1BE3D

Cytochrome bc1 complex from bovine
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 61
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1be3D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1be3D01
1CRHA 1CYCA 3PH2B 1C52A 3HQ6A 4EICA 1H1OA 2C9XB 1P84D 3HQ7A 1A8CA 2ORLA 4WQEA 3CU4A 2B0ZB 4QAOA 3CWBD 1RAQA 1CTJA 1H9XA 2JTIB 1AYGA 1CHJA 1CSXA 4L1QA 2YQBA 5KKZB 4FA9A 1FI9A 5CYTR 1K3HA 5CIDB 2QJPB 1C2RA 1B7VA 3NBSA 1LC1A 1CCRA 1FI3A 3DP5A 5GTIV 2PACA 3PXSA 3PTZA 2K9JB 4PD4D 1CIHA 1LC2A 1JDLA 4WQ9A 1CHIA 1L0LD 2ZBOA 1HZVA 1MG2D 1IRWA 1DW3A 5DF5A 2QJYB 5C9MA 2IBZD 1CRYA 1A2SA 1SQXD 1CSVA 1QL4A 4MU8A 3M97X 1W2LA 2QJKB 1A56A 3O20A 1KYOW 4FANA 1I6DA 1WEJF 1QL3A 2B10B 3L72D 2C1DA 5KLIB 4FA1A 3L71D 2GIWA 4V2KA 3WFDC 2N18B 1CRGA 5CIEB 3CXHW 1CXAA 155CA 4EDFA 1NTZD 1RZ5A 5KAIV 4O1QA 5TISV 5DJQC 1KX7A 3C2CA 2GC7D 1CHHA 3VNWA 2V07A 1FI7A 4FA5A 5C0ZA 1CXCA 3VMAA 1I54A 1LFMA 1HRCA 4FAVA 3PRJA 3OA8B 1M60A 3MK7C 3ZOWA 1KB0A 1L9JC 3CP5A 3SVWA 5B6QA 2N3BA 2QG4A 1HJ4A 4O1WA 1CIEA 1CYIA 1FCDC 2Y0EA 4EIFA 4K3IA 3VYMA 5H2FV 4JCGA 3WFBC 1YFCA 2YCCA 1YCCA 4EIEA 1I6EA 3L70D 1NIRA 3A0HV 2MHMA 3RMZA 3A0BV 2KS1A 3NWVA 1NNOA 4WQ7A 1M6ZA 1SQBD 5CIFB 3O5CA 3H1HD 3PHLA 5EXQA 3ZOXA 2CXBA 1H33A 3O0RC 2XTSB 2B11B 4YE1A 1DIQC 1VYDA 2C1UA 3L4OA 1LS9A 1YICA 1NTKD 1EZVD 2BLFB 1HJ3A 1AKKA 1CTYA 3DR0A 5CIGB 4U3FD 3CX5D 4A7PA 2N9YB 1IQCA 1OAEA 2Q3EA 3SXTA 2BPBB 4J20A 4RJTA 1N15A 1PP9D 3ZBMA 5CIBB 1IZL0 2BCCD 2VHDA 1CIFA 1YEAA 3HQ8A 1H32B 2FWLA 3KHUA 3X39A 1H9YA 1CNOA 1CYJA 3WC8A 5B5EV 2N3YA 2BCNB 3SLEA 1J3SA 1HCMA 2BGVX 3RN0A 1QYZA 3H1LD 4KMGA 1WVEC 4P4QB 1KX2A 1NMIA 2O3JA 1L0ND 3PXTA 1C7MA 2L91A 3O1YA 1SQQD 1KV9A 3GW6A 1DVHA 2AIUA 2CE1A 4AANA 2FRCA 4UB6V 4WQAA 3JBTB 3WU2V 2OZ1B 1DIIC 1RZ6A 3ORVA 2C2CA 1NMLA 4UB8V 1IO3A 4PW9B 4PJ0V 3ZCFA 5KLVD 2I8FA 1C6OA 3ITKA 1N50A 2MTAC 1E8EA 1SQVD 1F1CA 1EB7A 1H31B 4NFGB 1MZ4A 1CSUA 5KAFV 2Y0CA 1KYOD 2GB8B 1F1FA 2A06D 2BH5X 3OCDB 1QKSA 3KZIV 1E2RA 2GC4D 3CYTI 4L3GA 1CIGA 1KB9D 2N18C 1GJQA 3OA8A 1DT1A 5TJHA 4Q5PA 2YK3A 5DFSA 1LMSA 2ZONG 1CORA 2C1VA 3L75D 4Y5RA 1CTZA 1ZZHA 5B66V 2AXTV 2HV4A 1N90A 1FJ0A 3BCCD 1NTMD 3H1JD 2B4ZA 4AAOA 4AALA 351CA 2AI5A 5CICB 2JWAA 1FOCA 3TYIA 1CRCA 2B12B 1CSWA 1RAPA 1CO6A 1NU1D 1R0QA 4N0KA 3ZOOA 2N9IA 1BCCD 4AX3A 4FA4A 3FWLA 1PPJD 3WFEC 1MG3D 1DW2A 4XYDB 1K3GA 3L74D 4WQBA 1DW0A 1U75B 1DW1A 4H0JA 4RSZA 1OCDA 3SJLA 1GU2A 2CA4B 3DMIA 4WQDA 4FB1A 1GIWA 1HZUA 2YIUB 4PWAA 1AOQA 1I5TA 4GYDA 3VRDA 4EIDA 2FYUD 1I8OA 1IRVA 2FYNB 2ZZS1 1SQPD 1FHBA 1CC5A 1YEBA 1BL9A 3TGUD 5DJQB 2JQRA 5GTHV 2PCBB 1H32A 1CEDA 1C6SA 3PLNA 4D6TD 1ZRTD 3TDKA 1GKSA 3RLMA 2C1DB 4WQCA 2PCCB 1C2NA 2C8SA 3PXWA 1GDVA 2D0WA 1YNRA 4L3HA 2D0SA 4LJIA 3MK7B 1AOFA 1L9BC 1KIBA 2L4DA 2LITA 4GEDB 1BGYD 1GQ1A 1ETPA 1S6VB 1CRIA 2OZ1A 2LIRA 3SWSA 1S5LV 3TF5A 5IY51 3L73D 1COTA 3RN1A 2DVHA 2ZXYA 3WUIA 2EXVA 3ZIYA 1CRJA 1C75A 1U74B 1HJ5A 2KNCB 3CXHD 3H1ID 3ZOYA 1H31A 1C6RA 3A9FA 1BE3D 1E29A 2DGEA 2CE0A 2RMZA 2V08A 1YTCA 3OCDA 4XXLA 3NBTA 1HROA 4WQ8A 4IL6V 1M70A 1HH7A 4H0KA 5E79V 1CCHA 1I8PA 1W5CT 1I55A 2RN0A 2Y0DA 3H1KD 4DY9A 3CX5W 1YIQA 2BH4X 3GG2A 451CA 2ZOOA 1DVVA 5AURA 1QN2A 4AAMA 3WFCC 5CIHB 2CA3B 1H33B 1N9CA 3HQ9A 3L4MA 2N9JA
chains in the Genus database with same CATH superfamily
3PH2B 1C52A 5C39A 1PP9G 3HQ6A 4EICA 4JBZA 1H1OA 1P84D 3AE9C 1YJ9P 1W2EA 3A5TA 1CTJA 1AYGA 1SQVJ 1CSXA 1GK6A 4L1QA 2IBZG 4FA9A 1K3HA 3T97A 1B7VA 3NBSA 2HODB 3NTNA 1JY2N 2C0WA 1CCRA 1FI3A 2MKVA 5CCGD 3L71G 3PTZA 1FS0E 2OGUA 1N8RQ 1NJIQ 3I56P 2WWWA 2V7QH 2YMYA 2Y9YA 1A02F 3IFMA 1SQPE 1HH0A 4ZNCA 2IBZI 1MG2D 3VTPC 2QIWA 1ZLLA 4C7RA 1LTIC 3OJAB 5DF5A 4IFDK 3TGUE 2YMKA 3O20A 5APTA 4FANA 1I6DA 2YIUC 3L72D 5KLIB 1BCCJ 2GIWA 1JOCA 1JY2P 1SQXE 4ZKUA 155CA 1NTZD 3G4SP 1MUUA 3H6PA 3HD7B 3AE7C 1H88A 1X8YA 2POHA 3VNWA 3P8MC 5C0ZA 5AW8B 4PV1D 1HRCA 4FAVA 1SQBG 1S4XA 3OA8B 3H1HG 3JCUH 1RQUA 1KB9I 1L4AB 2AEJA 3CP5A 2HPCB 3H1IE 2N3BA 3MTUE 2Y0EA 1FCDC 3VYMA 1G2CB 1GK4A 5KJ7A 2YCCA 4JQ0D 2OARA 2V7QJ 1KQFB 1I6EA 3L70D 2KSEA 3HD7C 2O01N 1PGOA 3H1KE 3L36A 4DZOA 1IO4A 5TISH 3RMZA 3SWFA 5AVXB 1PZQA 1ZR4A 3NWVA 2B89A 3HUSB 3R4YA 2OTKE 3PHLA 1N7LA 2R5DA 3CC7P 1RF0C 4R4MA 1H33A 1DIQC 1VYDA 3CD6P 3B8EB 3CMAP 2FYUG 1LS9A 1YICA 1MFZA 3VP9A 1NTKD 3GF3A 4WY4A 4I6MC 5E79H 3L73J 4U3FD 4A7PA 2QM8A 2N9YB 1FZEA 5BU8B 1JM0A 3V2QA 1OAEA 1OZHA 2B87B 3KDPB 2OYIB 1M1JA 1KD1Q 1YTZI 2IPPA 1L0NG 1VQ5P 2HR3A 1N15A 3CCVP 2M5AB 1PP9D 1MKMA 1YJNP 2ZFCA 1H32B 3KHUA 4PD4E 5H2FE 3X39A 1YYCA 1BGYG 1LWUA 1H9YA 1VQMP 1CNOA 5B5EV 2BCCE 2N3YA 5KKZC 2JP3A 3SLEA 3A0HE 1J3SA 2C0XA 1NVOA 4N78E 2ZVNB 1LTTC 1OMIA 1NKNA 1C7MA 1PL5A 1H0TA 3GW6A 2AIUA 2CE1A 1VQNP 3WU2V 1VQOP 2OZ1B 5APWA 2K1AA 2Q5UA 3EQ2A 2WT7B 3LIEA 1GTWA 1SQQE 3CLQA 3L75G 1VF5D 1IFJA 1YHQP 3ITKA 1ZN5A 1AJYA 1Q90D 4JYBA 1H31B 3KQGA 1EDJA 1M7LA 5KAFV 3RL0D 1KYOD 3PH0A 2OYHC 1JUNA 3SWKA 2A06D 1KQSO 3EWKA 1QKSA 1NU1G 2GC4D 2WTYA 1KB9D 2ZJSE 1YI2P 3TNUA 2WSFH 3CCQP 5TJHA 2KI7B 1L0LJ 2R44A 3I5CA 1RF1B 2YK3A 2E74C 2PGDA 3HTKB 3L74G 1Y47A 2KP8A 3HE4A 1GL2D 3S4RA 3AEGC 1N90A 1LTJA 2E5YA 3BCCD 1URQD 1YTZT 1AQ5A 4GOFA 3Q3DA 2B4ZA 2E75D 4CPGA 5KLVK 2FXMA 4H13D 2AI5A 3RL0B 3L71J 1CRCA 2B12B 4UB6E 1CO6A 3M9QA 1JY3O 4YTPC 4N0KA 1S9KE 2Y9ZA 2QEXP 3AEDC 4AX3A 3MGNA 4UB8E 1X0TA 1MG3D 2YNYA 3AECC 1USDA 4L74A 1S2EA 2BASA 1DW1A 1QLED 4H0JA 1OCDA 5AW5B 1GL2B 1PPJE 3LIDA 1URQB 2RKLA 3AE3C 2CA4B 2E75B 1OW7A 3CCMP 2AXTH 4H13B 1GIWA 2N1TC 2CPBA 3AEAC 2FYUD 1IRVA 2FYNB 2B9BA 1SQPD 1QVGO 1J1DB 1SFCC 4I2LC 5AVZB 2KLVA 1JTHB 2WSFJ 3TGUD 1UIIA 3EFFK 1CEDA 2KSJA 1JCCA 1U7JA 4WQCA 1IFPA 1SQBJ 1C2NA 2C8SA 3H1HJ 2O1JA 3GHGA 2D0WA 4L3HA 3RK3C 2G3AA 3B5NA 3NFQA 3RGUA 1BE3G 1ZRTE 1AOFA 3TK1A 1BGYD 1DD3A 4HKZH 3PP5A 3AE5C 1PFIA 4BRYB 3CI9A 3KXDA 3CXHI 2WSEH 5CCHD 2EXVA 3CL3D 1U74B 1FZGA 1HJ5A 1X79B 2KNCB 3H1ID 3ZOYA 2ZXEB 3MP7B 1E29A 3AE6C 2DGEA 2FYUJ 1YTCA 4K35A 4XFJA 4ASWA 1HROA 4IL6V 1HH7A 3K5BA 1W5CT 2RN0A 1I55A 3H1KD 3V2NA 3JSVC 4GODA 3VN0A 4W80A 1LJ2A 2Q6QA 2BEZF 1L0NJ 4GOEA 1S5LH 3JCUE 3WFCC 2SPZA 2CA3B 2H8PD 5CJ4A 1A2SA 3H1JE 1P84I 1CYCA 1IFDA 4YPCA 2C9XB 3M9BA 3U1CA 4QAOA 3CWBD 3S1KA 1MZ9A 1H9XA 2E76B 1AA0A 3GMAA 4KJMA 1CHJA 1DIPA 3B4SA 5TISE 1FI9A 2KUBA 3E7KA 5CYTR 1WMKA 5K5GB 5CIDB 2CPSA 4I7ZB 1LC1A 2XU6A 4YXDC 3L72G 2WSEJ 3IF4A 4PD4D 2XZRA 5AVVB 2XKMA 4ASVA 4IFMA 1FOSF 1JDLA 1NTZG 1QGKB 2W83C 3A3YB 2W8ZA 3G6EP 4IFFA 5E79E 3L75J 5AVRB 2VRSA 2KYVA 1CHIA 2OTLP 1NTMJ 2E76C 5C9MA 1E5WA 1EXIA 4GT1A 1W2LA 2QJKB 1A56A 1YQ4C 1L0LE 1WEJF 1NU1J 2LXCB 1AVYA 1LTGC 5AW0B 3LW5H 2N18B 1CRGA 5AVSB 5CIEB 3CXHW 1Q86Q 1KILC 2HFED 3L74J 4U7JA 1RZ5A 2GM4A 1OW6A 2GC7D 1CHHA 3L70G 2V07A 1T6AA 3CXHH 1FI7A 2FFDB 3F89A 4HH2A 4NPFX 2LR2A 3W67A 2YKOA 4RO0A 1RH5B 4BWNA 2K9YA 3HD7A 1QX8A 1M60A 3MK7C 2J5UA 1SQXK 5AW4B 5B6QA 2KLUA 2QG4A 1HJ4A 1NTKG 2J59M 1CIEA 2IZ0A 1CYIA 4K3IA 5H2FV 4JCGA 1RF0A 4U3FG 3V2PA 2ZXXA 1YFCA 4D6TJ 4EIEA 4BXLA 1OFCX 2JJLA 3A0HV 1Z56A 2MHMA 1MFTA 1HF9A 1DEBA 5APVA 1P84H 1YBKA 2B88A 2OQQA 2Q3IA 1H8AA 3ZOXA 4JYCA 3AE1C 2CXBA 3AE8C 3G9RA 4RESB 2XTSB 2B11B 3L4OA 2W6AA 2D2CC 2ZYGA 1S5LX 5KAIE 1SQBE 1EZVD 3LW5J 5APXA 1HJ3A 2ZT9D 4OWFA 3RK3E 3H1HE 3DR0A 5CIGB 3CX5D 3BASA 1LT9C 1IQCA 1K04A 2Q3EA 1FJPA 3SXTA 1IFNA 4DT0A 4HJGH 3BRTB 2WSSH 3IAOA 1LP1B 2WZ7A 3PJSK 1BE3J 4B86A 3JC22 1CIFA 1YEAA 3HE5A 4WB4A 2FKWB 3M06A 2FWLA 2P10A 2OYOA 2FY8A 3CC2P 2ZT9B 5APUA 3WC8A 1CYJA 2WMMA 3O6QB 2BCNB 1HCMA 3RN0A 3SFEC 1QYZA 3H1LD 1N7SD 4KMGA 1NHLA 2AXTE 3D71A 3A0BE 1CZQA 2A06G 4AYCA 1BDCA 1DVHA 4UB6V 5GTIH 1A02J 3QWOC 1IK9A 1TU3F 3AEFC 4OGQD 4WBAA 2OYHA 1RZ6A 1UIXA 4UB8V 2NPSD 4PJ0V 3ZCFA 5KLVD 1GW4A 3FXEA 2I8FA 5AW7B 1JNMA 2W6BA 1N50A 2MTAC 1FZCB 1NAFA 3BCCG 1KYOI 1F1CA 1CI6B 3WUUA 1AVOA 4NFGB 1N7SB 1CSUA 5B5EH 3FX0A 2XNXA 5CCGC 5KLIC 4GDOA 1JMBA 3CCLP 3KZIV 4TT3H 1YJWP 2PRRA 3FWNA 4L3GA 4QMAA 2WPVB 1GJQA 1GZLA 4OGQB 3CC4P 1U7MA 3P8CE 3WU2H 1SQQK 1N73B 2C1VA 1CTZA 1ZZHA 2HV4A 3IN6A 4PV1B 3V4WA 2Z5HA 3H1JD 4AAOA 3HTKA 3L72J 2JWAA 1FOCA 4H44D 1SQVK 3ZOOA 1L4AC 1NTME 1SQPG 4FA4A 1NTZJ 5KAFH 2GUSA 1SLQA 2N1TA 1WRGA 1DW2A 5APSA 3TGUG 1K3GA 3VP8A 3T97B 1SFCA 3ABVC 1KILE 4ZMDA 1GU2A 2IYOA 3DMIA 3HUSC 2KZJA 5DJTB 1SQXG 3L74E 1VQ6P 2NZ2A 1HZUA 4PWAA 4H44B 3H32A 2ZZS1 1OXZA 4DCKA 1USEA 1RY3A 1CC5A 4XE5B 5DJQB 3L70J 3G3ZA 1CW5A 1IK7A 5B66E 2PCBB 2E74D 2A45G 2YKQA 3H25A 2OYIC 1M90Q 1KTMA 2PCCB 4EI2A 1JTHA 3H1IG 1JY2O 2P1JA 4AUWA 4LJIA 4D6TE 5KJ7D 5BVZA 1L9BC 1NTKJ 2LITA 3R2PA 1ETPA 3D6YA 1T3UA 1M1KQ 1ZR2A 4U3FJ 1CRIA 3H1KG 3RK2D 2A45I 1EQ7A 1KYOH 4C7NB 5CMZA 1RHZB 3D6ZA 1NYHA 1KB9H 1PP9J 1QL2A 1SQVE 1C75A 3M9HA 4WY4D 3A9FA 4NPDA 1QEXA 3USSA 2CE0A 2N1TD 1PGJA 3OCDA 3CWBG 4H0KA 1VF5B 5E79V 2FXPA 2M3EA 3CXHE 2K88A 2R32A 5GTHE 3RK2B 4H0LD 2E42A 4DY9A 2LXBA 2BH4X 2IYPA 3GG2A 2E5TA 451CA 1DVVA 3RBZA 1QN2A 1LGHB 4Y99B 1H33B 4LGDE 3HQ9A 3L4MA 2Q1KA 4WY4B 3RK3D 2R3CA 1A8CA 2ORLA 3VMXA 1RF1C 2GUVA 1RAQA 1BCCE 1T8ZA 2JTIB 1M1JB 2YQBA 1ZV8A 4H0LB 4IL6H 2G8YA 3CCJP 1ZP0C 1GDTA 2L5GB 1C2RA 3RL0C 5AVWB 3DP5A 4PD4I 2PACA 3PXSA 2WPQA 2K9JB 3N4XA 3U59A 3WMM0 1SQQG 2P7JA 2IDBA 2HG5D 1LWUB 1CIHA 3P32A 4YXWH 3Q5SA 5AVQB 4L76A 1HZVA 4Z1MH 1QVFO 3MD0A 2KB7P 2QRXA 3BCCJ 1GL2C 1KILA 1M1JC 1H0TB 1CRYA 3P7KA 1URQC 1SQXD 4C46A 1CSVA 2E75C 3M97X 4H13C 1QL3A 2B10B 3V6IA 2C1DA 4FA1A 1JB0J 1N86A 4V2KA 2FYNC 1GMJA 1J1DC 3L35A 2PP6A 1IC2A 5KAIV 4O1QA 1KX7A 3C2CA 1LTSC 3CCEP 1J1EB 1I54A 4IOIH 1LFMA 4DJGA 3PRJA 5GTIE 1IZNB 3L73E 1L0LK 3TNUB 1FJKA 3VMYA 2Q7CA 1SP4A 1SQPJ 1T2KD 1ZXGA 1KB0A 1L9JC 3M91A 3GLMA 2JKVA 3KPEA 1EZVG 1BSHA 1LTAC 1LTJB 3TGUJ 1PPJG 2I1JA 3AE2C 2IX7C 3WFBC 1YCCA 5CBOA 1L2PA 5B5EE 3A0BV 1HUCA 2KS1A 1NNOA 3O5CA 1LT9A 4RKUJ 1VQPP 3UIAA 2Z5IA 3SFDC 5EXQA 1BGYJ 1EZVI 4YE1A 2C1UA 2HLOA 3WU2E 1FBMA 1DD4A 4DOJA 2P58A 3CX5I 1AKKA 1R5SA 1CTYA 2AXCA 4HYTB 3H1LG 3B5ND 5AW6B 1RE3C 2BPBB 4PD4H 4J20A 1JCDA 4KHXA 1NTKE 4RJTA 3H1IJ 5CCHC 1EDIA 2OTJP 2QSIA 3TSIA 3A0HH 5CIBB 1IZL0 2BCCD 2HODA 2VHDA 1T3JA 3M0AA 1FE6A 1DH3A 3HQ8A 4IL6X 1KN7A 3VMZA 4N78D 2WITA 5KLVG 3H1KJ 3CCRP 1SQBK 4N6JA 1PP9E 5AW2B 1RQVA 2BGVX 3GHGB 1EDKA 1HWTC 3B5NB 1WVEC 4I7ZC 4GKGA 1S1CX 1WT6A 1S3JA 1ZW0A 1FC2C 2O3JA 2IBZE 3PXTA 2L91A 1KORA 3O1YA 1SQQD 1KV9A 2FRCA 4WQAA 1E79H 3JBTB 1DIIC 3CWBJ 1RE4C 2KOGA 3ORVA 1LTBC 2C2CA 5CCGA 1K9MQ 1NMLA 1IO3A 3L71E 3Q1MA 4XA4A 2KXPB 1VQ4P 1C6OA 1OX3A 2FBWC 1G1IA 1SQVD 1VQKP 2YXRB 1SVFA 3H1JG 2R5BA 2LKMA 1MZ4A 1VQ8P 2QJKC 2IFMA 2YXQB 1F1FA 1BDDA 4M3LA 2MJZA 1E2RA 3CYTI 1XTCC 1CIGA 2N18C 2K3RA 1FZAA 1Y8AA 3OA8A 4Q5PA 2QVAA 1Q2NA 1L0NK 5DFSA 1L4AA 2HPCA 2FFDC 1KB9E 5B66V 2P67A 2JR8A 1HJ0A 1S9KD 2GA1A 4PJ0H 1G2CA 1K05A 1VL2A 4GIFA 1M8OB 4AALA 351CA 5CICB 1CSWA 2WPSA 1RAPA 1BSNA 3BCCE 3HUSA 1BCCD 1X22A 4NPEA 1PPJD 3CX5H 4WVZA 5AVTB 1KQLA 1H89A 1NAYA 3BRVB 4I1LA 3KZIH 4XYDB 3EFGA 3AE4C 3L4FA 1DW0A 1U75B 4RSZA 1L0LG 1DEEG 5DJUB 1CSBA 4HB1A 2PAJA 3M0DC 2UWJE 1W2BO 4JF7A 1KV4A 2OYIA 4WQDA 2B87A 4FB1A 2YIUB 3Q5PA 1I5TA 4EIDA 5M1BA 2H7HA 1KFMA 1NGMB 1I8OA 1ZOYC 1NTMK 2M5AA 1ZMEC 3NXSA 1NOHA 4N3YB 3MUDC 1FHBA 1PIXA 2JDIH 2W6JH 4IL6E 2JQRA 5GTHV 1NU1K 2FYUE 1H32A 1JO5A 1NH4A 3HD7D 1C6SA 3PLNA 1ZRTD 1GKSA 3RLMA 5AW9B 2HYNA 3WUTA 2D0SA 2QA4P 1AV1A 3CMEP 2M3BA 1L0NE 2RH0A 1KIBA 2L4DA 4GEDB 1GQ1A 2C9LY 1L4AD 2H43A 3TYYA 2OZ1A 2ZT9C 2C9NY 2LIRA 4JPZB 3SWSA 4OVNF 1FZFA 1KZUB 3TF5A 1DX7A 5IY51 4AQRD 2DW3A 2WT7A 3L73D 1BGYE 1K8AQ 2ZXYA 3WUIA 3ZIYA 1JY3N 3FXDA 1FDIA 5APYA 1KMIZ 1IFMA 1H31A 4C7NA 3O8ZA 2NPSB 3BVHA 3ZDMA 2M0BA 1NWQA 4XXLA 4WQ8A 4Y28J 4L75A 1OVVA 1I8PA 2Y0DA 1VDFA 3SSUA 5AW1B 1FZCC 3H1LJ 1RF1A 3E1IA 3L75E 1N7SC 5AURA 4AAMA 3CCUP 1VPCA 5CIHB 2JO1A 1FDMA 2N9JA 1CRHA 5AVUB 1JY3P 2QM7A 2ITAA 1S72P 5KLVJ 4OGQC 3QH9A 3HQ7A 5BU5A 4WQEA 3CU4A 2B0ZB 2ZYDA 1KFNA 1VQ7P 2NPSC 1NU1E 2WQYC 2IZ1A 1N73C 1S5LE 2PFXA 2ZYAA 1FOSE 4PV1C 5KKZB 4ZKPA 1NKZB 5AW3B 3CWBE 2QJPB 1GL2A 5GTIV 1HJBA 3HE5B 1W5CE 4WWIA 1URQA 1AQTA 2Q9IA 2W90A 3OA7A 1LC2A 3VYIA 4WQ9A 1JEKA 1L0LD 2ZBOA 1FAVA 3AEBC 1R8EA 2K9JA 1IRWA 1DW3A 4O9BA 1KC8Q 2M8RA 2QJYB 2E43A 3H1JJ 2IBZD 1K73Q 2FXOA 1QL4A 4MU8A 5AVYB 1KYOW 2WVRA 2O1KA 3C9IA 5CHXA 2OYHB 2QJPC 4H44C 3L71D 3WFDC 1HTLC 2ZVOB 1CXAA 2WSCH 3V5BA 1OW8A 4EDFA 3B71A 3I55P 1XTGB 5TISV 3FGAD 5DJQC 2E74B 1D7MA 1PGQA 3D0WA 1YIJP 1PGPA 4FA5A 3V2RA 1GW3A 1CXCA 3VMAA 2QJYC 2AEFA 1NTMG 2W27A 4W7YA 4BRYA 2KZIA 4EOTA 3ZOWA 2KNCA 3SVWA 1SFCD 1OVRA 2N9BA 3OAKA 2ZAEB 4O1WA 4EYYQ 2KK7A 4EIFA 1BE3E 1MV8A 1PV3A 1FDOA 2CK3H 3L37A 1NIRA 5KAIH 4W7ZA 1NTZK 1EC5A 2QE7H 4WQ7A 1M6ZA 1SQBD 5CIFB 3N7NA 3AEEC 3H1HD 1RE3A 2BCCG 2N1TB 5CCHA 5KJ7C 3O0RC 1QL1A 1VF5C 4EIJA 1SFCB 3S9OA 2BLFB 1NO4A 3RK2C 1P84E 4PJ0E 2WSCJ 3U1AA 3C1LA 3WUVA 1EZVE 4Y99C 4D6TG 1JMMA 3H32B 3ZBMA 2J58A 3CX5E 3RK3B 4WY4C 1OIPA 2YO3A 3BATA 3A0BH 3KZIE 3OW2O 2Z4EA 2I8DA 3IR9A 1Q7YQ 1RE4A 4H0LC 1SQVG 2P2UA 2H88C 4LC1A 4P4QB 1NTKK 1KX2A 1NMIA 1L0ND 4AANA 2A45H 1SS1A 1LWUC 3H1LE 3L72E 2WPRA 4PW9B 3MIWA 1R5LA 2R3SA 4R4LA 5CJ0A 1NTZE 1E8EA 1LT1A 1N2DC 1IJDB 1EB7A 5KLVE 2Y0CA 2FFDA 2GB8B 3C8VA 3P8CD 2BH5X 3OCDB 3HE4B 3RBXA 1BCCG 1M57D 2O01H 1OWAA 2NRGA 1DT1A 1LMSA 4TLFA 2ZONG 1CORA 2AEMA 3L75D 4Y5RA 2E76D 2AXTV 1FJ0A 1SQXJ 1M56D 4K3AA 3Q2YA 1J1EC 1NTMD 1FU1A 5L8RJ 3L70E 3TYIA 1NU1D 1R0QA 2XNDH 3RL0g 2N9IA 3M0DA 3FWLA 1KILD 3WFEC 2XV5A 2FYZA 1LTJC 3MZWB 3L74D 4WQBA 3KYQA 1X9VA 5H2FH 3CPWO 1Q82Q 3MUDA 3SJLA 1G1JA 4U3FE 5KAFE 3II6A 5B66H 1AOQA 4GYDA 3VRDA 1GU4A 1EXJA 3E1RA 1T2KC 2YO2A 1VQ9P 4MN4C 4KT0J 1LP1A 2JEEA 1U57A 1KILB 1Y9BA 3Q5RA 5APQA 2O01J 1YEBA 1FZBA 1GD2E 1BL9A 2XDJA 1YQ3C 5EFWB 3L73G 1AFOA 4D6TD 3TDKA 2C1DB 3CCSP 3O6QA 1J2JB 3PXWA 3GF7A 1GDVA 2BEQD 1YNRA 2K37A 2V4HA 3D70A 1IFIA 3MK7B 3VOPA 1GU5A 3G71P 1HGZA 3SWYA 2D2CD 1S6VB 2IFNA 1S5LV 3F5HA 2FYUK 2H89C 3GHGC 1OVUA 3A7OA 1COTA 1SQPK 3B5NC 1YITP 3RN1A 3NMDA 2DVHA 5KTBA 5CBNA 1CRJA 1FZCA 5GTHH 2BCCJ 1CI6A 3CXHD 1Q81Q 1C6RA 1N7SA 2I1KA 1KYOE 1HGVA 1BE3D 4UB6H 2RMZA 2V08A 2A06E 3W68A 3V4QA 1HBWA 3NBTA 1LNQA 2D2CB 1M70A 1CCHA 2JWDA 1VQLP 2YKPA 4UB8H 1EDLA 4OH8B 4L73A 3MHVA 2KS1B 2NPSA 3CX5W 1HVVA 1YIQA 4LLHA 1N73A 2ZOOA 1LT9B 1SQQJ 3HRNA 1N9CA 3A2AA 1KQGB 2KIKA
chains in the Genus database with same CATH topology
1CRHA 1CYCA 3PH2B 1C52A 3HQ6A 4EICA 1H1OA 2C9XB 1P84D 3HQ7A 1A8CA 2ORLA 4WQEA 3CU4A 2B0ZB 4QAOA 3CWBD 1RAQA 1CTJA 1H9XA 2JTIB 1AYGA 1CHJA 1CSXA 4L1QA 2YQBA 5KKZB 4FA9A 1FI9A 5CYTR 1K3HA 5CIDB 2QJPB 1C2RA 1B7VA 3NBSA 1LC1A 1CCRA 1FI3A 3DP5A 5GTIV 2PACA 3PXSA 3PTZA 2K9JB 4PD4D 1CIHA 1LC2A 1JDLA 4WQ9A 1CHIA 1L0LD 2ZBOA 1HZVA 1MG2D 1IRWA 1DW3A 5DF5A 2QJYB 5C9MA 2IBZD 1CRYA 1A2SA 1SQXD 1CSVA 1QL4A 4MU8A 3M97X 1W2LA 2QJKB 1A56A 3O20A 1KYOW 4FANA 1I6DA 1WEJF 1QL3A 2B10B 3L72D 2C1DA 5KLIB 4FA1A 3L71D 2GIWA 4V2KA 3WFDC 2N18B 1CRGA 5CIEB 3CXHW 1CXAA 155CA 4EDFA 1NTZD 1RZ5A 5KAIV 4O1QA 5TISV 5DJQC 1KX7A 3C2CA 2GC7D 1CHHA 3VNWA 2V07A 1FI7A 4FA5A 5C0ZA 1CXCA 3VMAA 1I54A 1LFMA 1HRCA 4FAVA 3PRJA 3OA8B 1M60A 3MK7C 3ZOWA 1KB0A 1L9JC 3CP5A 3SVWA 5B6QA 2N3BA 2QG4A 1HJ4A 4O1WA 1CIEA 1CYIA 1FCDC 2Y0EA 4EIFA 4K3IA 3VYMA 5H2FV 4JCGA 3WFBC 1YFCA 2YCCA 1YCCA 4EIEA 1I6EA 3L70D 1NIRA 3A0HV 2MHMA 3RMZA 3A0BV 2KS1A 3NWVA 1NNOA 4WQ7A 1M6ZA 1SQBD 5CIFB 3O5CA 3H1HD 3PHLA 5EXQA 3ZOXA 2CXBA 1H33A 3O0RC 2XTSB 2B11B 4YE1A 1DIQC 1VYDA 2C1UA 3L4OA 1LS9A 1YICA 1NTKD 1EZVD 2BLFB 1HJ3A 1AKKA 1CTYA 3DR0A 5CIGB 4U3FD 3CX5D 4A7PA 2N9YB 1IQCA 1OAEA 2Q3EA 3SXTA 2BPBB 4J20A 4RJTA 1N15A 1PP9D 3ZBMA 5CIBB 1IZL0 2BCCD 2VHDA 1CIFA 1YEAA 3HQ8A 1H32B 2FWLA 3KHUA 3X39A 1H9YA 1CNOA 1CYJA 3WC8A 5B5EV 2N3YA 2BCNB 3SLEA 1J3SA 1HCMA 2BGVX 3RN0A 1QYZA 3H1LD 4KMGA 1WVEC 4P4QB 1KX2A 1NMIA 2O3JA 1L0ND 3PXTA 1C7MA 2L91A 3O1YA 1SQQD 1KV9A 3GW6A 1DVHA 2AIUA 2CE1A 4AANA 2FRCA 4UB6V 4WQAA 3JBTB 3WU2V 2OZ1B 1DIIC 1RZ6A 3ORVA 2C2CA 1NMLA 4UB8V 1IO3A 4PW9B 4PJ0V 3ZCFA 5KLVD 2I8FA 1C6OA 3ITKA 1N50A 2MTAC 1E8EA 1SQVD 1F1CA 1EB7A 1H31B 4NFGB 1MZ4A 1CSUA 5KAFV 2Y0CA 1KYOD 2GB8B 1F1FA 2A06D 2BH5X 3OCDB 1QKSA 3KZIV 1E2RA 2GC4D 3CYTI 4L3GA 1CIGA 1KB9D 2N18C 1GJQA 3OA8A 1DT1A 5TJHA 4Q5PA 2YK3A 5DFSA 1LMSA 2ZONG 1CORA 2C1VA 3L75D 4Y5RA 1CTZA 1ZZHA 5B66V 2AXTV 2HV4A 1N90A 1FJ0A 3BCCD 1NTMD 3H1JD 2B4ZA 4AAOA 4AALA 351CA 2AI5A 5CICB 2JWAA 1FOCA 3TYIA 1CRCA 2B12B 1CSWA 1RAPA 1CO6A 1NU1D 1R0QA 4N0KA 3ZOOA 2N9IA 1BCCD 4AX3A 4FA4A 3FWLA 1PPJD 3WFEC 1MG3D 1DW2A 4XYDB 1K3GA 3L74D 4WQBA 1DW0A 1U75B 1DW1A 4H0JA 4RSZA 1OCDA 3SJLA 1GU2A 2CA4B 3DMIA 4WQDA 4FB1A 1GIWA 1HZUA 2YIUB 4PWAA 1AOQA 1I5TA 4GYDA 3VRDA 4EIDA 2FYUD 1I8OA 1IRVA 2FYNB 2ZZS1 1SQPD 1FHBA 1CC5A 1YEBA 1BL9A 3TGUD 5DJQB 2JQRA 5GTHV 2PCBB 1H32A 1CEDA 1C6SA 3PLNA 4D6TD 1ZRTD 3TDKA 1GKSA 3RLMA 2C1DB 4WQCA 2PCCB 1C2NA 2C8SA 3PXWA 1GDVA 2D0WA 1YNRA 4L3HA 2D0SA 4LJIA 3MK7B 1AOFA 1L9BC 1KIBA 2L4DA 2LITA 4GEDB 1BGYD 1GQ1A 1ETPA 1S6VB 1CRIA 2OZ1A 2LIRA 3SWSA 1S5LV 3TF5A 5IY51 3L73D 1COTA 3RN1A 2DVHA 2ZXYA 3WUIA 2EXVA 3ZIYA 1CRJA 1C75A 1U74B 1HJ5A 2KNCB 3CXHD 3H1ID 3ZOYA 1H31A 1C6RA 3A9FA 1BE3D 1E29A 2DGEA 2CE0A 2RMZA 2V08A 1YTCA 3OCDA 4XXLA 3NBTA 1HROA 4WQ8A 4IL6V 1M70A 1HH7A 4H0KA 5E79V 1CCHA 1I8PA 1W5CT 1I55A 2RN0A 2Y0DA 3H1KD 4DY9A 3CX5W 1YIQA 2BH4X 3GG2A 451CA 2ZOOA 1DVVA 5AURA 1QN2A 4AAMA 3WFCC 5CIHB 2CA3B 1H33B 1N9CA 3HQ9A 3L4MA 2N9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRH A;  1CYC A;  3PH2 B;  1C52 A;  3HQ6 A;  4EIC A;  1H1O A;  2C9X B;  1P84 D;  3HQ7 A;  1A8C A;  2ORL A;  4WQE A;  3CU4 A;  2B0Z B;  4QAO A;  3CWB D;  1RAQ A;  1CTJ A;  1H9X A;  2JTI B;  1AYG A;  1CHJ A;  1CSX A;  4L1Q A;  2YQB A;  5KKZ B;  4FA9 A;  1FI9 A;  5CYT R;  1K3H A;  5CID B;  2QJP B;  1C2R A;  1B7V A;  3NBS A;  1LC1 A;  1CCR A;  1FI3 A;  3DP5 A;  5GTI V;  2PAC A;  3PXS A;  3PTZ A;  2K9J B;  4PD4 D;  1CIH A;  1LC2 A;  1JDL A;  4WQ9 A;  1CHI A;  1L0L D;  2ZBO A;  1HZV A;  1MG2 D;  1IRW A;  1DW3 A;  5DF5 A;  2QJY B;  5C9M A;  2IBZ D;  1CRY A;  1A2S A;  1SQX D;  1CSV A;  1QL4 A;  4MU8 A;  3M97 X;  1W2L A;  2QJK B;  1A56 A;  3O20 A;  1KYO W;  4FAN A;  1I6D A;  1WEJ F;  1QL3 A;  2B10 B;  3L72 D;  2C1D A;  5KLI B;  4FA1 A;  3L71 D;  2GIW A;  4V2K A;  3WFD C;  2N18 B;  1CRG A;  5CIE B;  3CXH W;  1CXA A;  155C A;  4EDF A;  1NTZ D;  1RZ5 A;  5KAI V;  4O1Q A;  5TIS V;  5DJQ C;  1KX7 A;  3C2C A;  2GC7 D;  1CHH A;  3VNW A;  2V07 A;  1FI7 A;  4FA5 A;  5C0Z A;  1CXC A;  3VMA A;  1I54 A;  1LFM A;  1HRC A;  4FAV A;  3PRJ A;  3OA8 B;  1M60 A;  3MK7 C;  3ZOW A;  1KB0 A;  1L9J C;  3CP5 A;  3SVW A;  5B6Q A;  2N3B A;  2QG4 A;  1HJ4 A;  4O1W A;  1CIE A;  1CYI A;  1FCD C;  2Y0E A;  4EIF A;  4K3I A;  3VYM A;  5H2F V;  4JCG A;  3WFB C;  1YFC A;  2YCC A;  1YCC A;  4EIE A;  1I6E A;  3L70 D;  1NIR A;  3A0H V;  2MHM A;  3RMZ A;  3A0B V;  2KS1 A;  3NWV A;  1NNO A;  4WQ7 A;  1M6Z A;  1SQB D;  5CIF B;  3O5C A;  3H1H D;  3PHL A;  5EXQ A;  3ZOX A;  2CXB A;  1H33 A;  3O0R C;  2XTS B;  2B11 B;  4YE1 A;  1DIQ C;  1VYD A;  2C1U A;  3L4O A;  1LS9 A;  1YIC A;  1NTK D;  1EZV D;  2BLF B;  1HJ3 A;  1AKK A;  1CTY A;  3DR0 A;  5CIG B;  4U3F D;  3CX5 D;  4A7P A;  2N9Y B;  1IQC A;  1OAE A;  2Q3E A;  3SXT A;  2BPB B;  4J20 A;  4RJT A;  1N15 A;  1PP9 D;  3ZBM A;  5CIB B;  1IZL 0;  2BCC D;  2VHD A;  1CIF A;  1YEA A;  3HQ8 A;  1H32 B;  2FWL A;  3KHU A;  3X39 A;  1H9Y A;  1CNO A;  1CYJ A;  3WC8 A;  5B5E V;  2N3Y A;  2BCN B;  3SLE A;  1J3S A;  1HCM A;  2BGV X;  3RN0 A;  1QYZ A;  3H1L D;  4KMG A;  1WVE C;  4P4Q B;  1KX2 A;  1NMI A;  2O3J A;  1L0N D;  3PXT A;  1C7M A;  2L91 A;  3O1Y A;  1SQQ D;  1KV9 A;  3GW6 A;  1DVH A;  2AIU A;  2CE1 A;  4AAN A;  2FRC A;  4UB6 V;  4WQA A;  3JBT B;  3WU2 V;  2OZ1 B;  1DII C;  1RZ6 A;  3ORV A;  2C2C A;  1NML A;  4UB8 V;  1IO3 A;  4PW9 B;  4PJ0 V;  3ZCF A;  5KLV D;  2I8F A;  1C6O A;  3ITK A;  1N50 A;  2MTA C;  1E8E A;  1SQV D;  1F1C A;  1EB7 A;  1H31 B;  4NFG B;  1MZ4 A;  1CSU A;  5KAF V;  2Y0C A;  1KYO D;  2GB8 B;  1F1F A;  2A06 D;  2BH5 X;  3OCD B;  1QKS A;  3KZI V;  1E2R A;  2GC4 D;  3CYT I;  4L3G A;  1CIG A;  1KB9 D;  2N18 C;  1GJQ A;  3OA8 A;  1DT1 A;  5TJH A;  4Q5P A;  2YK3 A;  5DFS A;  1LMS A;  2ZON G;  1COR A;  2C1V A;  3L75 D;  4Y5R A;  1CTZ A;  1ZZH A;  5B66 V;  2AXT V;  2HV4 A;  1N90 A;  1FJ0 A;  3BCC D;  1NTM D;  3H1J D;  2B4Z A;  4AAO A;  4AAL A;  351C A;  2AI5 A;  5CIC B;  2JWA A;  1FOC A;  3TYI A;  1CRC A;  2B12 B;  1CSW A;  1RAP A;  1CO6 A;  1NU1 D;  1R0Q A;  4N0K A;  3ZOO A;  2N9I A;  1BCC D;  4AX3 A;  4FA4 A;  3FWL A;  1PPJ D;  3WFE C;  1MG3 D;  1DW2 A;  4XYD B;  1K3G A;  3L74 D;  4WQB A;  1DW0 A;  1U75 B;  1DW1 A;  4H0J A;  4RSZ A;  1OCD A;  3SJL A;  1GU2 A;  2CA4 B;  3DMI A;  4WQD A;  4FB1 A;  1GIW A;  1HZU A;  2YIU B;  4PWA A;  1AOQ A;  1I5T A;  4GYD A;  3VRD A;  4EID A;  2FYU D;  1I8O A;  1IRV A;  2FYN B;  2ZZS 1;  1SQP D;  1FHB A;  1CC5 A;  1YEB A;  1BL9 A;  3TGU D;  5DJQ B;  2JQR A;  5GTH V;  2PCB B;  1H32 A;  1CED A;  1C6S A;  3PLN A;  4D6T D;  1ZRT D;  3TDK A;  1GKS A;  3RLM A;  2C1D B;  4WQC A;  2PCC B;  1C2N A;  2C8S A;  3PXW A;  1GDV A;  2D0W A;  1YNR A;  4L3H A;  2D0S A;  4LJI A;  3MK7 B;  1AOF A;  1L9B C;  1KIB A;  2L4D A;  2LIT A;  4GED B;  1BGY D;  1GQ1 A;  1ETP A;  1S6V B;  1CRI A;  2OZ1 A;  2LIR A;  3SWS A;  1S5L V;  3TF5 A;  5IY5 1;  3L73 D;  1COT A;  3RN1 A;  2DVH A;  2ZXY A;  3WUI A;  2EXV A;  3ZIY A;  1CRJ A;  1C75 A;  1U74 B;  1HJ5 A;  2KNC B;  3CXH D;  3H1I D;  3ZOY A;  1H31 A;  1C6R A;  3A9F A;  1BE3 D;  1E29 A;  2DGE A;  2CE0 A;  2RMZ A;  2V08 A;  1YTC A;  3OCD A;  4XXL A;  3NBT A;  1HRO A;  4WQ8 A;  4IL6 V;  1M70 A;  1HH7 A;  4H0K A;  5E79 V;  1CCH A;  1I8P A;  1W5C T;  1I55 A;  2RN0 A;  2Y0D A;  3H1K D;  4DY9 A;  3CX5 W;  1YIQ A;  2BH4 X;  3GG2 A;  451C A;  2ZOO A;  1DVV A;  5AUR A;  1QN2 A;  4AAM A;  3WFC C;  5CIH B;  2CA3 B;  1H33 B;  1N9C A;  3HQ9 A;  3L4M A;  2N9J A; 
#chains in the Genus database with same CATH topology
 3PH2 B;  1C52 A;  5C39 A;  1PP9 G;  3HQ6 A;  4EIC A;  4JBZ A;  1H1O A;  1P84 D;  3AE9 C;  1YJ9 P;  1W2E A;  3A5T A;  1CTJ A;  1AYG A;  1SQV J;  1CSX A;  1GK6 A;  4L1Q A;  2IBZ G;  4FA9 A;  1K3H A;  3T97 A;  1B7V A;  3NBS A;  2HOD B;  3NTN A;  1JY2 N;  2C0W A;  1CCR A;  1FI3 A;  2MKV A;  5CCG D;  3L71 G;  3PTZ A;  1FS0 E;  2OGU A;  1N8R Q;  1NJI Q;  3I56 P;  2WWW A;  2V7Q H;  2YMY A;  2Y9Y A;  1A02 F;  3IFM A;  1SQP E;  1HH0 A;  4ZNC A;  2IBZ I;  1MG2 D;  3VTP C;  2QIW A;  1ZLL A;  4C7R A;  1LTI C;  3OJA B;  5DF5 A;  4IFD K;  3TGU E;  2YMK A;  3O20 A;  5APT A;  4FAN A;  1I6D A;  2YIU C;  3L72 D;  5KLI B;  1BCC J;  2GIW A;  1JOC A;  1JY2 P;  1SQX E;  4ZKU A;  155C A;  1NTZ D;  3G4S P;  1MUU A;  3H6P A;  3HD7 B;  3AE7 C;  1H88 A;  1X8Y A;  2POH A;  3VNW A;  3P8M C;  5C0Z A;  5AW8 B;  4PV1 D;  1HRC A;  4FAV A;  1SQB G;  1S4X A;  3OA8 B;  3H1H G;  3JCU H;  1RQU A;  1KB9 I;  1L4A B;  2AEJ A;  3CP5 A;  2HPC B;  3H1I E;  2N3B A;  3MTU E;  2Y0E A;  1FCD C;  3VYM A;  1G2C B;  1GK4 A;  5KJ7 A;  2YCC A;  4JQ0 D;  2OAR A;  2V7Q J;  1KQF B;  1I6E A;  3L70 D;  2KSE A;  3HD7 C;  2O01 N;  1PGO A;  3H1K E;  3L36 A;  4DZO A;  1IO4 A;  5TIS H;  3RMZ A;  3SWF A;  5AVX B;  1PZQ A;  1ZR4 A;  3NWV A;  2B89 A;  3HUS B;  3R4Y A;  2OTK E;  3PHL A;  1N7L A;  2R5D A;  3CC7 P;  1RF0 C;  4R4M A;  1H33 A;  1DIQ C;  1VYD A;  3CD6 P;  3B8E B;  3CMA P;  2FYU G;  1LS9 A;  1YIC A;  1MFZ A;  3VP9 A;  1NTK D;  3GF3 A;  4WY4 A;  4I6M C;  5E79 H;  3L73 J;  4U3F D;  4A7P A;  2QM8 A;  2N9Y B;  1FZE A;  5BU8 B;  1JM0 A;  3V2Q A;  1OAE A;  1OZH A;  2B87 B;  3KDP B;  2OYI B;  1M1J A;  1KD1 Q;  1YTZ I;  2IPP A;  1L0N G;  1VQ5 P;  2HR3 A;  1N15 A;  3CCV P;  2M5A B;  1PP9 D;  1MKM A;  1YJN P;  2ZFC A;  1H32 B;  3KHU A;  4PD4 E;  5H2F E;  3X39 A;  1YYC A;  1BGY G;  1LWU A;  1H9Y A;  1VQM P;  1CNO A;  5B5E V;  2BCC E;  2N3Y A;  5KKZ C;  2JP3 A;  3SLE A;  3A0H E;  1J3S A;  2C0X A;  1NVO A;  4N78 E;  2ZVN B;  1LTT C;  1OMI A;  1NKN A;  1C7M A;  1PL5 A;  1H0T A;  3GW6 A;  2AIU A;  2CE1 A;  1VQN P;  3WU2 V;  1VQO P;  2OZ1 B;  5APW A;  2K1A A;  2Q5U A;  3EQ2 A;  2WT7 B;  3LIE A;  1GTW A;  1SQQ E;  3CLQ A;  3L75 G;  1VF5 D;  1IFJ A;  1YHQ P;  3ITK A;  1ZN5 A;  1AJY A;  1Q90 D;  4JYB A;  1H31 B;  3KQG A;  1EDJ A;  1M7L A;  5KAF V;  3RL0 D;  1KYO D;  3PH0 A;  2OYH C;  1JUN A;  3SWK A;  2A06 D;  1KQS O;  3EWK A;  1QKS A;  1NU1 G;  2GC4 D;  2WTY A;  1KB9 D;  2ZJS E;  1YI2 P;  3TNU A;  2WSF H;  3CCQ P;  5TJH A;  2KI7 B;  1L0L J;  2R44 A;  3I5C A;  1RF1 B;  2YK3 A;  2E74 C;  2PGD A;  3HTK B;  3L74 G;  1Y47 A;  2KP8 A;  3HE4 A;  1GL2 D;  3S4R A;  3AEG C;  1N90 A;  1LTJ A;  2E5Y A;  3BCC D;  1URQ D;  1YTZ T;  1AQ5 A;  4GOF A;  3Q3D A;  2B4Z A;  2E75 D;  4CPG A;  5KLV K;  2FXM A;  4H13 D;  2AI5 A;  3RL0 B;  3L71 J;  1CRC A;  2B12 B;  4UB6 E;  1CO6 A;  3M9Q A;  1JY3 O;  4YTP C;  4N0K A;  1S9K E;  2Y9Z A;  2QEX P;  3AED C;  4AX3 A;  3MGN A;  4UB8 E;  1X0T A;  1MG3 D;  2YNY A;  3AEC C;  1USD A;  4L74 A;  1S2E A;  2BAS A;  1DW1 A;  1QLE D;  4H0J A;  1OCD A;  5AW5 B;  1GL2 B;  1PPJ E;  3LID A;  1URQ B;  2RKL A;  3AE3 C;  2CA4 B;  2E75 B;  1OW7 A;  3CCM P;  2AXT H;  4H13 B;  1GIW A;  2N1T C;  2CPB A;  3AEA C;  2FYU D;  1IRV A;  2FYN B;  2B9B A;  1SQP D;  1QVG O;  1J1D B;  1SFC C;  4I2L C;  5AVZ B;  2KLV A;  1JTH B;  2WSF J;  3TGU D;  1UII A;  3EFF K;  1CED A;  2KSJ A;  1JCC A;  1U7J A;  4WQC A;  1IFP A;  1SQB J;  1C2N A;  2C8S A;  3H1H J;  2O1J A;  3GHG A;  2D0W A;  4L3H A;  3RK3 C;  2G3A A;  3B5N A;  3NFQ A;  3RGU A;  1BE3 G;  1ZRT E;  1AOF A;  3TK1 A;  1BGY D;  1DD3 A;  4HKZ H;  3PP5 A;  3AE5 C;  1PFI A;  4BRY B;  3CI9 A;  3KXD A;  3CXH I;  2WSE H;  5CCH D;  2EXV A;  3CL3 D;  1U74 B;  1FZG A;  1HJ5 A;  1X79 B;  2KNC B;  3H1I D;  3ZOY A;  2ZXE B;  3MP7 B;  1E29 A;  3AE6 C;  2DGE A;  2FYU J;  1YTC A;  4K35 A;  4XFJ A;  4ASW A;  1HRO A;  4IL6 V;  1HH7 A;  3K5B A;  1W5C T;  2RN0 A;  1I55 A;  3H1K D;  3V2N A;  3JSV C;  4GOD A;  3VN0 A;  4W80 A;  1LJ2 A;  2Q6Q A;  2BEZ F;  1L0N J;  4GOE A;  1S5L H;  3JCU E;  3WFC C;  2SPZ A;  2CA3 B;  2H8P D;  5CJ4 A;  1A2S A;  3H1J E;  1P84 I;  1CYC A;  1IFD A;  4YPC A;  2C9X B;  3M9B A;  3U1C A;  4QAO A;  3CWB D;  3S1K A;  1MZ9 A;  1H9X A;  2E76 B;  1AA0 A;  3GMA A;  4KJM A;  1CHJ A;  1DIP A;  3B4S A;  5TIS E;  1FI9 A;  2KUB A;  3E7K A;  5CYT R;  1WMK A;  5K5G B;  5CID B;  2CPS A;  4I7Z B;  1LC1 A;  2XU6 A;  4YXD C;  3L72 G;  2WSE J;  3IF4 A;  4PD4 D;  2XZR A;  5AVV B;  2XKM A;  4ASV A;  4IFM A;  1FOS F;  1JDL A;  1NTZ G;  1QGK B;  2W83 C;  3A3Y B;  2W8Z A;  3G6E P;  4IFF A;  5E79 E;  3L75 J;  5AVR B;  2VRS A;  2KYV A;  1CHI A;  2OTL P;  1NTM J;  2E76 C;  5C9M A;  1E5W A;  1EXI A;  4GT1 A;  1W2L A;  2QJK B;  1A56 A;  1YQ4 C;  1L0L E;  1WEJ F;  1NU1 J;  2LXC B;  1AVY A;  1LTG C;  5AW0 B;  3LW5 H;  2N18 B;  1CRG A;  5AVS B;  5CIE B;  3CXH W;  1Q86 Q;  1KIL C;  2HFE D;  3L74 J;  4U7J A;  1RZ5 A;  2GM4 A;  1OW6 A;  2GC7 D;  1CHH A;  3L70 G;  2V07 A;  1T6A A;  3CXH H;  1FI7 A;  2FFD B;  3F89 A;  4HH2 A;  4NPF X;  2LR2 A;  3W67 A;  2YKO A;  4RO0 A;  1RH5 B;  4BWN A;  2K9Y A;  3HD7 A;  1QX8 A;  1M60 A;  3MK7 C;  2J5U A;  1SQX K;  5AW4 B;  5B6Q A;  2KLU A;  2QG4 A;  1HJ4 A;  1NTK G;  2J59 M;  1CIE A;  2IZ0 A;  1CYI A;  4K3I A;  5H2F V;  4JCG A;  1RF0 A;  4U3F G;  3V2P A;  2ZXX A;  1YFC A;  4D6T J;  4EIE A;  4BXL A;  1OFC X;  2JJL A;  3A0H V;  1Z56 A;  2MHM A;  1MFT A;  1HF9 A;  1DEB A;  5APV A;  1P84 H;  1YBK A;  2B88 A;  2OQQ A;  2Q3I A;  1H8A A;  3ZOX A;  4JYC A;  3AE1 C;  2CXB A;  3AE8 C;  3G9R A;  4RES B;  2XTS B;  2B11 B;  3L4O A;  2W6A A;  2D2C C;  2ZYG A;  1S5L X;  5KAI E;  1SQB E;  1EZV D;  3LW5 J;  5APX A;  1HJ3 A;  2ZT9 D;  4OWF A;  3RK3 E;  3H1H E;  3DR0 A;  5CIG B;  3CX5 D;  3BAS A;  1LT9 C;  1IQC A;  1K04 A;  2Q3E A;  1FJP A;  3SXT A;  1IFN A;  4DT0 A;  4HJG H;  3BRT B;  2WSS H;  3IAO A;  1LP1 B;  2WZ7 A;  3PJS K;  1BE3 J;  4B86 A;  3JC2 2;  1CIF A;  1YEA A;  3HE5 A;  4WB4 A;  2FKW B;  3M06 A;  2FWL A;  2P10 A;  2OYO A;  2FY8 A;  3CC2 P;  2ZT9 B;  5APU A;  3WC8 A;  1CYJ A;  2WMM A;  3O6Q B;  2BCN B;  1HCM A;  3RN0 A;  3SFE C;  1QYZ A;  3H1L D;  1N7S D;  4KMG A;  1NHL A;  2AXT E;  3D71 A;  3A0B E;  1CZQ A;  2A06 G;  4AYC A;  1BDC A;  1DVH A;  4UB6 V;  5GTI H;  1A02 J;  3QWO C;  1IK9 A;  1TU3 F;  3AEF C;  4OGQ D;  4WBA A;  2OYH A;  1RZ6 A;  1UIX A;  4UB8 V;  2NPS D;  4PJ0 V;  3ZCF A;  5KLV D;  1GW4 A;  3FXE A;  2I8F A;  5AW7 B;  1JNM A;  2W6B A;  1N50 A;  2MTA C;  1FZC B;  1NAF A;  3BCC G;  1KYO I;  1F1C A;  1CI6 B;  3WUU A;  1AVO A;  4NFG B;  1N7S B;  1CSU A;  5B5E H;  3FX0 A;  2XNX A;  5CCG C;  5KLI C;  4GDO A;  1JMB A;  3CCL P;  3KZI V;  4TT3 H;  1YJW P;  2PRR A;  3FWN A;  4L3G A;  4QMA A;  2WPV B;  1GJQ A;  1GZL A;  4OGQ B;  3CC4 P;  1U7M A;  3P8C E;  3WU2 H;  1SQQ K;  1N73 B;  2C1V A;  1CTZ A;  1ZZH A;  2HV4 A;  3IN6 A;  4PV1 B;  3V4W A;  2Z5H A;  3H1J D;  4AAO A;  3HTK A;  3L72 J;  2JWA A;  1FOC A;  4H44 D;  1SQV K;  3ZOO A;  1L4A C;  1NTM E;  1SQP G;  4FA4 A;  1NTZ J;  5KAF H;  2GUS A;  1SLQ A;  2N1T A;  1WRG A;  1DW2 A;  5APS A;  3TGU G;  1K3G A;  3VP8 A;  3T97 B;  1SFC A;  3ABV C;  1KIL E;  4ZMD A;  1GU2 A;  2IYO A;  3DMI A;  3HUS C;  2KZJ A;  5DJT B;  1SQX G;  3L74 E;  1VQ6 P;  2NZ2 A;  1HZU A;  4PWA A;  4H44 B;  3H32 A;  2ZZS 1;  1OXZ A;  4DCK A;  1USE A;  1RY3 A;  1CC5 A;  4XE5 B;  5DJQ B;  3L70 J;  3G3Z A;  1CW5 A;  1IK7 A;  5B66 E;  2PCB B;  2E74 D;  2A45 G;  2YKQ A;  3H25 A;  2OYI C;  1M90 Q;  1KTM A;  2PCC B;  4EI2 A;  1JTH A;  3H1I G;  1JY2 O;  2P1J A;  4AUW A;  4LJI A;  4D6T E;  5KJ7 D;  5BVZ A;  1L9B C;  1NTK J;  2LIT A;  3R2P A;  1ETP A;  3D6Y A;  1T3U A;  1M1K Q;  1ZR2 A;  4U3F J;  1CRI A;  3H1K G;  3RK2 D;  2A45 I;  1EQ7 A;  1KYO H;  4C7N B;  5CMZ A;  1RHZ B;  3D6Z A;  1NYH A;  1KB9 H;  1PP9 J;  1QL2 A;  1SQV E;  1C75 A;  3M9H A;  4WY4 D;  3A9F A;  4NPD A;  1QEX A;  3USS A;  2CE0 A;  2N1T D;  1PGJ A;  3OCD A;  3CWB G;  4H0K A;  1VF5 B;  5E79 V;  2FXP A;  2M3E A;  3CXH E;  2K88 A;  2R32 A;  5GTH E;  3RK2 B;  4H0L D;  2E42 A;  4DY9 A;  2LXB A;  2BH4 X;  2IYP A;  3GG2 A;  2E5T A;  451C A;  1DVV A;  3RBZ A;  1QN2 A;  1LGH B;  4Y99 B;  1H33 B;  4LGD E;  3HQ9 A;  3L4M A;  2Q1K A;  4WY4 B;  3RK3 D;  2R3C A;  1A8C A;  2ORL A;  3VMX A;  1RF1 C;  2GUV A;  1RAQ A;  1BCC E;  1T8Z A;  2JTI B;  1M1J B;  2YQB A;  1ZV8 A;  4H0L B;  4IL6 H;  2G8Y A;  3CCJ P;  1ZP0 C;  1GDT A;  2L5G B;  1C2R A;  3RL0 C;  5AVW B;  3DP5 A;  4PD4 I;  2PAC A;  3PXS A;  2WPQ A;  2K9J B;  3N4X A;  3U59 A;  3WMM 0;  1SQQ G;  2P7J A;  2IDB A;  2HG5 D;  1LWU B;  1CIH A;  3P32 A;  4YXW H;  3Q5S A;  5AVQ B;  4L76 A;  1HZV A;  4Z1M H;  1QVF O;  3MD0 A;  2KB7 P;  2QRX A;  3BCC J;  1GL2 C;  1KIL A;  1M1J C;  1H0T B;  1CRY A;  3P7K A;  1URQ C;  1SQX D;  4C46 A;  1CSV A;  2E75 C;  3M97 X;  4H13 C;  1QL3 A;  2B10 B;  3V6I A;  2C1D A;  4FA1 A;  1JB0 J;  1N86 A;  4V2K A;  2FYN C;  1GMJ A;  1J1D C;  3L35 A;  2PP6 A;  1IC2 A;  5KAI V;  4O1Q A;  1KX7 A;  3C2C A;  1LTS C;  3CCE P;  1J1E B;  1I54 A;  4IOI H;  1LFM A;  4DJG A;  3PRJ A;  5GTI E;  1IZN B;  3L73 E;  1L0L K;  3TNU B;  1FJK A;  3VMY A;  2Q7C A;  1SP4 A;  1SQP J;  1T2K D;  1ZXG A;  1KB0 A;  1L9J C;  3M91 A;  3GLM A;  2JKV A;  3KPE A;  1EZV G;  1BSH A;  1LTA C;  1LTJ B;  3TGU J;  1PPJ G;  2I1J A;  3AE2 C;  2IX7 C;  3WFB C;  1YCC A;  5CBO A;  1L2P A;  5B5E E;  3A0B V;  1HUC A;  2KS1 A;  1NNO A;  3O5C A;  1LT9 A;  4RKU J;  1VQP P;  3UIA A;  2Z5I A;  3SFD C;  5EXQ A;  1BGY J;  1EZV I;  4YE1 A;  2C1U A;  2HLO A;  3WU2 E;  1FBM A;  1DD4 A;  4DOJ A;  2P58 A;  3CX5 I;  1AKK A;  1R5S A;  1CTY A;  2AXC A;  4HYT B;  3H1L G;  3B5N D;  5AW6 B;  1RE3 C;  2BPB B;  4PD4 H;  4J20 A;  1JCD A;  4KHX A;  1NTK E;  4RJT A;  3H1I J;  5CCH C;  1EDI A;  2OTJ P;  2QSI A;  3TSI A;  3A0H H;  5CIB B;  1IZL 0;  2BCC D;  2HOD A;  2VHD A;  1T3J A;  3M0A A;  1FE6 A;  1DH3 A;  3HQ8 A;  4IL6 X;  1KN7 A;  3VMZ A;  4N78 D;  2WIT A;  5KLV G;  3H1K J;  3CCR P;  1SQB K;  4N6J A;  1PP9 E;  5AW2 B;  1RQV A;  2BGV X;  3GHG B;  1EDK A;  1HWT C;  3B5N B;  1WVE C;  4I7Z C;  4GKG A;  1S1C X;  1WT6 A;  1S3J A;  1ZW0 A;  1FC2 C;  2O3J A;  2IBZ E;  3PXT A;  2L91 A;  1KOR A;  3O1Y A;  1SQQ D;  1KV9 A;  2FRC A;  4WQA A;  1E79 H;  3JBT B;  1DII C;  3CWB J;  1RE4 C;  2KOG A;  3ORV A;  1LTB C;  2C2C A;  5CCG A;  1K9M Q;  1NML A;  1IO3 A;  3L71 E;  3Q1M A;  4XA4 A;  2KXP B;  1VQ4 P;  1C6O A;  1OX3 A;  2FBW C;  1G1I A;  1SQV D;  1VQK P;  2YXR B;  1SVF A;  3H1J G;  2R5B A;  2LKM A;  1MZ4 A;  1VQ8 P;  2QJK C;  2IFM A;  2YXQ B;  1F1F A;  1BDD A;  4M3L A;  2MJZ A;  1E2R A;  3CYT I;  1XTC C;  1CIG A;  2N18 C;  2K3R A;  1FZA A;  1Y8A A;  3OA8 A;  4Q5P A;  2QVA A;  1Q2N A;  1L0N K;  5DFS A;  1L4A A;  2HPC A;  2FFD C;  1KB9 E;  5B66 V;  2P67 A;  2JR8 A;  1HJ0 A;  1S9K D;  2GA1 A;  4PJ0 H;  1G2C A;  1K05 A;  1VL2 A;  4GIF A;  1M8O B;  4AAL A;  351C A;  5CIC B;  1CSW A;  2WPS A;  1RAP A;  1BSN A;  3BCC E;  3HUS A;  1BCC D;  1X22 A;  4NPE A;  1PPJ D;  3CX5 H;  4WVZ A;  5AVT B;  1KQL A;  1H89 A;  1NAY A;  3BRV B;  4I1L A;  3KZI H;  4XYD B;  3EFG A;  3AE4 C;  3L4F A;  1DW0 A;  1U75 B;  4RSZ A;  1L0L G;  1DEE G;  5DJU B;  1CSB A;  4HB1 A;  2PAJ A;  3M0D C;  2UWJ E;  1W2B O;  4JF7 A;  1KV4 A;  2OYI A;  4WQD A;  2B87 A;  4FB1 A;  2YIU B;  3Q5P A;  1I5T A;  4EID A;  5M1B A;  2H7H A;  1KFM A;  1NGM B;  1I8O A;  1ZOY C;  1NTM K;  2M5A A;  1ZME C;  3NXS A;  1NOH A;  4N3Y B;  3MUD C;  1FHB A;  1PIX A;  2JDI H;  2W6J H;  4IL6 E;  2JQR A;  5GTH V;  1NU1 K;  2FYU E;  1H32 A;  1JO5 A;  1NH4 A;  3HD7 D;  1C6S A;  3PLN A;  1ZRT D;  1GKS A;  3RLM A;  5AW9 B;  2HYN A;  3WUT A;  2D0S A;  2QA4 P;  1AV1 A;  3CME P;  2M3B A;  1L0N E;  2RH0 A;  1KIB A;  2L4D A;  4GED B;  1GQ1 A;  2C9L Y;  1L4A D;  2H43 A;  3TYY A;  2OZ1 A;  2ZT9 C;  2C9N Y;  2LIR A;  4JPZ B;  3SWS A;  4OVN F;  1FZF A;  1KZU B;  3TF5 A;  1DX7 A;  5IY5 1;  4AQR D;  2DW3 A;  2WT7 A;  3L73 D;  1BGY E;  1K8A Q;  2ZXY A;  3WUI A;  3ZIY A;  1JY3 N;  3FXD A;  1FDI A;  5APY A;  1KMI Z;  1IFM A;  1H31 A;  4C7N A;  3O8Z A;  2NPS B;  3BVH A;  3ZDM A;  2M0B A;  1NWQ A;  4XXL A;  4WQ8 A;  4Y28 J;  4L75 A;  1OVV A;  1I8P A;  2Y0D A;  1VDF A;  3SSU A;  5AW1 B;  1FZC C;  3H1L J;  1RF1 A;  3E1I A;  3L75 E;  1N7S C;  5AUR A;  4AAM A;  3CCU P;  1VPC A;  5CIH B;  2JO1 A;  1FDM A;  2N9J A;  1CRH A;  5AVU B;  1JY3 P;  2QM7 A;  2ITA A;  1S72 P;  5KLV J;  4OGQ C;  3QH9 A;  3HQ7 A;  5BU5 A;  4WQE A;  3CU4 A;  2B0Z B;  2ZYD A;  1KFN A;  1VQ7 P;  2NPS C;  1NU1 E;  2WQY C;  2IZ1 A;  1N73 C;  1S5L E;  2PFX A;  2ZYA A;  1FOS E;  4PV1 C;  5KKZ B;  4ZKP A;  1NKZ B;  5AW3 B;  3CWB E;  2QJP B;  1GL2 A;  5GTI V;  1HJB A;  3HE5 B;  1W5C E;  4WWI A;  1URQ A;  1AQT A;  2Q9I A;  2W90 A;  3OA7 A;  1LC2 A;  3VYI A;  4WQ9 A;  1JEK A;  1L0L D;  2ZBO A;  1FAV A;  3AEB C;  1R8E A;  2K9J A;  1IRW A;  1DW3 A;  4O9B A;  1KC8 Q;  2M8R A;  2QJY B;  2E43 A;  3H1J J;  2IBZ D;  1K73 Q;  2FXO A;  1QL4 A;  4MU8 A;  5AVY B;  1KYO W;  2WVR A;  2O1K A;  3C9I A;  5CHX A;  2OYH B;  2QJP C;  4H44 C;  3L71 D;  3WFD C;  1HTL C;  2ZVO B;  1CXA A;  2WSC H;  3V5B A;  1OW8 A;  4EDF A;  3B71 A;  3I55 P;  1XTG B;  5TIS V;  3FGA D;  5DJQ C;  2E74 B;  1D7M A;  1PGQ A;  3D0W A;  1YIJ P;  1PGP A;  4FA5 A;  3V2R A;  1GW3 A;  1CXC A;  3VMA A;  2QJY C;  2AEF A;  1NTM G;  2W27 A;  4W7Y A;  4BRY A;  2KZI A;  4EOT A;  3ZOW A;  2KNC A;  3SVW A;  1SFC D;  1OVR A;  2N9B A;  3OAK A;  2ZAE B;  4O1W A;  4EYY Q;  2KK7 A;  4EIF A;  1BE3 E;  1MV8 A;  1PV3 A;  1FDO A;  2CK3 H;  3L37 A;  1NIR A;  5KAI H;  4W7Z A;  1NTZ K;  1EC5 A;  2QE7 H;  4WQ7 A;  1M6Z A;  1SQB D;  5CIF B;  3N7N A;  3AEE C;  3H1H D;  1RE3 A;  2BCC G;  2N1T B;  5CCH A;  5KJ7 C;  3O0R C;  1QL1 A;  1VF5 C;  4EIJ A;  1SFC B;  3S9O A;  2BLF B;  1NO4 A;  3RK2 C;  1P84 E;  4PJ0 E;  2WSC J;  3U1A A;  3C1L A;  3WUV A;  1EZV E;  4Y99 C;  4D6T G;  1JMM A;  3H32 B;  3ZBM A;  2J58 A;  3CX5 E;  3RK3 B;  4WY4 C;  1OIP A;  2YO3 A;  3BAT A;  3A0B H;  3KZI E;  3OW2 O;  2Z4E A;  2I8D A;  3IR9 A;  1Q7Y Q;  1RE4 A;  4H0L C;  1SQV G;  2P2U A;  2H88 C;  4LC1 A;  4P4Q B;  1NTK K;  1KX2 A;  1NMI A;  1L0N D;  4AAN A;  2A45 H;  1SS1 A;  1LWU C;  3H1L E;  3L72 E;  2WPR A;  4PW9 B;  3MIW A;  1R5L A;  2R3S A;  4R4L A;  5CJ0 A;  1NTZ E;  1E8E A;  1LT1 A;  1N2D C;  1IJD B;  1EB7 A;  5KLV E;  2Y0C A;  2FFD A;  2GB8 B;  3C8V A;  3P8C D;  2BH5 X;  3OCD B;  3HE4 B;  3RBX A;  1BCC G;  1M57 D;  2O01 H;  1OWA A;  2NRG A;  1DT1 A;  1LMS A;  4TLF A;  2ZON G;  1COR A;  2AEM A;  3L75 D;  4Y5R A;  2E76 D;  2AXT V;  1FJ0 A;  1SQX J;  1M56 D;  4K3A A;  3Q2Y A;  1J1E C;  1NTM D;  1FU1 A;  5L8R J;  3L70 E;  3TYI A;  1NU1 D;  1R0Q A;  2XND H;  3RL0 g;  2N9I A;  3M0D A;  3FWL A;  1KIL D;  3WFE C;  2XV5 A;  2FYZ A;  1LTJ C;  3MZW B;  3L74 D;  4WQB A;  3KYQ A;  1X9V A;  5H2F H;  3CPW O;  1Q82 Q;  3MUD A;  3SJL A;  1G1J A;  4U3F E;  5KAF E;  3II6 A;  5B66 H;  1AOQ A;  4GYD A;  3VRD A;  1GU4 A;  1EXJ A;  3E1R A;  1T2K C;  2YO2 A;  1VQ9 P;  4MN4 C;  4KT0 J;  1LP1 A;  2JEE A;  1U57 A;  1KIL B;  1Y9B A;  3Q5R A;  5APQ A;  2O01 J;  1YEB A;  1FZB A;  1GD2 E;  1BL9 A;  2XDJ A;  1YQ3 C;  5EFW B;  3L73 G;  1AFO A;  4D6T D;  3TDK A;  2C1D B;  3CCS P;  3O6Q A;  1J2J B;  3PXW A;  3GF7 A;  1GDV A;  2BEQ D;  1YNR A;  2K37 A;  2V4H A;  3D70 A;  1IFI A;  3MK7 B;  3VOP A;  1GU5 A;  3G71 P;  1HGZ A;  3SWY A;  2D2C D;  1S6V B;  2IFN A;  1S5L V;  3F5H A;  2FYU K;  2H89 C;  3GHG C;  1OVU A;  3A7O A;  1COT A;  1SQP K;  3B5N C;  1YIT P;  3RN1 A;  3NMD A;  2DVH A;  5KTB A;  5CBN A;  1CRJ A;  1FZC A;  5GTH H;  2BCC J;  1CI6 A;  3CXH D;  1Q81 Q;  1C6R A;  1N7S A;  2I1K A;  1KYO E;  1HGV A;  1BE3 D;  4UB6 H;  2RMZ A;  2V08 A;  2A06 E;  3W68 A;  3V4Q A;  1HBW A;  3NBT A;  1LNQ A;  2D2C B;  1M70 A;  1CCH A;  2JWD A;  1VQL P;  2YKP A;  4UB8 H;  1EDL A;  4OH8 B;  4L73 A;  3MHV A;  2KS1 B;  2NPS A;  3CX5 W;  1HVV A;  1YIQ A;  4LLH A;  1N73 A;  2ZOO A;  1LT9 B;  1SQQ J;  3HRN A;  1N9C A;  3A2A A;  1KQG B;  2KIK A; 
#chains in the Genus database with same CATH homology
 1CRH A;  1CYC A;  3PH2 B;  1C52 A;  3HQ6 A;  4EIC A;  1H1O A;  2C9X B;  1P84 D;  3HQ7 A;  1A8C A;  2ORL A;  4WQE A;  3CU4 A;  2B0Z B;  4QAO A;  3CWB D;  1RAQ A;  1CTJ A;  1H9X A;  2JTI B;  1AYG A;  1CHJ A;  1CSX A;  4L1Q A;  2YQB A;  5KKZ B;  4FA9 A;  1FI9 A;  5CYT R;  1K3H A;  5CID B;  2QJP B;  1C2R A;  1B7V A;  3NBS A;  1LC1 A;  1CCR A;  1FI3 A;  3DP5 A;  5GTI V;  2PAC A;  3PXS A;  3PTZ A;  2K9J B;  4PD4 D;  1CIH A;  1LC2 A;  1JDL A;  4WQ9 A;  1CHI A;  1L0L D;  2ZBO A;  1HZV A;  1MG2 D;  1IRW A;  1DW3 A;  5DF5 A;  2QJY B;  5C9M A;  2IBZ D;  1CRY A;  1A2S A;  1SQX D;  1CSV A;  1QL4 A;  4MU8 A;  3M97 X;  1W2L A;  2QJK B;  1A56 A;  3O20 A;  1KYO W;  4FAN A;  1I6D A;  1WEJ F;  1QL3 A;  2B10 B;  3L72 D;  2C1D A;  5KLI B;  4FA1 A;  3L71 D;  2GIW A;  4V2K A;  3WFD C;  2N18 B;  1CRG A;  5CIE B;  3CXH W;  1CXA A;  155C A;  4EDF A;  1NTZ D;  1RZ5 A;  5KAI V;  4O1Q A;  5TIS V;  5DJQ C;  1KX7 A;  3C2C A;  2GC7 D;  1CHH A;  3VNW A;  2V07 A;  1FI7 A;  4FA5 A;  5C0Z A;  1CXC A;  3VMA A;  1I54 A;  1LFM A;  1HRC A;  4FAV A;  3PRJ A;  3OA8 B;  1M60 A;  3MK7 C;  3ZOW A;  1KB0 A;  1L9J C;  3CP5 A;  3SVW A;  5B6Q A;  2N3B A;  2QG4 A;  1HJ4 A;  4O1W A;  1CIE A;  1CYI A;  1FCD C;  2Y0E A;  4EIF A;  4K3I A;  3VYM A;  5H2F V;  4JCG A;  3WFB C;  1YFC A;  2YCC A;  1YCC A;  4EIE A;  1I6E A;  3L70 D;  1NIR A;  3A0H V;  2MHM A;  3RMZ A;  3A0B V;  2KS1 A;  3NWV A;  1NNO A;  4WQ7 A;  1M6Z A;  1SQB D;  5CIF B;  3O5C A;  3H1H D;  3PHL A;  5EXQ A;  3ZOX A;  2CXB A;  1H33 A;  3O0R C;  2XTS B;  2B11 B;  4YE1 A;  1DIQ C;  1VYD A;  2C1U A;  3L4O A;  1LS9 A;  1YIC A;  1NTK D;  1EZV D;  2BLF B;  1HJ3 A;  1AKK A;  1CTY A;  3DR0 A;  5CIG B;  4U3F D;  3CX5 D;  4A7P A;  2N9Y B;  1IQC A;  1OAE A;  2Q3E A;  3SXT A;  2BPB B;  4J20 A;  4RJT A;  1N15 A;  1PP9 D;  3ZBM A;  5CIB B;  1IZL 0;  2BCC D;  2VHD A;  1CIF A;  1YEA A;  3HQ8 A;  1H32 B;  2FWL A;  3KHU A;  3X39 A;  1H9Y A;  1CNO A;  1CYJ A;  3WC8 A;  5B5E V;  2N3Y A;  2BCN B;  3SLE A;  1J3S A;  1HCM A;  2BGV X;  3RN0 A;  1QYZ A;  3H1L D;  4KMG A;  1WVE C;  4P4Q B;  1KX2 A;  1NMI A;  2O3J A;  1L0N D;  3PXT A;  1C7M A;  2L91 A;  3O1Y A;  1SQQ D;  1KV9 A;  3GW6 A;  1DVH A;  2AIU A;  2CE1 A;  4AAN A;  2FRC A;  4UB6 V;  4WQA A;  3JBT B;  3WU2 V;  2OZ1 B;  1DII C;  1RZ6 A;  3ORV A;  2C2C A;  1NML A;  4UB8 V;  1IO3 A;  4PW9 B;  4PJ0 V;  3ZCF A;  5KLV D;  2I8F A;  1C6O A;  3ITK A;  1N50 A;  2MTA C;  1E8E A;  1SQV D;  1F1C A;  1EB7 A;  1H31 B;  4NFG B;  1MZ4 A;  1CSU A;  5KAF V;  2Y0C A;  1KYO D;  2GB8 B;  1F1F A;  2A06 D;  2BH5 X;  3OCD B;  1QKS A;  3KZI V;  1E2R A;  2GC4 D;  3CYT I;  4L3G A;  1CIG A;  1KB9 D;  2N18 C;  1GJQ A;  3OA8 A;  1DT1 A;  5TJH A;  4Q5P A;  2YK3 A;  5DFS A;  1LMS A;  2ZON G;  1COR A;  2C1V A;  3L75 D;  4Y5R A;  1CTZ A;  1ZZH A;  5B66 V;  2AXT V;  2HV4 A;  1N90 A;  1FJ0 A;  3BCC D;  1NTM D;  3H1J D;  2B4Z A;  4AAO A;  4AAL A;  351C A;  2AI5 A;  5CIC B;  2JWA A;  1FOC A;  3TYI A;  1CRC A;  2B12 B;  1CSW A;  1RAP A;  1CO6 A;  1NU1 D;  1R0Q A;  4N0K A;  3ZOO A;  2N9I A;  1BCC D;  4AX3 A;  4FA4 A;  3FWL A;  1PPJ D;  3WFE C;  1MG3 D;  1DW2 A;  4XYD B;  1K3G A;  3L74 D;  4WQB A;  1DW0 A;  1U75 B;  1DW1 A;  4H0J A;  4RSZ A;  1OCD A;  3SJL A;  1GU2 A;  2CA4 B;  3DMI A;  4WQD A;  4FB1 A;  1GIW A;  1HZU A;  2YIU B;  4PWA A;  1AOQ A;  1I5T A;  4GYD A;  3VRD A;  4EID A;  2FYU D;  1I8O A;  1IRV A;  2FYN B;  2ZZS 1;  1SQP D;  1FHB A;  1CC5 A;  1YEB A;  1BL9 A;  3TGU D;  5DJQ B;  2JQR A;  5GTH V;  2PCB B;  1H32 A;  1CED A;  1C6S A;  3PLN A;  4D6T D;  1ZRT D;  3TDK A;  1GKS A;  3RLM A;  2C1D B;  4WQC A;  2PCC B;  1C2N A;  2C8S A;  3PXW A;  1GDV A;  2D0W A;  1YNR A;  4L3H A;  2D0S A;  4LJI A;  3MK7 B;  1AOF A;  1L9B C;  1KIB A;  2L4D A;  2LIT A;  4GED B;  1BGY D;  1GQ1 A;  1ETP A;  1S6V B;  1CRI A;  2OZ1 A;  2LIR A;  3SWS A;  1S5L V;  3TF5 A;  5IY5 1;  3L73 D;  1COT A;  3RN1 A;  2DVH A;  2ZXY A;  3WUI A;  2EXV A;  3ZIY A;  1CRJ A;  1C75 A;  1U74 B;  1HJ5 A;  2KNC B;  3CXH D;  3H1I D;  3ZOY A;  1H31 A;  1C6R A;  3A9F A;  1BE3 D;  1E29 A;  2DGE A;  2CE0 A;  2RMZ A;  2V08 A;  1YTC A;  3OCD A;  4XXL A;  3NBT A;  1HRO A;  4WQ8 A;  4IL6 V;  1M70 A;  1HH7 A;  4H0K A;  5E79 V;  1CCH A;  1I8P A;  1W5C T;  1I55 A;  2RN0 A;  2Y0D A;  3H1K D;  4DY9 A;  3CX5 W;  1YIQ A;  2BH4 X;  3GG2 A;  451C A;  2ZOO A;  1DVV A;  5AUR A;  1QN2 A;  4AAM A;  3WFC C;  5CIH B;  2CA3 B;  1H33 B;  1N9C A;  3HQ9 A;  3L4M A;  2N9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...