OZ1A 3CXHW 2GB8B 1ETPA 1I55A 5CICB 1CC5A 3NBSA 2AIUA 1YFCA 2N18B 1W2LA 5KAFV 1E2RA 1A2SA 2FYNB 1CYCA 4XXLA 4A7PA 3L71D 2XTSB 1YEAA 2CA4B 3PHLA 5CIBB 1PP9D 3RMZA 3WUIA 1HZUA 5CIGB 2O3JA 3A9FA 3OCDA 3TDKA 1I5TA 3PLNA 3L75D 4WQBA 1CRHA 4FANA 1IQCA 2C1DB 1SQVD 1WVEC 4XYDB 3H1KD 5C9MA 5IY51 1JDLA 3OCDB 3WFCC 2AI5A 1NTZD 3L73D 3WC8A 1SQQD 1J3SA 2CA3B 3O5CA 2BH5X 1A8CA 2Y0CA 2MTAC 1QKSA 1CXAA 2C1UA 3ZBMA 2QG4A 2IBZD 1C75A 4FA4A 3JBTB 4V2KA 5DF5A 1DT1A 1CTYA 1QL4A 1C2RA 3MK7B 3CU4A 1LC1A 1HRCA 2CE1A 4AAOA 2BCNB 1CRJA 4K3IA 2QJKB 2ZONG 1M70A 2N3YA 1N90A 1CSUA 1LC2A 2B0ZB 2PCBB 3ITKA 1N50A 1H33A 3M97X 1NMIA 1BL9A 2C1VA 2GC4D 1LMSA 1BE3D 4D6TD 2L4DA 3H1ID 1RZ5A 3L4OA 3VRDA 3H1HD 4O1QA 1K3HA 2Y0DA 1KV9A 5B66V 3PH2B 1CSWA 3X39A 2N18C 1S6VB 2MHMA 4PJ0V 1DVHA 1DW0A 1PPJD 2C1DA 4PD4D 3H1LD 2BPBB 5CIFB 1GQ1A 3PXSA 4YE1A 1IRWA 4L3HA 1L9BC 1FHBA 1HJ5A 1FI7A 3CP5A 1HJ3A 1H31A 2ORLA 2PACA 2K9JB 2PCCB 5EXQA 2D0WA 3SJLA 3TF5A 1QL3A 2DGEA 4UB8V 2D0SA 3SWSA 2CXBA 1WEJF 2YK3A 1ZZHA 3SXTA 3OA8B 1H33B 1U74B 5H2FV 3HQ9A 1H9YA 4FA1A 1YCCA 2ZOOA 4WQ7A 5DFSA 1MG2D 3CXHD 3ZOWA 1H32A 1A56A 1IRVA 3FWLA 1CTJA 1OCDA 2FYUD 4WQCA 5B6QA 4PWAA 3WFEC 1YICA 3PRJA 1HZVA 5KKZB 1B7VA 1F1CA 2N3BA 1CCRA 3ZOXA 155CA 2KS1A 2DVHA 4AX3A 2BGVX 1L0LD 2RN0A 2C2CA 5CIHB 1RZ6A 5KLVD 4J20A 3A0BV 3KHUA 1NTKD 5B5EV 4N0KA 1HJ4A 1M60A 4FAVA 4JCGA 1RAQA 2N9YB 2LIRA 1EZVD 2BH4X 5CYTR 4UB6V 1CRIA 1GJQA 1CHIA 1CYIA 1SQXD 2CE0A 3CX5D 5KLIB 3BCCD 4EIDA 1BGYD 2JWAA 1NTMD 3H1JD 1P84D 1CORA 1CO6A 2Y0EA 3HQ8A 1CHHA 1CNOA 1I6DA 1LFMA 1KX2A 5E79V 1M6ZA 3PXTA 2N9IA 351CA 4AAMA 1DIIC 2OZ1B 1COTA 2LITA 1QN2A 3RLMA 1CCHA 1K3GA 2YIUB 1AYGA 3O20A 3TGUD 3L74D 1SQPD 2L91A 2C8SA 1AKKA 3RN0A 1SQBD 3TYIA 1FJ0A 5TISV 1DIQC 1F1FA 3MK7C 1H31B 1I8OA 1KYOW 4GYDA 1MZ4A 4WQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKS A;  5GTH V;  3WFB C;  4KMG A;  1LS9 A;  1CSV A;  1DVV A;  3O0R C;  1I8P A;  1R0Q A;  3ZOO A;  3DMI A;  1CED A;  2C9X B;  1S5L V;  4RSZ A;  3WFD C;  4EDF A;  1C6O A;  3C2C A;  1CYJ A;  1I54 A;  3KZI V;  3PTZ A;  3GW6 A;  1HH7 A;  4P4Q B;  1FI9 A;  1NNO A;  3CX5 W;  3OA8 A;  3NBT A;  2YQB A;  4H0K A;  1CXC A;  3ZIY A;  2JTI B;  4O1W A;  3O1Y A;  2A06 D;  2QJY B;  1BCC D;  3L70 D;  4RJT A;  1GIW A;  1MG3 D;  3SLE A;  3WU2 V;  4FB1 A;  3GG2 A;  2VHD A;  4PW9 B;  4AAN A;  2ZZS 1;  4DY9 A;  1GU2 A;  2BLF B;  1HRO A;  1CTZ A;  3RN1 A;  1EB7 A;  1KB9 D;  1FI3 A;  4WQ9 A;  2BCC D;  1YNR A;  5CID B;  4IL6 V;  2FRC A;  1H32 B;  3DR0 A;  4FA9 A;  4LJI A;  1C7M A;  1GDV A;  4Y5R A;  4EIF A;  2B10 B;  4WQD A;  1DW2 A;  5GTI V;  3VYM A;  3ZOY A;  1AOF A;  1RAP A;  5DJQ C;  1HCM A;  2EXV A;  1OAE A;  4H0J A;  5CIE B;  1C6S A;  1YIQ A;  1DW1 A;  5TJH A;  2V08 A;  3VMA A;  1IO3 A;  3SVW A;  2RMZ A;  1CIG A;  5AUR A;  1FOC A;  1N15 A;  1KB0 A;  4L1Q A;  3DP5 A;  1FCD C;  1N9C A;  3A0H V;  1NU1 D;  1ZRT D;  1DW3 A;  3ORV A;  2GIW A;  1YTC A;  1H9X A;  1H1O A;  4FA5 A;  2Q3E A;  1AOQ A;  3L72 D;  1CRG A;  4GED B;  1CIH A;  2ZBO A;  2B12 B;  1NIR A;  3L4M A;  2AXT V;  2QJP B;  2ZXY A;  5C0Z A;  1W5C T;  2HV4 A;  4AAL A;  2B11 B;  1I6E A;  4EIE A;  3CYT I;  4WQE A;  1IZL 0;  4Q5P A;  1E29 A;  1CRY A;  1L0N D;  1VYD A;  4NFG B;  1CRC A;  2FWL A;  4U3F D;  1KIB A;  1CHJ A;  3HQ6 A;  4WQ8 A;  1L9J C;  3NWV A;  2I8F A;  1QYZ A;  2B4Z A;  1CSX A;  3CWB D;  1CIE A;  1KX7 A;  2KNC B;  2GC7 D;  3VNW A;  2YCC A;  4EIC A;  451C A;  3HQ7 A;  3ZCF A;  1C6R A;  3PXW A;  5DJQ B;  1E8E A;  2N9J A;  4QAO A;  4L3G A;  1C52 A;  2V07 A;  1NML A;  2JQR A;  1C2N A;  4MU8 A;  1KYO D;  5KAI V;  1YEB A;  1U75 B;  1CIF A;  2OZ1 A;  3CXH W;  2GB8 B;  1ETP A;  1I55 A;  5CIC B;  1CC5 A;  3NBS A;  2AIU A;  1YFC A;  2N18 B;  1W2L A;  5KAF V;  1E2R A;  1A2S A;  2FYN B;  1CYC A;  4XXL A;  4A7P A;  3L71 D;  2XTS B;  1YEA A;  2CA4 B;  3PHL A;  5CIB B;  1PP9 D;  3RMZ A;  3WUI A;  1HZU A;  5CIG B;  2O3J A;  3A9F A;  3OCD A;  3TDK A;  1I5T A;  3PLN A;  3L75 D;  4WQB A;  1CRH A;  4FAN A;  1IQC A;  2C1D B;  1SQV D;  1WVE C;  4XYD B;  3H1K D;  5C9M A;  5IY5 1;  1JDL A;  3OCD B;  3WFC C;  2AI5 A;  1NTZ D;  3L73 D;  3WC8 A;  1SQQ D;  1J3S A;  2CA3 B;  3O5C A;  2BH5 X;  1A8C A;  2Y0C A;  2MTA C;  1QKS A;  1CXA A;  2C1U A;  3ZBM A;  2QG4 A;  2IBZ D;  1C75 A;  4FA4 A;  3JBT B;  4V2K A;  5DF5 A;  1DT1 A;  1CTY A;  1QL4 A;  1C2R A;  3MK7 B;  3CU4 A;  1LC1 A;  1HRC A;  2CE1 A;  4AAO A;  2BCN B;  1CRJ A;  4K3I A;  2QJK B;  2ZON G;  1M70 A;  2N3Y A;  1N90 A;  1CSU A;  1LC2 A;  2B0Z B;  2PCB B;  3ITK A;  1N50 A;  1H33 A;  3M97 X;  1NMI A;  1BL9 A;  2C1V A;  2GC4 D;  1LMS A;  1BE3 D;  4D6T D;  2L4D A;  3H1I D;  1RZ5 A;  3L4O A;  3VRD A;  3H1H D;  4O1Q A;  1K3H A;  2Y0D A;  1KV9 A;  5B66 V;  3PH2 B;  1CSW A;  3X39 A;  2N18 C;  1S6V B;  2MHM A;  4PJ0 V;  1DVH A;  1DW0 A;  1PPJ D;  2C1D A;  4PD4 D;  3H1L D;  2BPB B;  5CIF B;  1GQ1 A;  3PXS A;  4YE1 A;  1IRW A;  4L3H A;  1L9B C;  1FHB A;  1HJ5 A;  1FI7 A;  3CP5 A;  1HJ3 A;  1H31 A;  2ORL A;  2PAC A;  2K9J B;  2PCC B;  5EXQ A;  2D0W A;  3SJL A;  3TF5 A;  1QL3 A;  2DGE A;  4UB8 V;  2D0S A;  3SWS A;  2CXB A;  1WEJ F;  2YK3 A;  1ZZH A;  3SXT A;  3OA8 B;  1H33 B;  1U74 B;  5H2F V;  3HQ9 A;  1H9Y A;  4FA1 A;  1YCC A;  2ZOO A;  4WQ7 A;  5DFS A;  1MG2 D;  3CXH D;  3ZOW A;  1H32 A;  1A56 A;  1IRV A;  3FWL A;  1CTJ A;  1OCD A;  2FYU D;  4WQC A;  5B6Q A;  4PWA A;  3WFE C;  1YIC A;  3PRJ A;  1HZV A;  5KKZ B;  1B7V A;  1F1C A;  2N3B A;  1CCR A;  3ZOX A;  155C A;  2KS1 A;  2DVH A;  4AX3 A;  2BGV X;  1L0L D;  2RN0 A;  2C2C A;  5CIH B;  1RZ6 A;  5KLV D;  4J20 A;  3A0B V;  3KHU A;  1NTK D;  5B5E V;  4N0K A;  1HJ4 A;  1M60 A;  4FAV A;  4JCG A;  1RAQ A;  2N9Y B;  2LIR A;  1EZV D;  2BH4 X;  5CYT R;  4UB6 V;  1CRI A;  1GJQ A;  1CHI A;  1CYI A;  1SQX D;  2CE0 A;  3CX5 D;  5KLI B;  3BCC D;  4EID A;  1BGY D;  2JWA A;  1NTM D;  3H1J D;  1P84 D;  1COR A;  1CO6 A;  2Y0E A;  3HQ8 A;  1CHH A;  1CNO A;  1I6D A;  1LFM A;  1KX2 A;  5E79 V;  1M6Z A;  3PXT A;  2N9I A;  351C A;  4AAM A;  1DII C;  2OZ1 B;  1COT A;  2LIT A;  1QN2 A;  3RLM A;  1CCH A;  1K3G A;  2YIU B;  1AYG A;  3O20 A;  3TGU D;  3L74 D;  1SQP D;  2L91 A;  2C8S A;  1AKK A;  3RN0 A;  1SQB D;  3TYI A;  1FJ0 A;  5TIS V;  1DIQ C;  1F1F A;  3MK7 C;  1H31 B;  1I8O A;  1KYO W;  4GYD A;  1MZ4 A;  4WQA A; 
#chains in the Genus database with same CATH topology
 1IFI A;  5GTH V;  2FYU J;  2ZT9 D;  4KMG A;  3M0A A;  3WUU A;  1GW4 A;  5H2F E;  3ZOO A;  4PJ0 E;  1N73 A;  1FZC A;  1W2E A;  3RL0 B;  1CED A;  2YO3 A;  1M1J C;  5KAF E;  1S5L V;  1C6O A;  1D7M A;  2QM7 A;  1I54 A;  3KZI V;  1Q2N A;  3CWB G;  1YTZ T;  1FI9 A;  3AE8 C;  2I1J A;  3CX5 W;  3BAS A;  1NTK J;  2QJY B;  1GDT A;  1BCC D;  2GUS A;  1EDK A;  3SLE A;  4FB1 A;  1SS1 A;  2FXM A;  1FZE A;  1EQ7 A;  2AXT H;  2NPS B;  3RN1 A;  1EB7 A;  1KB9 D;  3I56 P;  2WMM A;  3JCU E;  3RGU A;  1YNR A;  5CID B;  3DR0 A;  1H32 B;  2QJY C;  1S1C X;  4EIF A;  1FJP A;  1N7S D;  5GTI V;  3VYM A;  4IL6 E;  5H2F H;  3L72 G;  1T6A A;  1SFC D;  4H0J A;  3CCU P;  1DW1 A;  3B5N C;  2V08 A;  1IO3 A;  3SVW A;  1KYO H;  1CIG A;  5AW5 B;  1VF5 B;  2WTY A;  2RH0 A;  2HPC A;  2N1T D;  2MJZ A;  1NU1 D;  1DW3 A;  1BGY J;  3AE1 C;  4FA5 A;  2WSS H;  1JMM A;  1AOQ A;  3CWB E;  4GED B;  1CIH A;  1RE3 C;  2KSE A;  3MGN A;  3H1J G;  4PV1 B;  2PRR A;  3L4M A;  3FXE A;  4LGD E;  2AXT V;  2OYH C;  5AW6 B;  3Q2Y A;  2NZ2 A;  4ASW A;  2B11 B;  1SQX G;  5AVZ B;  1KIL A;  1SVF A;  3CCL P;  3U1A A;  4Q5P A;  2G8Y A;  3P8C D;  1E29 A;  5AW0 B;  1ZME C;  1A02 J;  2Q7C A;  1IFN A;  1NTK E;  1FU1 A;  4OGQ B;  2QRX A;  3H1L G;  2B4Z A;  3NTN A;  2KNC B;  1OFC X;  3Q5R A;  2BCC E;  1OW8 A;  4YTP C;  1PPJ E;  1Z56 A;  1BSH A;  2OZ1 A;  1BE3 G;  3N4X A;  1SQQ J;  1H8A A;  4U3F J;  1GZL A;  2N18 B;  1Y8A A;  2W6B A;  1SFC B;  2BEQ D;  2FYU G;  5KAF V;  5BU8 B;  4K3A A;  3RK2 D;  3W68 A;  1E2R A;  1A2S A;  3M0D C;  4XXL A;  4GIF A;  3H1K E;  2IPP A;  1PP9 D;  1HZU A;  5CIG B;  1FAV A;  5AW1 B;  2FYZ A;  3OCD A;  3AEG C;  3L75 D;  4WQB A;  1VF5 D;  3LIE A;  1NU1 K;  3MIW A;  5CCH D;  1SQV D;  1M56 D;  1NTM E;  5IY5 1;  1T8Z A;  1NTZ D;  3WC8 A;  1SQQ D;  5APT A;  4IOI H;  5TIS E;  1KZU B;  5KLV J;  1CXA A;  4Y28 J;  2IBZ D;  2ZYG A;  3BAT A;  4H44 D;  2KLU A;  1DT1 A;  2C9L Y;  2WSC H;  1QL4 A;  2E5Y A;  2J59 M;  2Z5I A;  5APS A;  3T97 A;  2BCN B;  2IBZ E;  1Q86 Q;  4Y99 C;  4WB4 A;  3G3Z A;  2B0Z B;  4HB1 A;  3VP9 A;  1N7S B;  1VQ8 P;  4H0L C;  1H33 A;  3H1K J;  3M97 X;  1NMI A;  2GC4 D;  5AVV B;  2L4D A;  4NPF X;  1RZ5 A;  1EDL A;  1L0N J;  1MFZ A;  3F5H A;  1VQK P;  3HUS B;  5KLV E;  1QGK B;  5AW9 B;  2E74 B;  3CLQ A;  5AW8 B;  1DEE G;  1L0L E;  4CPG A;  2FBW C;  1J1D B;  2OQQ A;  5KTB A;  2N1T A;  1S5L X;  1PPJ D;  1GMJ A;  3H1L D;  5AW4 B;  2BPB B;  2KZJ A;  5CCH A;  1LT1 A;  3TK1 A;  1GQ1 A;  4YE1 A;  3HUS C;  1YHQ P;  4L3H A;  5KLV G;  2HOD B;  1S4X A;  1CI6 A;  3H1I E;  1LTI C;  3CP5 A;  1HJ3 A;  1H31 A;  1EXI A;  3M91 A;  2PCC B;  2D0W A;  1QL3 A;  4I2L C;  3SWS A;  3R4Y A;  2KS1 B;  3V2R A;  3AE3 C;  3OA8 B;  1U74 B;  4BXL A;  1FE6 A;  2HOD A;  2WSE H;  5H2F V;  3TSI A;  4FA1 A;  2E76 B;  5AVT B;  1R8E A;  1N2D C;  1XTG B;  3CXH H;  3V5B A;  5DFS A;  1MG2 D;  2P7J A;  3CXH D;  3ZOW A;  1NVO A;  2W6J H;  1K04 A;  1BDC A;  3FX0 A;  1IRV A;  1CTJ A;  4RO0 A;  3Q5S A;  1YIC A;  2E42 A;  5KKZ B;  3OJA B;  3WU2 E;  4GDO A;  2KS1 A;  3Q1M A;  2ZXX A;  2RN0 A;  3BCC G;  3V6I A;  3H1H J;  2W90 A;  3GF7 A;  4AUW A;  4PD4 H;  5CBO A;  1J2J B;  2OTJ P;  3AE7 C;  4JCG A;  1JY3 N;  1RAQ A;  3KZI E;  1VQ4 P;  5AW2 B;  1EZV D;  1YQ3 C;  2KYV A;  1J1D C;  3B5N D;  3LID A;  2K9J A;  1SQQ E;  2IX7 C;  4ZNC A;  5AVR B;  3BCC D;  3L75 J;  1BGY D;  2JWA A;  1FOS E;  1P84 D;  3Q3D A;  1ZW0 A;  1KX2 A;  1JMB A;  2OYI C;  2WIT A;  4H13 D;  3PXT A;  1JY3 O;  2B89 A;  1NJI Q;  1JCD A;  1K3G A;  3O20 A;  3TGU D;  3L74 D;  2A45 H;  5KAF H;  1L2P A;  1AKK A;  1RE3 A;  1SQB D;  1S9K D;  2A45 G;  1I8O A;  3H1J J;  1KYO W;  3MUD A;  2OTL P;  2O01 J;  1MZ4 A;  1GKS A;  2IBZ G;  1LS9 A;  3L74 J;  1BGY G;  3L75 E;  1DVV A;  1EDI A;  3MTU E;  1I8P A;  1R0Q A;  3AE2 C;  3DMI A;  3SWF A;  2IZ0 A;  5APQ A;  1YYC A;  2IYO A;  2FYN C;  2IFN A;  1SFC C;  3GHG B;  1CYJ A;  1L0N G;  1BSN A;  1MZ9 A;  1HH7 A;  1NNO A;  1N8R Q;  3NBT A;  3L36 A;  2A06 D;  1LWU A;  1M7L A;  2IBZ I;  3H1K G;  2QVA A;  3EQ2 A;  3HE4 B;  3LW5 J;  1URQ C;  3GG2 A;  2N1T B;  4PW9 B;  4H44 B;  2YKP A;  2ZZS 1;  3L71 G;  4BRY B;  4DY9 A;  1SLQ A;  4LLH A;  1HRO A;  2J5U A;  2M5A A;  3H1H E;  1URQ A;  1L0N K;  1L0N E;  1WMK A;  1CTZ A;  3A0B E;  1URQ D;  4WQ9 A;  1NYH A;  1E79 H;  3EFF K;  4LJI A;  2H7H A;  4HYT B;  2B10 B;  3CCE P;  2KB7 P;  1CSB A;  2Z5H A;  1HGZ A;  1HJB A;  3CCV P;  3D70 A;  5CIE B;  2JR8 A;  5TJH A;  1KTM A;  1FZC C;  3S1K A;  2FXP A;  3AE5 C;  3SWK A;  5CCG C;  3NMD A;  1FCD C;  3A0H V;  2JKV A;  1KQL A;  4L75 A;  3L72 J;  2E43 A;  3MUD C;  1GK6 A;  2Q3E A;  3L72 D;  1VQ6 P;  2QE7 H;  1X9V A;  3FWN A;  2QJP B;  2M8R A;  3O8Z A;  1W5C T;  3MP7 B;  2QJP C;  4EIE A;  2WT7 A;  3SFD C;  5TIS H;  2ZT9 B;  1WRG A;  4NFG B;  2LXB A;  3HQ6 A;  1K8A Q;  2AEF A;  2WSF H;  4OGQ D;  1DIP A;  2I8F A;  2P1J A;  1QYZ A;  5CCG A;  1JB0 J;  4DCK A;  1PL5 A;  1CIE A;  4PV1 D;  1ZP0 C;  4OGQ C;  1YJN P;  4EIC A;  3HQ7 A;  1VF5 C;  4QAO A;  2KK7 A;  3H6P A;  1LWU C;  1E5W A;  4D6T J;  3D6Z A;  2L5G B;  3D71 A;  1C2N A;  4Z1M H;  1KYO D;  5KAI V;  4H0L B;  2LR2 A;  3CPW O;  1CIF A;  2FFD C;  1SQX J;  3NBS A;  2FFD A;  2JDI H;  1CYC A;  2OAR A;  1RQU A;  5AVX B;  3L71 D;  2XTS B;  1YEA A;  2V7Q J;  1H88 A;  3WUI A;  1FC2 C;  4GOD A;  1I5T A;  3WUT A;  1LT9 A;  2XKM A;  4W7Y A;  3A5T A;  2D2C D;  2OYO A;  2C1D B;  1NAY A;  1JDL A;  3B8E B;  1CW5 A;  3WFC C;  4TLF A;  2WPS A;  3L73 D;  2OYI A;  4MN4 C;  1J3S A;  3AE6 C;  1OW7 A;  4RES B;  1G1J A;  5AW7 B;  2BH5 X;  1LTJ A;  2KLV A;  2K37 A;  1JUN A;  1HUC A;  1LTT C;  3L70 E;  2QG4 A;  4FA4 A;  2N9B A;  2YNY A;  1CTY A;  2O1K A;  4D6T G;  3E1I A;  1LTS C;  1SQP K;  5GTH H;  3CU4 A;  3M9B A;  3M9H A;  5BVZ A;  4AAO A;  3A0B H;  2HYN A;  1RY3 A;  2G3A A;  1OVU A;  1CRJ A;  2QJK B;  2ZON G;  1M70 A;  2N3Y A;  3H1I G;  1RF0 A;  1LC2 A;  5DJT B;  1USD A;  5KLV K;  2PCB B;  3ITK A;  1S5L H;  1N50 A;  1KIL E;  4I1L A;  3CX5 I;  2R3C A;  1P84 I;  3H1I D;  4GT1 A;  1NGM B;  3VRD A;  3G71 P;  1K73 Q;  1K3H A;  2Y0D A;  2A45 I;  1AQT A;  5B66 V;  4DT0 A;  2W83 C;  4C7N B;  4XA4 A;  3B4S A;  5B66 E;  1FZG A;  2R5D A;  2NPS D;  3RK3 E;  1S6V B;  1NTZ E;  2MHM A;  4PJ0 V;  1DVH A;  1GD2 E;  1KB9 E;  2YMY A;  5CIF B;  3FXD A;  1AA0 A;  1RQV A;  3PXS A;  4KJM A;  1NWQ A;  1L9B C;  4N78 D;  1FHB A;  5GTI H;  1ZV8 A;  1PP9 G;  4HH2 A;  3V2P A;  1AQ5 A;  2KUB A;  2ORL A;  2PAC A;  1HJ0 A;  1GU4 A;  5EXQ A;  1ZR4 A;  2E75 B;  3G4S P;  2W8Z A;  3TF5 A;  1L0L K;  1G1I A;  1U57 A;  4EI2 A;  4HKZ H;  1AV1 A;  1GW3 A;  1ZZH A;  3KZI H;  1BCC J;  4KHX A;  2Q6Q A;  1H0T A;  1H9Y A;  1LWU B;  2RKL A;  3NXS A;  4WQ7 A;  4AQR D;  1YI2 P;  1NHL A;  1KFN A;  2C0W A;  5B66 H;  1OWA A;  3HE5 A;  1S72 P;  1H32 A;  2J58 A;  3H1L J;  1M1J A;  3FWL A;  3S4R A;  3UIA A;  4WQC A;  5B6Q A;  4PWA A;  4XE5 B;  3VP8 A;  1M8O B;  1B7V A;  1H0T B;  4EIJ A;  155C A;  2DVH A;  4ZKP A;  4PV1 C;  3MHV A;  4H0L D;  2BGV X;  1RZ6 A;  1BCC E;  2AXT E;  1DX7 A;  1HJ4 A;  3CCM P;  1M60 A;  1FDI A;  4WY4 A;  2E74 C;  3C1L A;  2HPC B;  4K35 A;  1J1E C;  3C9I A;  2ZVO B;  2BH4 X;  3SFE C;  4LC1 A;  5CYT R;  3S9O A;  1XTC C;  1GJQ A;  1CYI A;  1SQX D;  3IF4 A;  3KXD A;  2CE0 A;  3OAK A;  2WPV B;  1BCC G;  4OH8 B;  4DOJ A;  2NPS A;  1COR A;  2Y0E A;  3RK3 C;  1CNO A;  1PGO A;  3O6Q A;  1SQB J;  1RHZ B;  3N7N A;  351C A;  4BWN A;  1A02 F;  5APU A;  3V2N A;  1CCH A;  1OW6 A;  1S2E A;  3P8M C;  1EC5 A;  4N6J A;  1OIP A;  3T97 B;  1VQM P;  1KMI Z;  1SQP D;  3II6 A;  2FY8 A;  2L91 A;  1PGQ A;  3CC7 P;  1AVY A;  2Q3I A;  1DIQ C;  1SQP J;  1H31 B;  5KAI H;  4GYD A;  3WMM 0;  2KOG A;  1RH5 B;  2YMK A;  1OMI A;  1VL2 A;  1VDF A;  1DD4 A;  4TT3 H;  3O0R C;  1MFT A;  2IYP A;  4QMA A;  1HWT C;  3E1R A;  2WPR A;  2V4H A;  2C9X B;  4RSZ A;  4EDF A;  1EZV I;  3PTZ A;  3BRV B;  3GW6 A;  2YKQ A;  5C39 A;  1KC8 Q;  2CK3 H;  3OA8 A;  2W27 A;  2YQB A;  1CXC A;  1KIL B;  3ZIY A;  4O1W A;  1CZQ A;  3CC4 P;  3H32 B;  3MD0 A;  3OW2 O;  4RJT A;  5CHX A;  3WU2 V;  2DW3 A;  4B86 A;  1RF1 A;  4AAN A;  3H1I J;  2XV5 A;  1JTH A;  1QL2 A;  4C46 A;  1G2C A;  4AYC A;  4PD4 E;  4JYC A;  1FDM A;  2E5T A;  2FRC A;  4FA9 A;  1C7M A;  2HFE D;  5GTI E;  4GOE A;  4Y5R A;  1KQF B;  3CCJ P;  1DW2 A;  3ZOY A;  3OA7 A;  1AOF A;  5AVS B;  2E75 D;  1OAE A;  5B5E H;  5E79 E;  2YIU C;  1AJY A;  5BU5 A;  1Y9B A;  3VMA A;  2WT7 B;  2PAJ A;  4UB8 H;  2WZ7 A;  1YQ4 C;  1VQO P;  1N15 A;  1KB0 A;  2OTK E;  2D2C C;  3DP5 A;  1ZRT D;  2GIW A;  1H9X A;  1H1O A;  2O01 H;  1FZF A;  2XU6 A;  1ZLL A;  3L70 J;  3IN6 A;  2OYH B;  5GTH E;  1NTM G;  1NIR A;  4N78 E;  1MKM A;  2GM4 A;  4L73 A;  2ZXY A;  1FS0 E;  5C0Z A;  2B88 A;  3VMX A;  2BCC G;  2B87 B;  3A2A A;  3RK3 D;  1NH4 A;  2AEM A;  1IZL 0;  5L8R J;  2JWD A;  4R4M A;  2E74 D;  1FBM A;  2Y9Y A;  3L4F A;  1PPJ G;  1L0N D;  3JC2 2;  2AXC A;  3VMY A;  1VPC A;  2FWL A;  3L75 G;  3USS A;  1CHJ A;  4WQ8 A;  1X8Y A;  4NPD A;  3RL0 D;  1L9J C;  1RF0 C;  1NKN A;  1LP1 B;  1KX7 A;  1ZOY C;  2GC7 D;  3GMA A;  3A0H H;  4UB6 H;  1C6R A;  4HJG H;  1NTK G;  3PXW A;  1E8E A;  4O9B A;  2E76 C;  1C52 A;  2V07 A;  3CMA P;  4W80 A;  3CWB J;  3TGU G;  2FYU K;  2K88 A;  2SPZ A;  1YIJ P;  1KV4 A;  1U75 B;  3CXH W;  4IFF A;  2QJK C;  1ETP A;  1SQX E;  1I55 A;  5CIC B;  1QVF O;  1CC5 A;  4WVZ A;  1YFC A;  4OWF A;  2WQY C;  5B5E E;  4N3Y B;  1W2L A;  5K5G B;  1L4A B;  2FYN B;  1HTL C;  3AEA C;  1JY3 P;  1SQP G;  2WVR A;  4A7P A;  3K5B A;  3PHL A;  1P84 H;  1SQV G;  2O3J A;  2KIK A;  3HD7 A;  3Q5P A;  3A9F A;  3TDK A;  2W6A A;  1GL2 A;  3PLN A;  5KJ7 A;  4FAN A;  1IQC A;  1IZN B;  1TU3 F;  1HBW A;  3PH0 A;  2QA4 P;  2AEJ A;  3CCR P;  5C9M A;  3VTP C;  3L35 A;  3OCD B;  1DH3 A;  1T2K C;  1GTW A;  2E75 C;  4PD4 I;  2CA3 B;  4WBA A;  3VOP A;  3O5C A;  3EWK A;  3HE4 A;  1ZRT E;  4IL6 H;  1EZV E;  3VN0 A;  1A8C A;  1QKS A;  1L4A D;  3RK2 B;  1KYO I;  1L0L G;  2A06 G;  3TGU J;  1C75 A;  5KAI E;  1C2R A;  3MK7 B;  1R5L A;  1S3J A;  2LXC B;  1LC1 A;  1HRC A;  2CE1 A;  1BGY E;  3L71 J;  1QX8 A;  1M90 Q;  4IL6 X;  1WT6 A;  1N90 A;  2R3S A;  1CSU A;  2H88 C;  2KI7 B;  3LW5 H;  3ABV C;  2WSE J;  1BL9 A;  1MUU A;  1R5S A;  1BE3 D;  4ZMD A;  4D6T D;  3HRN A;  1VQL P;  1DEB A;  1ZR2 A;  3L4O A;  2IFM A;  1SQV E;  4WY4 C;  5AW3 B;  1JY2 P;  2QSI A;  4JF7 A;  3PH2 B;  3HD7 D;  2FFD B;  1NTM K;  1Y47 A;  3I55 P;  3MZW B;  1KOR A;  1OVV A;  2FXO A;  2N18 C;  3TNU B;  2PFX A;  1DW0 A;  4DJG A;  4EYY Q;  1LT9 C;  1NOH A;  2I1K A;  4JYB A;  1IRW A;  3A7O A;  2OYI B;  1HJ5 A;  2IDB A;  5M1B A;  3M0D A;  4C7N A;  1SQX K;  2K9J B;  1GU5 A;  1PIX A;  3L73 G;  2DGE A;  1K9M Q;  3GHG A;  1YBK A;  4UB8 V;  1SP4 A;  4I6M C;  3H32 A;  3RL0 g;  2MKV A;  3CL3 D;  1IFM A;  4UB8 E;  3SXT A;  2FYU E;  1CI6 B;  1KD1 Q;  3HQ9 A;  2D2C B;  1JY2 N;  2E76 D;  2ZAE B;  1LTG C;  1M1K Q;  3H25 A;  1LJ2 A;  2ZYD A;  1EDJ A;  4YPC A;  1KFM A;  4BRY A;  1JOC A;  2CPS A;  1NU1 G;  2POH A;  5CJ0 A;  1OCD A;  3CCQ P;  2FYU D;  3L73 E;  3W67 A;  4W7Z A;  1NTK K;  2N3B A;  3JSV C;  5CCG D;  1S5L E;  1PFI A;  3HUS A;  1L0L D;  4U7J A;  5CIH B;  5KLV D;  3P7K A;  1SFC A;  3AED C;  2PGD A;  1NTK D;  1GK4 A;  1AFO A;  4FAV A;  1VQN P;  2C9N Y;  2LKM A;  1JEK A;  2LIR A;  1M57 D;  2OYH A;  2BAS A;  3AEF C;  3KDP B;  2C0X A;  2XNX A;  3R2P A;  1ZXG A;  1CHI A;  1W2B O;  2NPS C;  3ZDM A;  2JP3 A;  4EID A;  2ZYA A;  1Q90 D;  1NTM D;  1URQ B;  3VYI A;  1KYO E;  3HQ8 A;  2H43 A;  1I6D A;  2I8D A;  1LFM A;  1M6Z A;  4AAM A;  3AE4 C;  3QWO C;  2ZXE B;  2LIT A;  3FGA D;  3C8V A;  3L73 J;  1K05 A;  1PP9 E;  1QN2 A;  1NAF A;  4PJ0 H;  2YIU B;  3L74 G;  1AYG A;  1MV8 A;  3AE9 C;  4I7Z C;  2C8S A;  2YKO A;  3TYI A;  1BE3 J;  1NU1 E;  1PGJ A;  1SQB G;  1FJ0 A;  5TIS V;  1F1F A;  3MK7 C;  3HD7 C;  1KB9 H;  2V7Q H;  4WQA A;  3A3Y B;  2H89 C;  4U3F E;  3WFB C;  2ZVN B;  1T2K D;  1CSV A;  2JEE A;  1JTH B;  3L72 E;  2IZ1 A;  1N7S A;  3BRT B;  2QEX P;  1OZH A;  1L4A C;  3WFD C;  3C2C A;  3KYQ A;  1LNQ A;  4ZKU A;  3IFM A;  1EZV G;  2Z4E A;  4P4Q B;  4WWI A;  2HG5 D;  3CX5 H;  4IFM A;  4H0K A;  1FDO A;  2JTI B;  3O1Y A;  3CI9 A;  1W5C E;  3L70 D;  1GIW A;  1MG3 D;  2R5B A;  3AEE C;  3TNU A;  2VHD A;  1EXJ A;  4IFD K;  1RF1 C;  1GU2 A;  2BLF B;  1Q81 Q;  2P58 A;  3H1H G;  2JO1 A;  2VRS A;  3U59 A;  1N73 B;  3BCC J;  1GL2 B;  1FI3 A;  4NPE A;  2WSF J;  3P8C E;  4RKU J;  2ZT9 C;  1ZN5 A;  2BCC D;  4IL6 V;  3V2Q A;  1GDV A;  4WQD A;  3L70 G;  3RBZ A;  2P2U A;  5APY A;  1RAP A;  5DJQ C;  1PV3 A;  1HCM A;  2EXV A;  1RF1 B;  5AVQ B;  1C6S A;  1YIQ A;  1RE4 C;  4D6T E;  4L76 A;  2RMZ A;  3JCU H;  5AUR A;  1N86 A;  1SQB E;  1FOC A;  1PGP A;  1YJW P;  3PP5 A;  3TGU E;  4L1Q A;  3H1L E;  3RL0 C;  1N9C A;  2OGU A;  3ORV A;  2ZFC A;  2Y9Z A;  3D0W A;  2YXQ B;  3A0H E;  1YTC A;  2P10 A;  1T3J A;  1IFP A;  3IAO A;  1FOS F;  1CRG A;  5CCH C;  2ZBO A;  2B12 B;  2WWW A;  1PZQ A;  2A06 E;  3B71 A;  3RBX A;  1YTZ I;  2GA1 A;  2H8P D;  1IK9 A;  1VQ5 P;  4GOF A;  2HV4 A;  1NTZ J;  4AAL A;  2JJL A;  1SQQ G;  5APV A;  5AVU B;  1DD3 A;  3M06 A;  4U3F G;  1I6E A;  1KQS O;  3CYT I;  1X79 B;  4WQE A;  2KNC A;  1FZA A;  2ZJS E;  1CRY A;  3G6E P;  1VYD A;  4YXD C;  1CRC A;  1HVV A;  3G9R A;  4U3F D;  2XZR A;  1KIB A;  4H13 C;  1P84 E;  4EOT A;  1JY2 O;  1NTZ K;  3VMZ A;  2B87 A;  3NWV A;  1SQQ K;  1CSX A;  3CWB D;  3VNW A;  2YCC A;  2QIW A;  2PP6 A;  451C A;  4I7Z B;  3ZCF A;  1NKZ B;  3B5N A;  2ITA A;  2R44 A;  3IR9 A;  5DJQ B;  2N9J A;  1QEX A;  4JPZ B;  4L3G A;  2R32 A;  1N7L A;  3O6Q B;  1NML A;  5CMZ A;  2JQR A;  2K1A A;  4MU8 A;  1LGH B;  1YEB A;  3E7K A;  3WU2 H;  4KT0 J;  4JQ0 D;  1IFJ A;  2GB8 B;  1JCC A;  1IO4 A;  2AIU A;  2KZI A;  3V4Q A;  4GKG A;  2M5A B;  3D6Y A;  1NTM J;  1FJK A;  1VQ9 P;  1VQP P;  2Q9I A;  2CA4 B;  5CIB B;  3RMZ A;  3EFG A;  1IFD A;  3GLM A;  1VQ7 P;  1CRH A;  4DZO A;  2KSJ A;  2NRG A;  1IC2 A;  2N1T C;  3GHG C;  2P67 A;  4UB6 E;  1WVE C;  1IJD B;  4XYD B;  1X22 A;  4XFJ A;  3H1K D;  1L4A A;  3HTK B;  1N73 C;  2AI5 A;  1AVO A;  3CX5 E;  1KIL D;  2BEZ F;  1HF9 A;  3AEC C;  3CD6 P;  1SQV J;  2Y0C A;  4OVN F;  2MTA C;  2C1U A;  3RK3 B;  3ZBM A;  3NFQ A;  3JBT B;  4V2K A;  5DF5 A;  2O1J A;  1H89 A;  2Q5U A;  2UWJ E;  1UIX A;  4K3I A;  5KKZ C;  3P32 A;  5APW A;  2HLO A;  1L0L J;  1SQP E;  2WPQ A;  2C1V A;  1U7J A;  1LMS A;  4M3L A;  1USE A;  3H1H D;  3TYY A;  3KPE A;  4O1Q A;  1BE3 E;  1KV9 A;  1NU1 J;  1KN7 A;  2M3B A;  1CSW A;  3X39 A;  5AVW B;  1KB9 I;  3HTK A;  1LT9 B;  2CPB A;  1NTZ G;  5EFW B;  2YXR B;  2C1D A;  4PD4 D;  4H44 C;  2M3E A;  3KQG A;  3CC2 P;  2O01 N;  3SWY A;  3QH9 A;  1LTJ C;  2B9B A;  2QM8 A;  4WY4 B;  1FI7 A;  5APX A;  4L74 A;  1KQG B;  3L37 A;  3V4W A;  3SJL A;  3WUV A;  2D0S A;  3AEB C;  1LP1 A;  2CXB A;  3SSU A;  3HD7 B;  1SQV K;  2FKW B;  1GL2 C;  5KJ7 C;  1FZC B;  4H13 B;  1WEJ F;  2YK3 A;  1S9K E;  1IK7 A;  1H33 B;  3F89 A;  3L74 E;  1YCC A;  2ZOO A;  1GL2 D;  5KJ7 D;  2Q1K A;  1JO5 A;  1BDD A;  1G2C B;  3CME P;  5DJU B;  3B5N B;  1A56 A;  1N7S C;  5E79 H;  1SQB K;  1Q7Y Q;  1NO4 A;  1LTA C;  3WFE C;  3PRJ A;  3BCC E;  1HZV A;  1YIT P;  1F1C A;  1CCR A;  3ZOX A;  1J1E B;  1U7M A;  3CXH E;  1JM0 A;  1T3U A;  4AX3 A;  1HGV A;  2GUV A;  4YXW H;  2C2C A;  4J20 A;  1KIL C;  3A0B V;  3KHU A;  2BCC J;  1QLE D;  3GF3 A;  5B5E V;  4N0K A;  3CCS P;  1QL1 A;  4R4L A;  3I5C A;  1JNM A;  2N9Y B;  5CBN A;  4C7R A;  4WY4 D;  4ASV A;  2WSC J;  2KP8 A;  5KLI C;  1UII A;  4UB6 V;  2XND H;  5AVY B;  1CRI A;  1OVR A;  4JBZ A;  1QVG O;  3CX5 D;  5KLI B;  1FZB A;  3H1J D;  2KXP B;  3RK2 C;  1CO6 A;  1LTJ B;  3H1J E;  1OX3 A;  1CHH A;  1OXZ A;  2HR3 A;  1YJ9 P;  2K9Y A;  3CXH I;  5E79 V;  3M9Q A;  2N9I A;  1X0T A;  4Y99 B;  1Q82 Q;  1DII C;  2OZ1 B;  1COT A;  1HH0 A;  2XDJ A;  3RLM A;  2K3R A;  1PP9 J;  2M0B A;  1RE4 A;  3L71 E;  3BVH A;  3HE5 B;  3RN0 A;  1LTB C;  1M1J B;  2YO2 A;  5CJ4 A;  3U1C A;  3PJS K; 
#chains in the Genus database with same CATH homology
 1GKS A;  5GTH V;  3WFB C;  4KMG A;  1LS9 A;  1CSV A;  1DVV A;  3O0R C;  1I8P A;  1R0Q A;  3ZOO A;  3DMI A;  1CED A;  2C9X B;  1S5L V;  4RSZ A;  3WFD C;  4EDF A;  1C6O A;  3C2C A;  1CYJ A;  1I54 A;  3KZI V;  3PTZ A;  3GW6 A;  1HH7 A;  4P4Q B;  1FI9 A;  1NNO A;  3CX5 W;  3OA8 A;  3NBT A;  2YQB A;  4H0K A;  1CXC A;  3ZIY A;  2JTI B;  4O1W A;  3O1Y A;  2A06 D;  2QJY B;  1BCC D;  3L70 D;  4RJT A;  1GIW A;  1MG3 D;  3SLE A;  3WU2 V;  4FB1 A;  3GG2 A;  2VHD A;  4PW9 B;  4AAN A;  2ZZS 1;  4DY9 A;  1GU2 A;  2BLF B;  1HRO A;  1CTZ A;  3RN1 A;  1EB7 A;  1KB9 D;  1FI3 A;  4WQ9 A;  2BCC D;  1YNR A;  5CID B;  4IL6 V;  2FRC A;  1H32 B;  3DR0 A;  4FA9 A;  4LJI A;  1C7M A;  1GDV A;  4Y5R A;  4EIF A;  2B10 B;  4WQD A;  1DW2 A;  5GTI V;  3VYM A;  3ZOY A;  1AOF A;  1RAP A;  5DJQ C;  1HCM A;  2EXV A;  1OAE A;  4H0J A;  5CIE B;  1C6S A;  1YIQ A;  1DW1 A;  5TJH A;  2V08 A;  3VMA A;  1IO3 A;  3SVW A;  2RMZ A;  1CIG A;  5AUR A;  1FOC A;  1N15 A;  1KB0 A;  4L1Q A;  3DP5 A;  1FCD C;  1N9C A;  3A0H V;  1NU1 D;  1ZRT D;  1DW3 A;  3ORV A;  2GIW A;  1YTC A;  1H9X A;  1H1O A;  4FA5 A;  2Q3E A;  1AOQ A;  3L72 D;  1CRG A;  4GED B;  1CIH A;  2ZBO A;  2B12 B;  1NIR A;  3L4M A;  2AXT V;  2QJP B;  2ZXY A;  5C0Z A;  1W5C T;  2HV4 A;  4AAL A;  2B11 B;  1I6E A;  4EIE A;  3CYT I;  4WQE A;  1IZL 0;  4Q5P A;  1E29 A;  1CRY A;  1L0N D;  1VYD A;  4NFG B;  1CRC A;  2FWL A;  4U3F D;  1KIB A;  1CHJ A;  3HQ6 A;  4WQ8 A;  1L9J C;  3NWV A;  2I8F A;  1QYZ A;  2B4Z A;  1CSX A;  3CWB D;  1CIE A;  1KX7 A;  2KNC B;  2GC7 D;  3VNW A;  2YCC A;  4EIC A;  451C A;  3HQ7 A;  3ZCF A;  1C6R A;  3PXW A;  5DJQ B;  1E8E A;  2N9J A;  4QAO A;  4L3G A;  1C52 A;  2V07 A;  1NML A;  2JQR A;  1C2N A;  4MU8 A;  1KYO D;  5KAI V;  1YEB A;  1U75 B;  1CIF A;  2OZ1 A;  3CXH W;  2GB8 B;  1ETP A;  1I55 A;  5CIC B;  1CC5 A;  3NBS A;  2AIU A;  1YFC A;  2N18 B;  1W2L A;  5KAF V;  1E2R A;  1A2S A;  2FYN B;  1CYC A;  4XXL A;  4A7P A;  3L71 D;  2XTS B;  1YEA A;  2CA4 B;  3PHL A;  5CIB B;  1PP9 D;  3RMZ A;  3WUI A;  1HZU A;  5CIG B;  2O3J A;  3A9F A;  3OCD A;  3TDK A;  1I5T A;  3PLN A;  3L75 D;  4WQB A;  1CRH A;  4FAN A;  1IQC A;  2C1D B;  1SQV D;  1WVE C;  4XYD B;  3H1K D;  5C9M A;  5IY5 1;  1JDL A;  3OCD B;  3WFC C;  2AI5 A;  1NTZ D;  3L73 D;  3WC8 A;  1SQQ D;  1J3S A;  2CA3 B;  3O5C A;  2BH5 X;  1A8C A;  2Y0C A;  2MTA C;  1QKS A;  1CXA A;  2C1U A;  3ZBM A;  2QG4 A;  2IBZ D;  1C75 A;  4FA4 A;  3JBT B;  4V2K A;  5DF5 A;  1DT1 A;  1CTY A;  1QL4 A;  1C2R A;  3MK7 B;  3CU4 A;  1LC1 A;  1HRC A;  2CE1 A;  4AAO A;  2BCN B;  1CRJ A;  4K3I A;  2QJK B;  2ZON G;  1M70 A;  2N3Y A;  1N90 A;  1CSU A;  1LC2 A;  2B0Z B;  2PCB B;  3ITK A;  1N50 A;  1H33 A;  3M97 X;  1NMI A;  1BL9 A;  2C1V A;  2GC4 D;  1LMS A;  1BE3 D;  4D6T D;  2L4D A;  3H1I D;  1RZ5 A;  3L4O A;  3VRD A;  3H1H D;  4O1Q A;  1K3H A;  2Y0D A;  1KV9 A;  5B66 V;  3PH2 B;  1CSW A;  3X39 A;  2N18 C;  1S6V B;  2MHM A;  4PJ0 V;  1DVH A;  1DW0 A;  1PPJ D;  2C1D A;  4PD4 D;  3H1L D;  2BPB B;  5CIF B;  1GQ1 A;  3PXS A;  4YE1 A;  1IRW A;  4L3H A;  1L9B C;  1FHB A;  1HJ5 A;  1FI7 A;  3CP5 A;  1HJ3 A;  1H31 A;  2ORL A;  2PAC A;  2K9J B;  2PCC B;  5EXQ A;  2D0W A;  3SJL A;  3TF5 A;  1QL3 A;  2DGE A;  4UB8 V;  2D0S A;  3SWS A;  2CXB A;  1WEJ F;  2YK3 A;  1ZZH A;  3SXT A;  3OA8 B;  1H33 B;  1U74 B;  5H2F V;  3HQ9 A;  1H9Y A;  4FA1 A;  1YCC A;  2ZOO A;  4WQ7 A;  5DFS A;  1MG2 D;  3CXH D;  3ZOW A;  1H32 A;  1A56 A;  1IRV A;  3FWL A;  1CTJ A;  1OCD A;  2FYU D;  4WQC A;  5B6Q A;  4PWA A;  3WFE C;  1YIC A;  3PRJ A;  1HZV A;  5KKZ B;  1B7V A;  1F1C A;  2N3B A;  1CCR A;  3ZOX A;  155C A;  2KS1 A;  2DVH A;  4AX3 A;  2BGV X;  1L0L D;  2RN0 A;  2C2C A;  5CIH B;  1RZ6 A;  5KLV D;  4J20 A;  3A0B V;  3KHU A;  1NTK D;  5B5E V;  4N0K A;  1HJ4 A;  1M60 A;  4FAV A;  4JCG A;  1RAQ A;  2N9Y B;  2LIR A;  1EZV D;  2BH4 X;  5CYT R;  4UB6 V;  1CRI A;  1GJQ A;  1CHI A;  1CYI A;  1SQX D;  2CE0 A;  3CX5 D;  5KLI B;  3BCC D;  4EID A;  1BGY D;  2JWA A;  1NTM D;  3H1J D;  1P84 D;  1COR A;  1CO6 A;  2Y0E A;  3HQ8 A;  1CHH A;  1CNO A;  1I6D A;  1LFM A;  1KX2 A;  5E79 V;  1M6Z A;  3PXT A;  2N9I A;  351C A;  4AAM A;  1DII C;  2OZ1 B;  1COT A;  2LIT A;  1QN2 A;  3RLM A;  1CCH A;  1K3G A;  2YIU B;  1AYG A;  3O20 A;  3TGU D;  3L74 D;  1SQP D;  2L91 A;  2C8S A;  1AKK A;  3RN0 A;  1SQB D;  3TYI A;  1FJ0 A;  5TIS V;  1DIQ C;  1F1F A;  3MK7 C;  1H31 B;  1I8O A;  1KYO W;  4GYD A;  1MZ4 A;  4WQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...