1BE3D

Cytochrome bc1 complex from bovine
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 61
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1be3D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1be3D01
3TF5A 1H32A 1A2SA 1H9XA 1HJ4A 1M60A 1CNOA 3NBSA 3O0RC 5DJQB 3ZBMA 1HH7A 3PH2B 2FRCA 1MZ4A 3SXTA 1FCDC 1DW3A 1DW2A 1CYCA 2Q3EA 5KAFV 1CORA 4J20A 1J3SA 3A9FA 1ETPA 5TISV 3L75D 1DW0A 1PPJD 1CSXA 3SLEA 4Q5PA 2K9JB 3ZCFA 5KLVD 3WFEC 2QG4A 3OA8B 5CIFB 1I54A 2OZ1A 4GEDB 1DIQC 1GIWA 3A0BV 2ZONG 4WQCA 2C1UA 3VMAA 3WFDC 1R0QA 1I8OA 3PXSA 1FHBA 4PW9B 2N9IA 3O20A 3WFBC 2RMZA 2AIUA 1AYGA 2RN0A 4QAOA 1M70A 4FA9A 4GYDA 2PCCB 1CRIA 4D6TD 1K3GA 2GC4D 1GJQA 2KS1A 5CIEB 2CA3B 3PLNA 4KMGA 1I8PA 1RAPA 1IO3A 1M6ZA 1DT1A 2MTAC 4O1QA 1H31B 1QL3A 2MHMA 2JTIB 1NIRA 1YTCA 3O1YA 1FOCA 2B11B 4JCGA 3HQ9A 1YNRA 2A06D 1NTMD 3KZIV 1BGYD 5TJHA 2C9XB 1CRYA 4WQBA 1OCDA 1HZVA 1COTA 1E2RA 3PHLA 2AI5A 1H31A 1HROA 2OZ1B 1HJ5A 2YIUB 1C6SA 1NMIA 4V2KA 3L71D 2XTSB 2N3BA 1YIQA 5C0ZA 4O1WA 2B0ZB 4AALA 1H9YA 2VHDA 2YQBA 3H1HD 1FJ0A 1SQXD 1CSVA 1ZZHA 4MU8A 4Y5RA 4AX3A 2JQRA 1FI9A 4RJTA 1I5TA 1NTZD 3TYIA 2C1DB 3JBTB 4L3GA 1RZ6A 3ZIYA 3WFCC 3DMIA 3RN1A 3PXWA 1MG3D 2C1DA 2ZOOA 1QKSA 2IBZD 4K3IA 3ITKA 2FYNB 1F1CA 4FAVA 1CHHA 1CRCA 4WQ7A 1BCCD 4FANA 351CA 4L1QA 3CYTI 2LIRA 1C2RA 3CWBD 1CO6A 2B10B 3O5CA 1QN2A 3HQ6A 3CX5W 1H33A 1GDVA 1A8CA 3PTZA 1NTKD 1H1OA 1I55A 3OCDB 4FA4A 2L91A 2YCCA 3SJLA 2CXBA 2QJKB 3RMZA 2V08A 3VYMA 3TDKA 1LC1A 1KYOD 1CYIA 1NU1D 3MK7C 3C2CA 4PD4D 2LITA 2BH5X 3CXHW 1CRJA 1S6VB 3WU2V 1YCCA 2GB8B 4YE1A 1E8EA 2JWAA 5DFSA 5CICB 1A56A 3RN0A 1E29A 1FI7A 4L3HA 4H0JA 2D0WA 3H1ID 4U3FD 1CEDA 1KB9D 3L4MA 5EXQA 1N50A 1HRCA 5CIBB 1SQPD 1CC5A 4EIFA 3H1KD 2BLFB 1EB7A 4A7PA 3CP5A 4PWAA 5CIHB 1YFCA 5KLIB 4DY9A 3ORVA 2Y0EA 2BCNB 1HZUA 1GQ1A 1IQCA 1QL4A 1CHJA 4WQAA 1CIFA 2PACA 1HCMA 1OAEA 1KIBA 1IZL0 1I6EA 3ZOWA 2N9JA 1L9JC 3SWSA 451CA 5KAIV 4XXLA 5B66V 1H32B 1BE3D 4WQ9A 1C52A 1LS9A 4P4QB 1C6RA 2BGVX 1NMLA 1L0LD 2BCCD 3KHUA 1CHIA 1CIGA 2GIWA 2V07A 5C9MA 1YICA 5KKZB 1DIIC 3VRDA 3DP5A 3TGUD 2N18C 1H33B 1MG2D 4AAMA 5B6QA 2ZBOA 5GTHV 1CIEA 1SQVD 3A0HV 1GU2A 1RZ5A 3GW6A 1L9BC 1W5CT 1IRVA 4UB6V 4WQ8A 3ZOOA 3OA8A 3L74D 3L4OA 1WVEC 4N0KA 2I8FA 2B12B 3PXTA 5AURA 1I6DA 1YEBA 1AOFA 2HV4A 3CXHD 3L73D 1BL9A 3HQ7A 1YEAA 1C6OA 1DVHA 1DW1A 1VYDA 4FB1A 2CE1A 5CIDB 2Y0CA 1CSUA 3ZOYA 155CA 2QJPB 2Y0DA 1SQBD 1KV9A 4LJIA 2CA4B 2N18B 5CIGB 1IRWA 1CTJA 3CU4A 5CYTR 1GKSA 5IY51 1L0ND 2QJYB 1KYOW 4AANA 1CXAA 3L72D 4WQDA 2ZZS1 2BH4X 2PCBB 3M97X 3MK7B 5GTIV 2DGEA 1N9CA 1SQQD 1LFMA 2BPBB 2L4DA 1ZRTD 2ZXYA 1KX7A 4UB8V 3ZOXA 1CCHA 3PRJA 2YK3A 1WEJF 1CTYA 3VNWA 5H2FV 3HQ8A 1U75B 3RLMA 1N15A 1C75A 3GG2A 2C8SA 4PJ0V 1CCRA 1N90A 2N3YA 4AAOA 2AXTV 2CE0A 1CTZA 1CSWA 1CXCA 2KNCB 1DVVA 1LC2A 2B4ZA 4EIDA 1HJ3A 3BCCD 1KB0A 4RSZA 2C2CA 1C7MA 1CRHA 4WQEA 1NNOA 1AKKA 1K3HA 2DVHA 4FA5A 1RAQA 1LMSA 2GC7D 1AOQA 5E79V 4H0KA 4XYDB 3WUIA 1CYJA 5B5EV 3NWVA 4IL6V 4EDFA 3CX5D 1U74B 4NFGB 3FWLA 1CRGA 4FA1A 1JDLA 2FYUD 2FWLA 1FI3A 3NBTA 1KX2A 2D0SA 4EICA 1EZVD 3SVWA 3WC8A 1PP9D 5DJQC 1C2NA 2O3JA 2N9YB 1P84D 1QYZA 1S5LV 1CIHA 3DR0A 3L70D 1B7VA 2ORLA 2C1VA 1F1FA 2EXVA 5DF5A 4EIEA 3X39A 3H1JD 3OCDA 3H1LD 1W2LA
chains in the Genus database with same CATH superfamily
1PGJA 3PH0A 1VQ6P 1H32A 1HJ4A 1S5LH 1M60A 3HE5A 3AE9C 3B5NB 3SXTA 1FCDC 3L73J 5B66H 4HH2A 1LNQA 3NFQA 1J3SA 5TISV 1J1DB 2Z4EA 2ZT9C 1PPJD 5CCHD 1CSXA 2IPPA 1QX8A 3SLEA 2K9JB 3ZCFA 1VF5C 1JOCA 4H13B 2WSFH 5KJ7A 3M06A 4ZNCA 1YYCA 1GIWA 3A0BV 5AVVB 1IFJA 4GODA 2C1UA 3VMAA 4Y99C 1SQBK 3PXSA 5KTBA 1RY3A 1S3JA 3U1AA 2RMZA 1RF1C 2H43A 2FXPA 3L71G 3CCEP 1OMIA 1M70A 4GYDA 2PCCB 4D6TD 1K3GA 2GC4D 1GJQA 1RH5B 2KS1A 2CA3B 4WB4A 5AW7B 2J5UA 1M6ZA 2MTAC 3CMEP 1EDLA 1IFIA 1PPJG 1KFNA 1GL2A 1YTCA 1QEXA 2B11B 4JCGA 3I55P 2A06D 3KZIH 1PP9E 1N2DC 1NAYA 3B5NC 1COTA 3PHLA 2ITAA 2YMYA 1PL5A 2W6AA 3GF7A 2A45I 1NMIA 4V2KA 4AUWA 1JCDA 4IFMA 3L71D 2N3BA 2AEJA 1YIQA 2BASA 1NTKJ 1H9YA 3T97A 2QE7H 1LTBC 4H0LB 4ASVA 2M0BA 3Q5RA 3L72E 1CI6A 4L75A 4N3YB 4CPGA 4WY4C 3IF4A 2AXTH 2XKMA 4PJ0E 3L74G 1KD1Q 1I5TA 3FXEA 2ZT9D 4WY4B 1BDDA 5B5EE 3WFCC 3V2QA 3RN1A 2SPZA 2RH0A 1QKSA 3ITKA 4IFDK 4JPZB 1SFCA 2NPSA 1SQPK 2N1TC 2O01H 4FANA 1LT9B 2FYUE 4D6TG 1BDCA 4UB6H 3CYTI 5GTHE 2MKVA 4JF7A 4YTPC 1U7MA 2LIRA 5AVZB 2OYIB 1CO6A 4TLFA 1PGOA 1PP9G 2OARA 3L75E 1L0LK 1PGQA 1RF1A 3AE3C 5KLVG 1GZLA 2L91A 3G3ZA 5KAFH 5KAIH 3SJLA 3GF3A 4U3FJ 2YKOA 3RMZA 1LC1A 3MK7C 1W2BO 1NJIQ 1JCCA 3CXHW 1S6VB 1SFCB 2QJYC 1YCCA 2GB8B 4ASWA 5DFSA 5CICB 1A56A 3C9IA 1FI7A 2YNYA 4H0JA 5CMZA 2WTYA 2R5BA 3V2RA 1LTSC 3CL3D 1KB9D 3L4MA 2UWJE 2Q9IA 2E42A 2IX7C 1VDFA 3D0WA 4PD4H 1OIPA 1EB7A 1KFMA 1YFCA 2HFED 3AE1C 1XTGB 2XNXA 1HZUA 3S1KA 3L37A 1QL4A 3TGUJ 3RK3D 1KIBA 1IZL0 1KB9H 2K1AA 2KYVA 451CA 1T2KC 5KAIE 5B66V 4UB6E 1KILC 3H1KJ 2BEZF 4P4QB 1SQBG 4I7ZB 1L0LD 1KZUB 4PV1B 1NTMG 1CIGA 2V07A 3CXHH 1YICA 1KB9I 3VOPA 2CPBA 4R4LA 3VRDA 1CW5A 4BXLA 1H33B 5CJ4A 1QVGO 1A02J 2G3AA 2K88A 1OVUA 2ZBOA 2J58A 1SQVD 1BE3G 1LTAC 3SFEC 1GU2A 1JY2P 4HYTB 2GUSA 3OA8A 1SVFA 2WVRA 3H1IE 1BSNA 1L0NJ 5APYA 3WU2H 3PXTA 3NTNA 1YQ3C 1SFCD 3SWYA 1YEBA 2QA4P 4HB1A 1VQOP 2AEFA 5GTIH 5GTIE 1DVHA 1LT9A 155CA 1JNMA 1KV9A 3HE5B 5CIGB 1OFCX 1ZRTE 1IRWA 1U7JA 3L72D 1QL2A 5APWA 2ZZS1 2BH4X 1VQPP 5AVSB 1SQQD 1L0NE 1HWTC 1W2EA 1OWAA 1HH0A 1ZRTD 4UB8V 1LT1A 5AW5B 3H1IJ 1CCHA 2IZ1A 1FZFA 2IBZE 3AE6C 3R2PA 3GG2A 1RE3A 2K3RA 2QJPC 3CWBE 1HJ0A 4HKZH 1CTZA 1CSWA 1CXCA 2KNCB 2FBWC 1WMKA 2D2CB 1EZVI 3GHGA 4I1LA 5KLVK 1WT6A 1RQUA 4H0LD 1NNOA 4Y28J 2I1JA 1AKKA 4FA5A 2XZRA 1SQQJ 5APUA 1LMSA 3LW5H 5CJ0A 3CPWO 4EDFA 2WSEH 1E5WA 1GW3A 2QSIA 5CCHA 3VMZA 1CRGA 1LTJB 4FA1A 5BU8B 1Q7YQ 2E75C 3WMM0 2V7QH 3KZIE 2GM4A 3SVWA 3WC8A 4PV1D 2NPSD 2O3JA 2Q5UA 1SQVJ 1L4AC 3M0DC 3DR0A 5AVUB 2ORLA 1NU1E 5KKZC 3TF5A 2IBZG 3ZBMA 1H9XA 2OYIC 5DJQB 3PH2B 1VQ9P 4QMAA 1AFOA 1CYCA 3B8EB 1FE6A 2R3SA 4EI2A 2WSEJ 3A9FA 1ETPA 3L75D 1DW0A 1Q81Q 3H1JE 4Q5PA 2QRXA 3JCUE 3VTPC 2QG4A 4WWIA 4XE5B 1X79B 4GEDB 5APTA 2JKVA 4WQCA 5KLIC 3L71E 2ZYAA 2NPSC 3HE4B 1I8OA 5E79H 1NTMJ 5APVA 4PW9B 1VQ5P 2NRGA 3WFBC 3M91A 3AE8C 3Q5SA 4H0LC 2AEMA 2CPSA 3D71A 1BGYE 3QH9A 3NMDA 2QIWA 1IO3A 2KNCA 1DT1A 2JP3A 3RBXA 1QL3A 1GW4A 3H25A 4PV1C 2O1JA 4W7YA 3H1IG 1NIRA 4I7ZC 3O1YA 3E1RA 1FOCA 3HQ9A 1YNRA 4AQRD 3KZIV 2IFMA 5TJHA 4GDOA 4K35A 2C9XB 2KLUA 2E75D 3EFGA 2N1TD 1HJ5A 1C6SA 1GTWA 3KQGA 3OW2O 2HG5D 4IL6H 2XTSB 3M0AA 4GOFA 5CBOA 5EFWB 2IBZI 5DJUB 2BCCG 2Z5IA 2C9LY 1JUNA 1FJ0A 1JEKA 1VQMP 1YTZT 1ZZHA 5AW4B 3ABVC 3TNUB 2JQRA 3F5HA 3L70E 2W6JH 1NTZD 3TYIA 1SFCC 1SQPE 1L0LG 1RZ6A 4H13C 3ZIYA 1SS1A 5KJ7C 2K37A 3PXWA 2WZ7A 1MG3D 1YJ9P 4K3IA 4FAVA 1XTCC 1CHHA 4WQ7A 1SLQA 1Y9BA 4GT1A 3HUSC 351CA 4RESB 4L1QA 1S72P 1YHQP 2HYNA 2ZFCA 4WBAA 3CWBD 1R5LA 3V2NA 1BCCE 2B10B 1L0NG 2A06E 3P8CD 5KLVE 1CSBA 1FS0E 1ZP0C 5AW2B 5CCGC 2LKMA 2LR2A 2VRSA 2FFDC 1VQKP 2YIUC 1DD3A 2JEEA 1NTZG 4NPEA 1T3JA 4DOJA 4H44C 2QVAA 2QJKB 1KYOD 1CYIA 2LITA 2WITA 5AVYB 1CRJA 2ZXXA 2JR8A 2B89A 4U3FE 3BVHA 2ZAEB 1OZHA 2HODA 1EDJA 3B5ND 4WY4A 3MUDA 3RN0A 1E29A 5E79E 3HUSA 2OTKE 1VF5D 2YO3A 1HRCA 1IC2A 1NGMB 1PPJE 1CC5A 4EIFA 4L74A 2ZYGA 4LLHA 1J1EC 3H1KD 2E76D 4W80A 4JBZA 3W67A 3CP5A 5CIHB 1ZV8A 1X8YA 1JM0A 2FXOA 1YI2P 1H0TB 3V4WA 1L2PA 1CHJA 1VQNP 1HJBA 1YJNP 1SQBE 1NWQA 1OAEA 2WSCH 2E74B 2N9JA 1L9JC 5KAIV 4XXLA 1JO5A 1AVOA 3AE2C 3U1CA 4WQ9A 1ZN5A 1M7LA 2OYOA 1C6RA 3JSVC 1NMLA 5C9MA 1DIIC 3MUDC 3CMAP 1FZCC 3A0BE 3HTKA 3A0BH 2N18C 5AVTB 2FY8A 1MG2D 3HD7C 1GK4A 1KYOH 3KYQA 4UB8H 1S5LX 1MKMA 5GTHV 2FFDA 1S2EA 1A02F 1L9BC 1IRVA 4WQ8A 3BCCG 3ZOOA 1PV3A 2CK3H 2HPCB 3L74D 4Y99B 2PP6A 3RK2B 1M1JB 2H88C 1E79H 2KZIA 1GU5A 2KLVA 5AURA 3TGUE 3D6ZA 1IJDB 2HV4A 4ZKPA 1N73A 3HQ7A 4U3FG 5AW0B 1VYDA 2CE1A 5KLVJ 2Y0CA 1USEA 4LJIA 1QL1A 3CU4A 1GKSA 5IY51 1L0ND 1T8ZA 1G2CA 4JYCA 1N7LA 4WQDA 4GKGA 1KB9E 1OW8A 4XFJA 2PCBB 3M97X 1HVVA 2FYNC 3CX5I 3M9HA 3PJSK 3FX0A 3ZOXA 3TYYA 2KS1B 4OGQB 1CTYA 3VNWA 3RLMA 1LTJA 2W6BA 1C75A 1CCRA 1N90A 3L74J 1M1KQ 1LC2A 2B4ZA 4EIDA 1HJ3A 3BCCD 3R4YA 2KOGA 4RSZA 3AECC 1RQVA 3CCRP 2AXCA 2E76B 1FOSE 3V4QA 4H44D 2DVHA 1P84I 2R5DA 3HTKB 1U57A 4LC1A 1L0LJ 2GA1A 4XYDB 3WUIA 3WUTA 5B5EV 1G1IA 2KXPB 4PJ0H 3NWVA 1EC5A 3BCCE 3CX5D 5H2FH 1DX7A 1LWUB 1KMIZ 4EIJA 1LWUA 3FWLA 3GLMA 1BCCG 2JWDA 1JDLA 2FYUD 2FWLA 1SQBJ 1FI3A 1VQ7P 1M1JA 4EICA 1FZAA 2B87A 1C2NA 1RE4A 1KILD 2WPSA 2Q1KA 3TGUG 3RL0C 1B7VA 2C1VA 3G9RA 3RK3B 3P32A 4IL6X 2IZ0A 2EXVA 2M5AB 3RK3C 1NTKK 3SSUA 3OCDA 4KJMA 3H1LD 4XA4A 1W2LA 3RK3E 1HH7A 2M3EA 1R8EA 1MZ4A 1NTME 3CCMP 1DW2A 2YKPA 5AVRB 1JMMA 5KAFV 2WPVB 2PGDA 1CORA 2G8YA 2N9BA 1ZOYC 1ZMEC 3QWOC 3H1HE 1GDTA 1VL2A 5KLVD 3P8CE 3H1JJ 3WFEC 3OA8B 5CIFB 2ZVNB 1I54A 4KT0J 1D7MA 1JY2N 1FZBA 2FYUG 4D6TE 1CI6B 2L5GB 3H1LG 1R0QA 1KILA 3CLQA 2P67A 2N9IA 1HGZA 2FYZA 2BEQD 1HUCA 1JY3N 3O20A 1NU1J 3A0HH 2C0XA 2RN0A 1KTMA 1KORA 4QAOA 1ZXGA 4FA9A 1ZR2A 4PD4E 1NKZB 3AEAC 3PLNA 1SQVE 1PGPA 1WRGA 4O1QA 5H2FE 1TU3F 4RO0A 2MHMA 2JTIB 3CX5E 1USDA 3IFMA 1M57D 1M90Q 1KILE 3MZWB 1N8RQ 1H0TA 1CRYA 1Z56A 3E7KA 1OCDA 4OGQD 1E2RA 3MP7B 2AI5A 1H31A 2OZ1B 1K04A 2ZXEB 2YIUB 3RL0g 1FU1A 1NVOA 2XDJA 1URQC 5C0ZA 4O1WA 2MJZA 2FXMA 3A7OA 2VHDA 1NKNA 2YQBA 3H1HD 2WPRA 1EDKA 3H1KG 3S9OA 3CWBJ 4MU8A 4AX3A 3CC2P 2AXTE 2HR3A 1SQQK 2V4HA 4RJTA 1DH3A 1ZW0A 2C1DB 3A3YB 1MV8A 3JBTB 4L3GA 1VPCA 1NHLA 1SQVG 2ZOOA 1FDOA 1NU1K 5TISE 1IO4A 1F1CA 1CRCA 1BCCD 3VMXA 1L0LE 1T6AA 1Q2NA 1LTTC 1NU1G 1M56D 1PZQA 1KV4A 3LIDA 2C0WA 1N7SB 5AVWB 1BGYJ 3O5CA 3TK1A 2WT7B 4BRYA 1FZCB 3CCSP 1FDMA 3CX5W 5AW9B 1H33A 2GUVA 1GDVA 1A8CA 2R32A 3CX5H 3PTZA 1S5LE 1NTKD 2KIKA 4R4MA 1H1OA 1N7SC 1I55A 1VQ4P 1EXJA 3L71J 2YCCA 1X0TA 1BSHA 3VYMA 1YQ4C 2V08A 3N4XA 3VP9A 1NU1D 3C2CA 3LW5J 2E43A 4GIFA 1JTHB 1Y47A 1Y8AA 1OXZA 1E8EA 2JWAA 1BGYG 1GL2B 3H1JG 3BRVB 2W8ZA 1UIIA 3SWFA 3CCUP 2OYHB 4L3HA 4RKUJ 4U3FD 3V5BA 1CEDA 4U7JA 3CCQP 1N50A 3A0HE 5CIBB 1SQPD 2BCCJ 2M3BA 3Q2YA 2C9NY 2BLFB 4A7PA 1VQ8P 2PRRA 3AE7C 2NPSB 5KLIB 4DY9A 1M8OB 3ORVA 2Y0EA 3O8ZA 1URQB 3H1KE 3NXSA 1CIFA 2PACA 1M1JC 2J59M 1I6EA 1JTHA 2RKLA 1KQSO 1H32B 2YXQB 1C52A 2WSFJ 2E5TA 1FDIA 1FBMA 2BGVX 3ZDMA 1JMBA 2BCCD 3KHUA 2FFDB 1AA0A 1CHIA 2GIWA 5CCGA 1Q90D 5KKZB 1YBKA 3VN0A 1LTIC 2IDBA 2HODB 4AAMA 3H32B 1NO4A 4BRYB 2XNDH 2O01N 1CIEA 5KAFE 3A0HV 3KDPB 5APQA 3G6EP 2YXRB 1FJKA 2WSSH 2WPQA 1BE3J 1NTZK 3IAOA 4N0KA 2I8FA 3AEEC 1YITP 1JY3P 4W7ZA 3AEDC 1I6DA 1LJ2A 3LIEA 4IFFA 3L73D 5L8RJ 1C6OA 4C7NB 1NOHA 3L4FA 4L76A 1N73B 5BU5A 4YXWH 4FB1A 1T2KD 1N86A 5CIDB 1NTZE 5CBNA 2Y0DA 3II6A 1SQXG 1S9KE 1DD4A 2CA4B 4N6JA 1CTJA 5CYTR 1Q86Q 3EFFK 3RL0B 1CXAA 1IZNB 1SQQG 2KB7P 2YO2A 1R5SA 2P10A 5GTIV 1LP1B 3FGAD 3L73G 3G4SP 2D2CD 2Q7CA 1LFMA 2BPBB 2IFNA 4KHXA 3H1LJ 4GOEA 1S9KD 3PRJA 1WEJF 5H2FV 3JCUH 1P84E 1MZ9A 1P84H 1N15A 2R44A 2XU6A 1JY3O 5AW8B 4PJ0V 1OVRA 3CC4P 3L72J 4AAOA 3JC22 1SQXJ 2W27A 2N1TA 4UB8E 3CXHI 3SWKA 2Q3IA 1KB0A 3B5NA 2PAJA 2C2CA 1C7MA 1EZVG 1CRHA 1RE4C 3HUSB 4WQEA 3RGUA 1MUUA 3C8VA 3TSIA 3HD7D 1K3HA 5AW6B 2OYHC 1AOQA 5E79V 4H0KA 3P7KA 3RBZA 1GL2C 4IL6V 3AE5C 4AYCA 4EYYQ 1QGKB 1JB0J 3GMAA 1YTZI 3I56P 4NFGB 1SQXK 3HRNA 1HBWA 1SQPJ 3M9BA 3NBTA 1KX2A 2D0SA 1MFTA 3V2PA 1AJYA 1RF0A 1EZVD 4NPFX 5DJQC 2ZJSE 2N9YB 1QYZA 1IFDA 2PFXA 1Q82Q 3TNUA 4OWFA 2Z5HA 1F1FA 5DF5A 4EIEA 2BCCE 3X39A 3H1JD 1AQTA 1L4AA 3M0DA 2QEXP 1L4AB 3D70A 1N73C 1A2SA 3NBSA 3O0RC 1CNOA 3FWNA 3MD0A 1SQXE 2WWWA 2FRCA 1DW3A 2Q3EA 3Q1MA 1KILB 4D6TJ 5KJ7D 1URQA 4J20A 1LTJC 4YPCA 2QM8A 1OVVA 5C39A 1T3UA 3B4SA 2OZ1A 1DIQC 5AW3B 2ZONG 3V6IA 1NTMK 3H1HG 3A5TA 3WFDC 2QM7A 4OVNF 2A06G 2P7JA 3EQ2A 1FHBA 1S1CX 1EXIA 1IFNA 3RK2D 2AIUA 1AYGA 1SQVK 3KPEA 1YJWP 1NTZJ 2P1JA 3G71P 2Y9YA 2W90A 1CRIA 5CIEB 2H89C 1GMJA 2KI7B 1RE3C 4KMGA 2P2UA 1I8PA 1RAPA 1K73Q 3HD7B 2KP8A 1H31B 4HJGH 2B87B 1DIPA 4ZKUA 1URQD 1VQLP 2YKQA 1NTMD 1ZR4A 1HTLC 1BGYD 3FXDA 1EDIA 4WQBA 3BASA 4O9BA 1HZVA 4BWNA 1PIXA 4K3AA 1HROA 1LP1A 3MIWA 4LGDE 1BE3E 3A2AA 1OX3A 1KQFB 2IYPA 4NPDA 2OQQA 4IL6E 3PP5A 2K9YA 1H8AA 3M9QA 2B0ZB 4AALA 4EOTA 1DEEG 4TT3H 3AEBC 1KQGB 1NTKE 1L4AD 1SQXD 3E1IA 3L74E 1CSVA 3F89A 4C7NA 2WMMA 4Y5RA 2M5AA 3UIAA 1MFZA 1FI9A 1H88A 1L0NK 2O01J 2NZ2A 3CCJP 1PP9J 3L35A 5B5EH 3DMIA 2C1DA 1KQLA 1RF0C 2IBZD 2KK7A 3WUUA 2FYNB 5TISH 3AEFC 1SP4A 2Q6QA 4MN4C 3L75G 1SQQE 4OH8B 1FOSF 2D2CC 3BRTB 1C2RA 5AVXB 3CXHE 3C1LA 3O6QB 1KN7A 2DW3A 1OW6A 1UIXA 1QN2A 3HQ6A 3T97B 2POHA 3OAKA 1IFMA 1FZCA 2K9JA 3OCDB 4FA4A 3RL0D 2I1KA 3O6QA 3CWBG 1FAVA 1EQ7A 2CXBA 3TDKA 1GU4A 5APSA 3H1LE 4PD4D 2OYHA 2ZVOB 2BH5X 4DZOA 1FZEA 1NTKG 3H1HJ 3WU2V 1LWUC 4YE1A 2FKWB 3VP8A 1IFPA 1GK6A 2YMKA 2JO1A 4N78D 4DCKA 1LGHB 2D0WA 3L70G 3H1ID 2OGUA 2E76C 1CZQA 5EXQA 2OYIA 4M3LA 1RF1B 3OA7A 3SFDC 5K5GB 2HLOA 1KYOI 2H8PD 4PWAA 4C46A 1J2JB 2FYUJ 2WT7A 2BCNB 3WU2E 2O1KA 1GQ1A 1IQCA 2W83C 2A45G 2E5YA 4WQAA 1PFIA 1VF5B 3MTUE 1HCMA 1J1DC 3ZOWA 3SWSA 2WSCJ 1OW7A 1BE3D 1LS9A 3B71A 3BATA 1SQPG 2KUBA 3CD6P 1HF9A 4WVZA 3I5CA 1S4XA 3DP5A 3TGUD 2FYUK 1H89A 4ZMDA 4IOIH 3CCLP 5CCGD 2JDIH 3KXDA 5B6QA 3GHGC 5CHXA 3OJAB 3K5BA 4DJGA 3HE4A 2E75B 2N1TB 1RZ5A 1HGVA 3GW6A 4C7RA 1W5CT 4UB6V 5B66E 2IYOA 3U59A 3L4OA 1WVEC 1NH4A 3MGNA 1G2CB 1IK9A 4WY4D 2WQYC 2B12B 1AV1A 4N78E 1X22A 1AQ5A 1G1JA 1FZGA 4PD4I 5AW1B 2B88A 5AVQB 3RK2C 1AOFA 3IN6A 3CXHD 2ZYDA 1BL9A 2LXBA 5GTHH 1YEAA 1FJPA 1DW1A 1K9MQ 4DT0A 2OTJP 2KSJA 1CSUA 1BCCJ 3ZOYA 3IR9A 3L36A 2QJPB 3P8MC 1SQBD 3HD7A 5BVZA 1DEBA 2N18B 1N7SA 3AEGC 2QJYB 3W68A 3H32A 1KYOE 1KYOW 4AANA 1FC2C 3MK7B 2M8RA 5CCHC 2DGEA 1ZLLA 3H6PA 1N7SD 1N9CA 5DJTB 3AE4C 2XV5A 5APXA 4H13D 1RHZB 2L4DA 1LTGC 2ZXYA 1KX7A 5M1BA 2Y9ZA 2E74C 3CC7P 3L70J 4I2LC 3WUVA 3MHVA 2YK3A 2KSEA 4L73A 3S4RA 3HQ8A 3L73E 1U75B 1NAFA 2P58A 2B9BA 2C8SA 1EZVE 1KC8Q 2N3YA 1X9VA 2AXTV 2CE0A 2JJLA 1DVVA 3L75J 1J1EB 1W5CE 2A45H 3D6YA 2R3CA 1LT9C 4Z1MH 3USSA 1RAQA 2GC7D 4JQ0D 1CYJA 1GL2D 1NYHA 2V7QJ 1AVYA 3CCVP 1U74B 4OGQC 3CI9A 2ZT9B 4YXDC 2H7HA 1QVFO 3VMYA 3N7NA 1QLED 1GD2E 1YIJP 2QJKC 3BCCJ 4B86A 4H44B 3Q3DA 1K05A 1K8AQ 1JY2O 2HPCA 1PP9D 4JYBA 2I8DA 1P84D 3GHGB 1S5LV 1CIHA 3L70D 2LXCB 3L72G 3Q5PA 1IK7A 2KZJA 2OTLP 2E74D 3VYIA 4I6MC 3EWKA
chains in the Genus database with same CATH topology
3TF5A 1H32A 1A2SA 1H9XA 1HJ4A 1M60A 1CNOA 3NBSA 3O0RC 5DJQB 3ZBMA 1HH7A 3PH2B 2FRCA 1MZ4A 3SXTA 1FCDC 1DW3A 1DW2A 1CYCA 2Q3EA 5KAFV 1CORA 4J20A 1J3SA 3A9FA 1ETPA 5TISV 3L75D 1DW0A 1PPJD 1CSXA 3SLEA 4Q5PA 2K9JB 3ZCFA 5KLVD 3WFEC 2QG4A 3OA8B 5CIFB 1I54A 2OZ1A 4GEDB 1DIQC 1GIWA 3A0BV 2ZONG 4WQCA 2C1UA 3VMAA 3WFDC 1R0QA 1I8OA 3PXSA 1FHBA 4PW9B 2N9IA 3O20A 3WFBC 2RMZA 2AIUA 1AYGA 2RN0A 4QAOA 1M70A 4FA9A 4GYDA 2PCCB 1CRIA 4D6TD 1K3GA 2GC4D 1GJQA 2KS1A 5CIEB 2CA3B 3PLNA 4KMGA 1I8PA 1RAPA 1IO3A 1M6ZA 1DT1A 2MTAC 4O1QA 1H31B 1QL3A 2MHMA 2JTIB 1NIRA 1YTCA 3O1YA 1FOCA 2B11B 4JCGA 3HQ9A 1YNRA 2A06D 1NTMD 3KZIV 1BGYD 5TJHA 2C9XB 1CRYA 4WQBA 1OCDA 1HZVA 1COTA 1E2RA 3PHLA 2AI5A 1H31A 1HROA 2OZ1B 1HJ5A 2YIUB 1C6SA 1NMIA 4V2KA 3L71D 2XTSB 2N3BA 1YIQA 5C0ZA 4O1WA 2B0ZB 4AALA 1H9YA 2VHDA 2YQBA 3H1HD 1FJ0A 1SQXD 1CSVA 1ZZHA 4MU8A 4Y5RA 4AX3A 2JQRA 1FI9A 4RJTA 1I5TA 1NTZD 3TYIA 2C1DB 3JBTB 4L3GA 1RZ6A 3ZIYA 3WFCC 3DMIA 3RN1A 3PXWA 1MG3D 2C1DA 2ZOOA 1QKSA 2IBZD 4K3IA 3ITKA 2FYNB 1F1CA 4FAVA 1CHHA 1CRCA 4WQ7A 1BCCD 4FANA 351CA 4L1QA 3CYTI 2LIRA 1C2RA 3CWBD 1CO6A 2B10B 3O5CA 1QN2A 3HQ6A 3CX5W 1H33A 1GDVA 1A8CA 3PTZA 1NTKD 1H1OA 1I55A 3OCDB 4FA4A 2L91A 2YCCA 3SJLA 2CXBA 2QJKB 3RMZA 2V08A 3VYMA 3TDKA 1LC1A 1KYOD 1CYIA 1NU1D 3MK7C 3C2CA 4PD4D 2LITA 2BH5X 3CXHW 1CRJA 1S6VB 3WU2V 1YCCA 2GB8B 4YE1A 1E8EA 2JWAA 5DFSA 5CICB 1A56A 3RN0A 1E29A 1FI7A 4L3HA 4H0JA 2D0WA 3H1ID 4U3FD 1CEDA 1KB9D 3L4MA 5EXQA 1N50A 1HRCA 5CIBB 1SQPD 1CC5A 4EIFA 3H1KD 2BLFB 1EB7A 4A7PA 3CP5A 4PWAA 5CIHB 1YFCA 5KLIB 4DY9A 3ORVA 2Y0EA 2BCNB 1HZUA 1GQ1A 1IQCA 1QL4A 1CHJA 4WQAA 1CIFA 2PACA 1HCMA 1OAEA 1KIBA 1IZL0 1I6EA 3ZOWA 2N9JA 1L9JC 3SWSA 451CA 5KAIV 4XXLA 5B66V 1H32B 1BE3D 4WQ9A 1C52A 1LS9A 4P4QB 1C6RA 2BGVX 1NMLA 1L0LD 2BCCD 3KHUA 1CHIA 1CIGA 2GIWA 2V07A 5C9MA 1YICA 5KKZB 1DIIC 3VRDA 3DP5A 3TGUD 2N18C 1H33B 1MG2D 4AAMA 5B6QA 2ZBOA 5GTHV 1CIEA 1SQVD 3A0HV 1GU2A 1RZ5A 3GW6A 1L9BC 1W5CT 1IRVA 4UB6V 4WQ8A 3ZOOA 3OA8A 3L74D 3L4OA 1WVEC 4N0KA 2I8FA 2B12B 3PXTA 5AURA 1I6DA 1YEBA 1AOFA 2HV4A 3CXHD 3L73D 1BL9A 3HQ7A 1YEAA 1C6OA 1DVHA 1DW1A 1VYDA 4FB1A 2CE1A 5CIDB 2Y0CA 1CSUA 3ZOYA 155CA 2QJPB 2Y0DA 1SQBD 1KV9A 4LJIA 2CA4B 2N18B 5CIGB 1IRWA 1CTJA 3CU4A 5CYTR 1GKSA 5IY51 1L0ND 2QJYB 1KYOW 4AANA 1CXAA 3L72D 4WQDA 2ZZS1 2BH4X 2PCBB 3M97X 3MK7B 5GTIV 2DGEA 1N9CA 1SQQD 1LFMA 2BPBB 2L4DA 1ZRTD 2ZXYA 1KX7A 4UB8V 3ZOXA 1CCHA 3PRJA 2YK3A 1WEJF 1CTYA 3VNWA 5H2FV 3HQ8A 1U75B 3RLMA 1N15A 1C75A 3GG2A 2C8SA 4PJ0V 1CCRA 1N90A 2N3YA 4AAOA 2AXTV 2CE0A 1CTZA 1CSWA 1CXCA 2KNCB 1DVVA 1LC2A 2B4ZA 4EIDA 1HJ3A 3BCCD 1KB0A 4RSZA 2C2CA 1C7MA 1CRHA 4WQEA 1NNOA 1AKKA 1K3HA 2DVHA 4FA5A 1RAQA 1LMSA 2GC7D 1AOQA 5E79V 4H0KA 4XYDB 3WUIA 1CYJA 5B5EV 3NWVA 4IL6V 4EDFA 3CX5D 1U74B 4NFGB 3FWLA 1CRGA 4FA1A 1JDLA 2FYUD 2FWLA 1FI3A 3NBTA 1KX2A 2D0SA 4EICA 1EZVD 3SVWA 3WC8A 1PP9D 5DJQC 1C2NA 2O3JA 2N9YB 1P84D 1QYZA 1S5LV 1CIHA 3DR0A 3L70D 1B7VA 2ORLA 2C1VA 1F1FA 2EXVA 5DF5A 4EIEA 3X39A 3H1JD 3OCDA 3H1LD 1W2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TF5 A;  1H32 A;  1A2S A;  1H9X A;  1HJ4 A;  1M60 A;  1CNO A;  3NBS A;  3O0R C;  5DJQ B;  3ZBM A;  1HH7 A;  3PH2 B;  2FRC A;  1MZ4 A;  3SXT A;  1FCD C;  1DW3 A;  1DW2 A;  1CYC A;  2Q3E A;  5KAF V;  1COR A;  4J20 A;  1J3S A;  3A9F A;  1ETP A;  5TIS V;  3L75 D;  1DW0 A;  1PPJ D;  1CSX A;  3SLE A;  4Q5P A;  2K9J B;  3ZCF A;  5KLV D;  3WFE C;  2QG4 A;  3OA8 B;  5CIF B;  1I54 A;  2OZ1 A;  4GED B;  1DIQ C;  1GIW A;  3A0B V;  2ZON G;  4WQC A;  2C1U A;  3VMA A;  3WFD C;  1R0Q A;  1I8O A;  3PXS A;  1FHB A;  4PW9 B;  2N9I A;  3O20 A;  3WFB C;  2RMZ A;  2AIU A;  1AYG A;  2RN0 A;  4QAO A;  1M70 A;  4FA9 A;  4GYD A;  2PCC B;  1CRI A;  4D6T D;  1K3G A;  2GC4 D;  1GJQ A;  2KS1 A;  5CIE B;  2CA3 B;  3PLN A;  4KMG A;  1I8P A;  1RAP A;  1IO3 A;  1M6Z A;  1DT1 A;  2MTA C;  4O1Q A;  1H31 B;  1QL3 A;  2MHM A;  2JTI B;  1NIR A;  1YTC A;  3O1Y A;  1FOC A;  2B11 B;  4JCG A;  3HQ9 A;  1YNR A;  2A06 D;  1NTM D;  3KZI V;  1BGY D;  5TJH A;  2C9X B;  1CRY A;  4WQB A;  1OCD A;  1HZV A;  1COT A;  1E2R A;  3PHL A;  2AI5 A;  1H31 A;  1HRO A;  2OZ1 B;  1HJ5 A;  2YIU B;  1C6S A;  1NMI A;  4V2K A;  3L71 D;  2XTS B;  2N3B A;  1YIQ A;  5C0Z A;  4O1W A;  2B0Z B;  4AAL A;  1H9Y A;  2VHD A;  2YQB A;  3H1H D;  1FJ0 A;  1SQX D;  1CSV A;  1ZZH A;  4MU8 A;  4Y5R A;  4AX3 A;  2JQR A;  1FI9 A;  4RJT A;  1I5T A;  1NTZ D;  3TYI A;  2C1D B;  3JBT B;  4L3G A;  1RZ6 A;  3ZIY A;  3WFC C;  3DMI A;  3RN1 A;  3PXW A;  1MG3 D;  2C1D A;  2ZOO A;  1QKS A;  2IBZ D;  4K3I A;  3ITK A;  2FYN B;  1F1C A;  4FAV A;  1CHH A;  1CRC A;  4WQ7 A;  1BCC D;  4FAN A;  351C A;  4L1Q A;  3CYT I;  2LIR A;  1C2R A;  3CWB D;  1CO6 A;  2B10 B;  3O5C A;  1QN2 A;  3HQ6 A;  3CX5 W;  1H33 A;  1GDV A;  1A8C A;  3PTZ A;  1NTK D;  1H1O A;  1I55 A;  3OCD B;  4FA4 A;  2L91 A;  2YCC A;  3SJL A;  2CXB A;  2QJK B;  3RMZ A;  2V08 A;  3VYM A;  3TDK A;  1LC1 A;  1KYO D;  1CYI A;  1NU1 D;  3MK7 C;  3C2C A;  4PD4 D;  2LIT A;  2BH5 X;  3CXH W;  1CRJ A;  1S6V B;  3WU2 V;  1YCC A;  2GB8 B;  4YE1 A;  1E8E A;  2JWA A;  5DFS A;  5CIC B;  1A56 A;  3RN0 A;  1E29 A;  1FI7 A;  4L3H A;  4H0J A;  2D0W A;  3H1I D;  4U3F D;  1CED A;  1KB9 D;  3L4M A;  5EXQ A;  1N50 A;  1HRC A;  5CIB B;  1SQP D;  1CC5 A;  4EIF A;  3H1K D;  2BLF B;  1EB7 A;  4A7P A;  3CP5 A;  4PWA A;  5CIH B;  1YFC A;  5KLI B;  4DY9 A;  3ORV A;  2Y0E A;  2BCN B;  1HZU A;  1GQ1 A;  1IQC A;  1QL4 A;  1CHJ A;  4WQA A;  1CIF A;  2PAC A;  1HCM A;  1OAE A;  1KIB A;  1IZL 0;  1I6E A;  3ZOW A;  2N9J A;  1L9J C;  3SWS A;  451C A;  5KAI V;  4XXL A;  5B66 V;  1H32 B;  1BE3 D;  4WQ9 A;  1C52 A;  1LS9 A;  4P4Q B;  1C6R A;  2BGV X;  1NML A;  1L0L D;  2BCC D;  3KHU A;  1CHI A;  1CIG A;  2GIW A;  2V07 A;  5C9M A;  1YIC A;  5KKZ B;  1DII C;  3VRD A;  3DP5 A;  3TGU D;  2N18 C;  1H33 B;  1MG2 D;  4AAM A;  5B6Q A;  2ZBO A;  5GTH V;  1CIE A;  1SQV D;  3A0H V;  1GU2 A;  1RZ5 A;  3GW6 A;  1L9B C;  1W5C T;  1IRV A;  4UB6 V;  4WQ8 A;  3ZOO A;  3OA8 A;  3L74 D;  3L4O A;  1WVE C;  4N0K A;  2I8F A;  2B12 B;  3PXT A;  5AUR A;  1I6D A;  1YEB A;  1AOF A;  2HV4 A;  3CXH D;  3L73 D;  1BL9 A;  3HQ7 A;  1YEA A;  1C6O A;  1DVH A;  1DW1 A;  1VYD A;  4FB1 A;  2CE1 A;  5CID B;  2Y0C A;  1CSU A;  3ZOY A;  155C A;  2QJP B;  2Y0D A;  1SQB D;  1KV9 A;  4LJI A;  2CA4 B;  2N18 B;  5CIG B;  1IRW A;  1CTJ A;  3CU4 A;  5CYT R;  1GKS A;  5IY5 1;  1L0N D;  2QJY B;  1KYO W;  4AAN A;  1CXA A;  3L72 D;  4WQD A;  2ZZS 1;  2BH4 X;  2PCB B;  3M97 X;  3MK7 B;  5GTI V;  2DGE A;  1N9C A;  1SQQ D;  1LFM A;  2BPB B;  2L4D A;  1ZRT D;  2ZXY A;  1KX7 A;  4UB8 V;  3ZOX A;  1CCH A;  3PRJ A;  2YK3 A;  1WEJ F;  1CTY A;  3VNW A;  5H2F V;  3HQ8 A;  1U75 B;  3RLM A;  1N15 A;  1C75 A;  3GG2 A;  2C8S A;  4PJ0 V;  1CCR A;  1N90 A;  2N3Y A;  4AAO A;  2AXT V;  2CE0 A;  1CTZ A;  1CSW A;  1CXC A;  2KNC B;  1DVV A;  1LC2 A;  2B4Z A;  4EID A;  1HJ3 A;  3BCC D;  1KB0 A;  4RSZ A;  2C2C A;  1C7M A;  1CRH A;  4WQE A;  1NNO A;  1AKK A;  1K3H A;  2DVH A;  4FA5 A;  1RAQ A;  1LMS A;  2GC7 D;  1AOQ A;  5E79 V;  4H0K A;  4XYD B;  3WUI A;  1CYJ A;  5B5E V;  3NWV A;  4IL6 V;  4EDF A;  3CX5 D;  1U74 B;  4NFG B;  3FWL A;  1CRG A;  4FA1 A;  1JDL A;  2FYU D;  2FWL A;  1FI3 A;  3NBT A;  1KX2 A;  2D0S A;  4EIC A;  1EZV D;  3SVW A;  3WC8 A;  1PP9 D;  5DJQ C;  1C2N A;  2O3J A;  2N9Y B;  1P84 D;  1QYZ A;  1S5L V;  1CIH A;  3DR0 A;  3L70 D;  1B7V A;  2ORL A;  2C1V A;  1F1F A;  2EXV A;  5DF5 A;  4EIE A;  3X39 A;  3H1J D;  3OCD A;  3H1L D;  1W2L A; 
#chains in the Genus database with same CATH topology
 1PGJ A;  3PH0 A;  1VQ6 P;  1H32 A;  1HJ4 A;  1S5L H;  1M60 A;  3HE5 A;  3AE9 C;  3B5N B;  3SXT A;  1FCD C;  3L73 J;  5B66 H;  4HH2 A;  1LNQ A;  3NFQ A;  1J3S A;  5TIS V;  1J1D B;  2Z4E A;  2ZT9 C;  1PPJ D;  5CCH D;  1CSX A;  2IPP A;  1QX8 A;  3SLE A;  2K9J B;  3ZCF A;  1VF5 C;  1JOC A;  4H13 B;  2WSF H;  5KJ7 A;  3M06 A;  4ZNC A;  1YYC A;  1GIW A;  3A0B V;  5AVV B;  1IFJ A;  4GOD A;  2C1U A;  3VMA A;  4Y99 C;  1SQB K;  3PXS A;  5KTB A;  1RY3 A;  1S3J A;  3U1A A;  2RMZ A;  1RF1 C;  2H43 A;  2FXP A;  3L71 G;  3CCE P;  1OMI A;  1M70 A;  4GYD A;  2PCC B;  4D6T D;  1K3G A;  2GC4 D;  1GJQ A;  1RH5 B;  2KS1 A;  2CA3 B;  4WB4 A;  5AW7 B;  2J5U A;  1M6Z A;  2MTA C;  3CME P;  1EDL A;  1IFI A;  1PPJ G;  1KFN A;  1GL2 A;  1YTC A;  1QEX A;  2B11 B;  4JCG A;  3I55 P;  2A06 D;  3KZI H;  1PP9 E;  1N2D C;  1NAY A;  3B5N C;  1COT A;  3PHL A;  2ITA A;  2YMY A;  1PL5 A;  2W6A A;  3GF7 A;  2A45 I;  1NMI A;  4V2K A;  4AUW A;  1JCD A;  4IFM A;  3L71 D;  2N3B A;  2AEJ A;  1YIQ A;  2BAS A;  1NTK J;  1H9Y A;  3T97 A;  2QE7 H;  1LTB C;  4H0L B;  4ASV A;  2M0B A;  3Q5R A;  3L72 E;  1CI6 A;  4L75 A;  4N3Y B;  4CPG A;  4WY4 C;  3IF4 A;  2AXT H;  2XKM A;  4PJ0 E;  3L74 G;  1KD1 Q;  1I5T A;  3FXE A;  2ZT9 D;  4WY4 B;  1BDD A;  5B5E E;  3WFC C;  3V2Q A;  3RN1 A;  2SPZ A;  2RH0 A;  1QKS A;  3ITK A;  4IFD K;  4JPZ B;  1SFC A;  2NPS A;  1SQP K;  2N1T C;  2O01 H;  4FAN A;  1LT9 B;  2FYU E;  4D6T G;  1BDC A;  4UB6 H;  3CYT I;  5GTH E;  2MKV A;  4JF7 A;  4YTP C;  1U7M A;  2LIR A;  5AVZ B;  2OYI B;  1CO6 A;  4TLF A;  1PGO A;  1PP9 G;  2OAR A;  3L75 E;  1L0L K;  1PGQ A;  1RF1 A;  3AE3 C;  5KLV G;  1GZL A;  2L91 A;  3G3Z A;  5KAF H;  5KAI H;  3SJL A;  3GF3 A;  4U3F J;  2YKO A;  3RMZ A;  1LC1 A;  3MK7 C;  1W2B O;  1NJI Q;  1JCC A;  3CXH W;  1S6V B;  1SFC B;  2QJY C;  1YCC A;  2GB8 B;  4ASW A;  5DFS A;  5CIC B;  1A56 A;  3C9I A;  1FI7 A;  2YNY A;  4H0J A;  5CMZ A;  2WTY A;  2R5B A;  3V2R A;  1LTS C;  3CL3 D;  1KB9 D;  3L4M A;  2UWJ E;  2Q9I A;  2E42 A;  2IX7 C;  1VDF A;  3D0W A;  4PD4 H;  1OIP A;  1EB7 A;  1KFM A;  1YFC A;  2HFE D;  3AE1 C;  1XTG B;  2XNX A;  1HZU A;  3S1K A;  3L37 A;  1QL4 A;  3TGU J;  3RK3 D;  1KIB A;  1IZL 0;  1KB9 H;  2K1A A;  2KYV A;  451C A;  1T2K C;  5KAI E;  5B66 V;  4UB6 E;  1KIL C;  3H1K J;  2BEZ F;  4P4Q B;  1SQB G;  4I7Z B;  1L0L D;  1KZU B;  4PV1 B;  1NTM G;  1CIG A;  2V07 A;  3CXH H;  1YIC A;  1KB9 I;  3VOP A;  2CPB A;  4R4L A;  3VRD A;  1CW5 A;  4BXL A;  1H33 B;  5CJ4 A;  1QVG O;  1A02 J;  2G3A A;  2K88 A;  1OVU A;  2ZBO A;  2J58 A;  1SQV D;  1BE3 G;  1LTA C;  3SFE C;  1GU2 A;  1JY2 P;  4HYT B;  2GUS A;  3OA8 A;  1SVF A;  2WVR A;  3H1I E;  1BSN A;  1L0N J;  5APY A;  3WU2 H;  3PXT A;  3NTN A;  1YQ3 C;  1SFC D;  3SWY A;  1YEB A;  2QA4 P;  4HB1 A;  1VQO P;  2AEF A;  5GTI H;  5GTI E;  1DVH A;  1LT9 A;  155C A;  1JNM A;  1KV9 A;  3HE5 B;  5CIG B;  1OFC X;  1ZRT E;  1IRW A;  1U7J A;  3L72 D;  1QL2 A;  5APW A;  2ZZS 1;  2BH4 X;  1VQP P;  5AVS B;  1SQQ D;  1L0N E;  1HWT C;  1W2E A;  1OWA A;  1HH0 A;  1ZRT D;  4UB8 V;  1LT1 A;  5AW5 B;  3H1I J;  1CCH A;  2IZ1 A;  1FZF A;  2IBZ E;  3AE6 C;  3R2P A;  3GG2 A;  1RE3 A;  2K3R A;  2QJP C;  3CWB E;  1HJ0 A;  4HKZ H;  1CTZ A;  1CSW A;  1CXC A;  2KNC B;  2FBW C;  1WMK A;  2D2C B;  1EZV I;  3GHG A;  4I1L A;  5KLV K;  1WT6 A;  1RQU A;  4H0L D;  1NNO A;  4Y28 J;  2I1J A;  1AKK A;  4FA5 A;  2XZR A;  1SQQ J;  5APU A;  1LMS A;  3LW5 H;  5CJ0 A;  3CPW O;  4EDF A;  2WSE H;  1E5W A;  1GW3 A;  2QSI A;  5CCH A;  3VMZ A;  1CRG A;  1LTJ B;  4FA1 A;  5BU8 B;  1Q7Y Q;  2E75 C;  3WMM 0;  2V7Q H;  3KZI E;  2GM4 A;  3SVW A;  3WC8 A;  4PV1 D;  2NPS D;  2O3J A;  2Q5U A;  1SQV J;  1L4A C;  3M0D C;  3DR0 A;  5AVU B;  2ORL A;  1NU1 E;  5KKZ C;  3TF5 A;  2IBZ G;  3ZBM A;  1H9X A;  2OYI C;  5DJQ B;  3PH2 B;  1VQ9 P;  4QMA A;  1AFO A;  1CYC A;  3B8E B;  1FE6 A;  2R3S A;  4EI2 A;  2WSE J;  3A9F A;  1ETP A;  3L75 D;  1DW0 A;  1Q81 Q;  3H1J E;  4Q5P A;  2QRX A;  3JCU E;  3VTP C;  2QG4 A;  4WWI A;  4XE5 B;  1X79 B;  4GED B;  5APT A;  2JKV A;  4WQC A;  5KLI C;  3L71 E;  2ZYA A;  2NPS C;  3HE4 B;  1I8O A;  5E79 H;  1NTM J;  5APV A;  4PW9 B;  1VQ5 P;  2NRG A;  3WFB C;  3M91 A;  3AE8 C;  3Q5S A;  4H0L C;  2AEM A;  2CPS A;  3D71 A;  1BGY E;  3QH9 A;  3NMD A;  2QIW A;  1IO3 A;  2KNC A;  1DT1 A;  2JP3 A;  3RBX A;  1QL3 A;  1GW4 A;  3H25 A;  4PV1 C;  2O1J A;  4W7Y A;  3H1I G;  1NIR A;  4I7Z C;  3O1Y A;  3E1R A;  1FOC A;  3HQ9 A;  1YNR A;  4AQR D;  3KZI V;  2IFM A;  5TJH A;  4GDO A;  4K35 A;  2C9X B;  2KLU A;  2E75 D;  3EFG A;  2N1T D;  1HJ5 A;  1C6S A;  1GTW A;  3KQG A;  3OW2 O;  2HG5 D;  4IL6 H;  2XTS B;  3M0A A;  4GOF A;  5CBO A;  5EFW B;  2IBZ I;  5DJU B;  2BCC G;  2Z5I A;  2C9L Y;  1JUN A;  1FJ0 A;  1JEK A;  1VQM P;  1YTZ T;  1ZZH A;  5AW4 B;  3ABV C;  3TNU B;  2JQR A;  3F5H A;  3L70 E;  2W6J H;  1NTZ D;  3TYI A;  1SFC C;  1SQP E;  1L0L G;  1RZ6 A;  4H13 C;  3ZIY A;  1SS1 A;  5KJ7 C;  2K37 A;  3PXW A;  2WZ7 A;  1MG3 D;  1YJ9 P;  4K3I A;  4FAV A;  1XTC C;  1CHH A;  4WQ7 A;  1SLQ A;  1Y9B A;  4GT1 A;  3HUS C;  351C A;  4RES B;  4L1Q A;  1S72 P;  1YHQ P;  2HYN A;  2ZFC A;  4WBA A;  3CWB D;  1R5L A;  3V2N A;  1BCC E;  2B10 B;  1L0N G;  2A06 E;  3P8C D;  5KLV E;  1CSB A;  1FS0 E;  1ZP0 C;  5AW2 B;  5CCG C;  2LKM A;  2LR2 A;  2VRS A;  2FFD C;  1VQK P;  2YIU C;  1DD3 A;  2JEE A;  1NTZ G;  4NPE A;  1T3J A;  4DOJ A;  4H44 C;  2QVA A;  2QJK B;  1KYO D;  1CYI A;  2LIT A;  2WIT A;  5AVY B;  1CRJ A;  2ZXX A;  2JR8 A;  2B89 A;  4U3F E;  3BVH A;  2ZAE B;  1OZH A;  2HOD A;  1EDJ A;  3B5N D;  4WY4 A;  3MUD A;  3RN0 A;  1E29 A;  5E79 E;  3HUS A;  2OTK E;  1VF5 D;  2YO3 A;  1HRC A;  1IC2 A;  1NGM B;  1PPJ E;  1CC5 A;  4EIF A;  4L74 A;  2ZYG A;  4LLH A;  1J1E C;  3H1K D;  2E76 D;  4W80 A;  4JBZ A;  3W67 A;  3CP5 A;  5CIH B;  1ZV8 A;  1X8Y A;  1JM0 A;  2FXO A;  1YI2 P;  1H0T B;  3V4W A;  1L2P A;  1CHJ A;  1VQN P;  1HJB A;  1YJN P;  1SQB E;  1NWQ A;  1OAE A;  2WSC H;  2E74 B;  2N9J A;  1L9J C;  5KAI V;  4XXL A;  1JO5 A;  1AVO A;  3AE2 C;  3U1C A;  4WQ9 A;  1ZN5 A;  1M7L A;  2OYO A;  1C6R A;  3JSV C;  1NML A;  5C9M A;  1DII C;  3MUD C;  3CMA P;  1FZC C;  3A0B E;  3HTK A;  3A0B H;  2N18 C;  5AVT B;  2FY8 A;  1MG2 D;  3HD7 C;  1GK4 A;  1KYO H;  3KYQ A;  4UB8 H;  1S5L X;  1MKM A;  5GTH V;  2FFD A;  1S2E A;  1A02 F;  1L9B C;  1IRV A;  4WQ8 A;  3BCC G;  3ZOO A;  1PV3 A;  2CK3 H;  2HPC B;  3L74 D;  4Y99 B;  2PP6 A;  3RK2 B;  1M1J B;  2H88 C;  1E79 H;  2KZI A;  1GU5 A;  2KLV A;  5AUR A;  3TGU E;  3D6Z A;  1IJD B;  2HV4 A;  4ZKP A;  1N73 A;  3HQ7 A;  4U3F G;  5AW0 B;  1VYD A;  2CE1 A;  5KLV J;  2Y0C A;  1USE A;  4LJI A;  1QL1 A;  3CU4 A;  1GKS A;  5IY5 1;  1L0N D;  1T8Z A;  1G2C A;  4JYC A;  1N7L A;  4WQD A;  4GKG A;  1KB9 E;  1OW8 A;  4XFJ A;  2PCB B;  3M97 X;  1HVV A;  2FYN C;  3CX5 I;  3M9H A;  3PJS K;  3FX0 A;  3ZOX A;  3TYY A;  2KS1 B;  4OGQ B;  1CTY A;  3VNW A;  3RLM A;  1LTJ A;  2W6B A;  1C75 A;  1CCR A;  1N90 A;  3L74 J;  1M1K Q;  1LC2 A;  2B4Z A;  4EID A;  1HJ3 A;  3BCC D;  3R4Y A;  2KOG A;  4RSZ A;  3AEC C;  1RQV A;  3CCR P;  2AXC A;  2E76 B;  1FOS E;  3V4Q A;  4H44 D;  2DVH A;  1P84 I;  2R5D A;  3HTK B;  1U57 A;  4LC1 A;  1L0L J;  2GA1 A;  4XYD B;  3WUI A;  3WUT A;  5B5E V;  1G1I A;  2KXP B;  4PJ0 H;  3NWV A;  1EC5 A;  3BCC E;  3CX5 D;  5H2F H;  1DX7 A;  1LWU B;  1KMI Z;  4EIJ A;  1LWU A;  3FWL A;  3GLM A;  1BCC G;  2JWD A;  1JDL A;  2FYU D;  2FWL A;  1SQB J;  1FI3 A;  1VQ7 P;  1M1J A;  4EIC A;  1FZA A;  2B87 A;  1C2N A;  1RE4 A;  1KIL D;  2WPS A;  2Q1K A;  3TGU G;  3RL0 C;  1B7V A;  2C1V A;  3G9R A;  3RK3 B;  3P32 A;  4IL6 X;  2IZ0 A;  2EXV A;  2M5A B;  3RK3 C;  1NTK K;  3SSU A;  3OCD A;  4KJM A;  3H1L D;  4XA4 A;  1W2L A;  3RK3 E;  1HH7 A;  2M3E A;  1R8E A;  1MZ4 A;  1NTM E;  3CCM P;  1DW2 A;  2YKP A;  5AVR B;  1JMM A;  5KAF V;  2WPV B;  2PGD A;  1COR A;  2G8Y A;  2N9B A;  1ZOY C;  1ZME C;  3QWO C;  3H1H E;  1GDT A;  1VL2 A;  5KLV D;  3P8C E;  3H1J J;  3WFE C;  3OA8 B;  5CIF B;  2ZVN B;  1I54 A;  4KT0 J;  1D7M A;  1JY2 N;  1FZB A;  2FYU G;  4D6T E;  1CI6 B;  2L5G B;  3H1L G;  1R0Q A;  1KIL A;  3CLQ A;  2P67 A;  2N9I A;  1HGZ A;  2FYZ A;  2BEQ D;  1HUC A;  1JY3 N;  3O20 A;  1NU1 J;  3A0H H;  2C0X A;  2RN0 A;  1KTM A;  1KOR A;  4QAO A;  1ZXG A;  4FA9 A;  1ZR2 A;  4PD4 E;  1NKZ B;  3AEA C;  3PLN A;  1SQV E;  1PGP A;  1WRG A;  4O1Q A;  5H2F E;  1TU3 F;  4RO0 A;  2MHM A;  2JTI B;  3CX5 E;  1USD A;  3IFM A;  1M57 D;  1M90 Q;  1KIL E;  3MZW B;  1N8R Q;  1H0T A;  1CRY A;  1Z56 A;  3E7K A;  1OCD A;  4OGQ D;  1E2R A;  3MP7 B;  2AI5 A;  1H31 A;  2OZ1 B;  1K04 A;  2ZXE B;  2YIU B;  3RL0 g;  1FU1 A;  1NVO A;  2XDJ A;  1URQ C;  5C0Z A;  4O1W A;  2MJZ A;  2FXM A;  3A7O A;  2VHD A;  1NKN A;  2YQB A;  3H1H D;  2WPR A;  1EDK A;  3H1K G;  3S9O A;  3CWB J;  4MU8 A;  4AX3 A;  3CC2 P;  2AXT E;  2HR3 A;  1SQQ K;  2V4H A;  4RJT A;  1DH3 A;  1ZW0 A;  2C1D B;  3A3Y B;  1MV8 A;  3JBT B;  4L3G A;  1VPC A;  1NHL A;  1SQV G;  2ZOO A;  1FDO A;  1NU1 K;  5TIS E;  1IO4 A;  1F1C A;  1CRC A;  1BCC D;  3VMX A;  1L0L E;  1T6A A;  1Q2N A;  1LTT C;  1NU1 G;  1M56 D;  1PZQ A;  1KV4 A;  3LID A;  2C0W A;  1N7S B;  5AVW B;  1BGY J;  3O5C A;  3TK1 A;  2WT7 B;  4BRY A;  1FZC B;  3CCS P;  1FDM A;  3CX5 W;  5AW9 B;  1H33 A;  2GUV A;  1GDV A;  1A8C A;  2R32 A;  3CX5 H;  3PTZ A;  1S5L E;  1NTK D;  2KIK A;  4R4M A;  1H1O A;  1N7S C;  1I55 A;  1VQ4 P;  1EXJ A;  3L71 J;  2YCC A;  1X0T A;  1BSH A;  3VYM A;  1YQ4 C;  2V08 A;  3N4X A;  3VP9 A;  1NU1 D;  3C2C A;  3LW5 J;  2E43 A;  4GIF A;  1JTH B;  1Y47 A;  1Y8A A;  1OXZ A;  1E8E A;  2JWA A;  1BGY G;  1GL2 B;  3H1J G;  3BRV B;  2W8Z A;  1UII A;  3SWF A;  3CCU P;  2OYH B;  4L3H A;  4RKU J;  4U3F D;  3V5B A;  1CED A;  4U7J A;  3CCQ P;  1N50 A;  3A0H E;  5CIB B;  1SQP D;  2BCC J;  2M3B A;  3Q2Y A;  2C9N Y;  2BLF B;  4A7P A;  1VQ8 P;  2PRR A;  3AE7 C;  2NPS B;  5KLI B;  4DY9 A;  1M8O B;  3ORV A;  2Y0E A;  3O8Z A;  1URQ B;  3H1K E;  3NXS A;  1CIF A;  2PAC A;  1M1J C;  2J59 M;  1I6E A;  1JTH A;  2RKL A;  1KQS O;  1H32 B;  2YXQ B;  1C52 A;  2WSF J;  2E5T A;  1FDI A;  1FBM A;  2BGV X;  3ZDM A;  1JMB A;  2BCC D;  3KHU A;  2FFD B;  1AA0 A;  1CHI A;  2GIW A;  5CCG A;  1Q90 D;  5KKZ B;  1YBK A;  3VN0 A;  1LTI C;  2IDB A;  2HOD B;  4AAM A;  3H32 B;  1NO4 A;  4BRY B;  2XND H;  2O01 N;  1CIE A;  5KAF E;  3A0H V;  3KDP B;  5APQ A;  3G6E P;  2YXR B;  1FJK A;  2WSS H;  2WPQ A;  1BE3 J;  1NTZ K;  3IAO A;  4N0K A;  2I8F A;  3AEE C;  1YIT P;  1JY3 P;  4W7Z A;  3AED C;  1I6D A;  1LJ2 A;  3LIE A;  4IFF A;  3L73 D;  5L8R J;  1C6O A;  4C7N B;  1NOH A;  3L4F A;  4L76 A;  1N73 B;  5BU5 A;  4YXW H;  4FB1 A;  1T2K D;  1N86 A;  5CID B;  1NTZ E;  5CBN A;  2Y0D A;  3II6 A;  1SQX G;  1S9K E;  1DD4 A;  2CA4 B;  4N6J A;  1CTJ A;  5CYT R;  1Q86 Q;  3EFF K;  3RL0 B;  1CXA A;  1IZN B;  1SQQ G;  2KB7 P;  2YO2 A;  1R5S A;  2P10 A;  5GTI V;  1LP1 B;  3FGA D;  3L73 G;  3G4S P;  2D2C D;  2Q7C A;  1LFM A;  2BPB B;  2IFN A;  4KHX A;  3H1L J;  4GOE A;  1S9K D;  3PRJ A;  1WEJ F;  5H2F V;  3JCU H;  1P84 E;  1MZ9 A;  1P84 H;  1N15 A;  2R44 A;  2XU6 A;  1JY3 O;  5AW8 B;  4PJ0 V;  1OVR A;  3CC4 P;  3L72 J;  4AAO A;  3JC2 2;  1SQX J;  2W27 A;  2N1T A;  4UB8 E;  3CXH I;  3SWK A;  2Q3I A;  1KB0 A;  3B5N A;  2PAJ A;  2C2C A;  1C7M A;  1EZV G;  1CRH A;  1RE4 C;  3HUS B;  4WQE A;  3RGU A;  1MUU A;  3C8V A;  3TSI A;  3HD7 D;  1K3H A;  5AW6 B;  2OYH C;  1AOQ A;  5E79 V;  4H0K A;  3P7K A;  3RBZ A;  1GL2 C;  4IL6 V;  3AE5 C;  4AYC A;  4EYY Q;  1QGK B;  1JB0 J;  3GMA A;  1YTZ I;  3I56 P;  4NFG B;  1SQX K;  3HRN A;  1HBW A;  1SQP J;  3M9B A;  3NBT A;  1KX2 A;  2D0S A;  1MFT A;  3V2P A;  1AJY A;  1RF0 A;  1EZV D;  4NPF X;  5DJQ C;  2ZJS E;  2N9Y B;  1QYZ A;  1IFD A;  2PFX A;  1Q82 Q;  3TNU A;  4OWF A;  2Z5H A;  1F1F A;  5DF5 A;  4EIE A;  2BCC E;  3X39 A;  3H1J D;  1AQT A;  1L4A A;  3M0D A;  2QEX P;  1L4A B;  3D70 A;  1N73 C;  1A2S A;  3NBS A;  3O0R C;  1CNO A;  3FWN A;  3MD0 A;  1SQX E;  2WWW A;  2FRC A;  1DW3 A;  2Q3E A;  3Q1M A;  1KIL B;  4D6T J;  5KJ7 D;  1URQ A;  4J20 A;  1LTJ C;  4YPC A;  2QM8 A;  1OVV A;  5C39 A;  1T3U A;  3B4S A;  2OZ1 A;  1DIQ C;  5AW3 B;  2ZON G;  3V6I A;  1NTM K;  3H1H G;  3A5T A;  3WFD C;  2QM7 A;  4OVN F;  2A06 G;  2P7J A;  3EQ2 A;  1FHB A;  1S1C X;  1EXI A;  1IFN A;  3RK2 D;  2AIU A;  1AYG A;  1SQV K;  3KPE A;  1YJW P;  1NTZ J;  2P1J A;  3G71 P;  2Y9Y A;  2W90 A;  1CRI A;  5CIE B;  2H89 C;  1GMJ A;  2KI7 B;  1RE3 C;  4KMG A;  2P2U A;  1I8P A;  1RAP A;  1K73 Q;  3HD7 B;  2KP8 A;  1H31 B;  4HJG H;  2B87 B;  1DIP A;  4ZKU A;  1URQ D;  1VQL P;  2YKQ A;  1NTM D;  1ZR4 A;  1HTL C;  1BGY D;  3FXD A;  1EDI A;  4WQB A;  3BAS A;  4O9B A;  1HZV A;  4BWN A;  1PIX A;  4K3A A;  1HRO A;  1LP1 A;  3MIW A;  4LGD E;  1BE3 E;  3A2A A;  1OX3 A;  1KQF B;  2IYP A;  4NPD A;  2OQQ A;  4IL6 E;  3PP5 A;  2K9Y A;  1H8A A;  3M9Q A;  2B0Z B;  4AAL A;  4EOT A;  1DEE G;  4TT3 H;  3AEB C;  1KQG B;  1NTK E;  1L4A D;  1SQX D;  3E1I A;  3L74 E;  1CSV A;  3F89 A;  4C7N A;  2WMM A;  4Y5R A;  2M5A A;  3UIA A;  1MFZ A;  1FI9 A;  1H88 A;  1L0N K;  2O01 J;  2NZ2 A;  3CCJ P;  1PP9 J;  3L35 A;  5B5E H;  3DMI A;  2C1D A;  1KQL A;  1RF0 C;  2IBZ D;  2KK7 A;  3WUU A;  2FYN B;  5TIS H;  3AEF C;  1SP4 A;  2Q6Q A;  4MN4 C;  3L75 G;  1SQQ E;  4OH8 B;  1FOS F;  2D2C C;  3BRT B;  1C2R A;  5AVX B;  3CXH E;  3C1L A;  3O6Q B;  1KN7 A;  2DW3 A;  1OW6 A;  1UIX A;  1QN2 A;  3HQ6 A;  3T97 B;  2POH A;  3OAK A;  1IFM A;  1FZC A;  2K9J A;  3OCD B;  4FA4 A;  3RL0 D;  2I1K A;  3O6Q A;  3CWB G;  1FAV A;  1EQ7 A;  2CXB A;  3TDK A;  1GU4 A;  5APS A;  3H1L E;  4PD4 D;  2OYH A;  2ZVO B;  2BH5 X;  4DZO A;  1FZE A;  1NTK G;  3H1H J;  3WU2 V;  1LWU C;  4YE1 A;  2FKW B;  3VP8 A;  1IFP A;  1GK6 A;  2YMK A;  2JO1 A;  4N78 D;  4DCK A;  1LGH B;  2D0W A;  3L70 G;  3H1I D;  2OGU A;  2E76 C;  1CZQ A;  5EXQ A;  2OYI A;  4M3L A;  1RF1 B;  3OA7 A;  3SFD C;  5K5G B;  2HLO A;  1KYO I;  2H8P D;  4PWA A;  4C46 A;  1J2J B;  2FYU J;  2WT7 A;  2BCN B;  3WU2 E;  2O1K A;  1GQ1 A;  1IQC A;  2W83 C;  2A45 G;  2E5Y A;  4WQA A;  1PFI A;  1VF5 B;  3MTU E;  1HCM A;  1J1D C;  3ZOW A;  3SWS A;  2WSC J;  1OW7 A;  1BE3 D;  1LS9 A;  3B71 A;  3BAT A;  1SQP G;  2KUB A;  3CD6 P;  1HF9 A;  4WVZ A;  3I5C A;  1S4X A;  3DP5 A;  3TGU D;  2FYU K;  1H89 A;  4ZMD A;  4IOI H;  3CCL P;  5CCG D;  2JDI H;  3KXD A;  5B6Q A;  3GHG C;  5CHX A;  3OJA B;  3K5B A;  4DJG A;  3HE4 A;  2E75 B;  2N1T B;  1RZ5 A;  1HGV A;  3GW6 A;  4C7R A;  1W5C T;  4UB6 V;  5B66 E;  2IYO A;  3U59 A;  3L4O A;  1WVE C;  1NH4 A;  3MGN A;  1G2C B;  1IK9 A;  4WY4 D;  2WQY C;  2B12 B;  1AV1 A;  4N78 E;  1X22 A;  1AQ5 A;  1G1J A;  1FZG A;  4PD4 I;  5AW1 B;  2B88 A;  5AVQ B;  3RK2 C;  1AOF A;  3IN6 A;  3CXH D;  2ZYD A;  1BL9 A;  2LXB A;  5GTH H;  1YEA A;  1FJP A;  1DW1 A;  1K9M Q;  4DT0 A;  2OTJ P;  2KSJ A;  1CSU A;  1BCC J;  3ZOY A;  3IR9 A;  3L36 A;  2QJP B;  3P8M C;  1SQB D;  3HD7 A;  5BVZ A;  1DEB A;  2N18 B;  1N7S A;  3AEG C;  2QJY B;  3W68 A;  3H32 A;  1KYO E;  1KYO W;  4AAN A;  1FC2 C;  3MK7 B;  2M8R A;  5CCH C;  2DGE A;  1ZLL A;  3H6P A;  1N7S D;  1N9C A;  5DJT B;  3AE4 C;  2XV5 A;  5APX A;  4H13 D;  1RHZ B;  2L4D A;  1LTG C;  2ZXY A;  1KX7 A;  5M1B A;  2Y9Z A;  2E74 C;  3CC7 P;  3L70 J;  4I2L C;  3WUV A;  3MHV A;  2YK3 A;  2KSE A;  4L73 A;  3S4R A;  3HQ8 A;  3L73 E;  1U75 B;  1NAF A;  2P58 A;  2B9B A;  2C8S A;  1EZV E;  1KC8 Q;  2N3Y A;  1X9V A;  2AXT V;  2CE0 A;  2JJL A;  1DVV A;  3L75 J;  1J1E B;  1W5C E;  2A45 H;  3D6Y A;  2R3C A;  1LT9 C;  4Z1M H;  3USS A;  1RAQ A;  2GC7 D;  4JQ0 D;  1CYJ A;  1GL2 D;  1NYH A;  2V7Q J;  1AVY A;  3CCV P;  1U74 B;  4OGQ C;  3CI9 A;  2ZT9 B;  4YXD C;  2H7H A;  1QVF O;  3VMY A;  3N7N A;  1QLE D;  1GD2 E;  1YIJ P;  2QJK C;  3BCC J;  4B86 A;  4H44 B;  3Q3D A;  1K05 A;  1K8A Q;  1JY2 O;  2HPC A;  1PP9 D;  4JYB A;  2I8D A;  1P84 D;  3GHG B;  1S5L V;  1CIH A;  3L70 D;  2LXC B;  3L72 G;  3Q5P A;  1IK7 A;  2KZJ A;  2OTL P;  2E74 D;  3VYI A;  4I6M C;  3EWK A; 
#chains in the Genus database with same CATH homology
 3TF5 A;  1H32 A;  1A2S A;  1H9X A;  1HJ4 A;  1M60 A;  1CNO A;  3NBS A;  3O0R C;  5DJQ B;  3ZBM A;  1HH7 A;  3PH2 B;  2FRC A;  1MZ4 A;  3SXT A;  1FCD C;  1DW3 A;  1DW2 A;  1CYC A;  2Q3E A;  5KAF V;  1COR A;  4J20 A;  1J3S A;  3A9F A;  1ETP A;  5TIS V;  3L75 D;  1DW0 A;  1PPJ D;  1CSX A;  3SLE A;  4Q5P A;  2K9J B;  3ZCF A;  5KLV D;  3WFE C;  2QG4 A;  3OA8 B;  5CIF B;  1I54 A;  2OZ1 A;  4GED B;  1DIQ C;  1GIW A;  3A0B V;  2ZON G;  4WQC A;  2C1U A;  3VMA A;  3WFD C;  1R0Q A;  1I8O A;  3PXS A;  1FHB A;  4PW9 B;  2N9I A;  3O20 A;  3WFB C;  2RMZ A;  2AIU A;  1AYG A;  2RN0 A;  4QAO A;  1M70 A;  4FA9 A;  4GYD A;  2PCC B;  1CRI A;  4D6T D;  1K3G A;  2GC4 D;  1GJQ A;  2KS1 A;  5CIE B;  2CA3 B;  3PLN A;  4KMG A;  1I8P A;  1RAP A;  1IO3 A;  1M6Z A;  1DT1 A;  2MTA C;  4O1Q A;  1H31 B;  1QL3 A;  2MHM A;  2JTI B;  1NIR A;  1YTC A;  3O1Y A;  1FOC A;  2B11 B;  4JCG A;  3HQ9 A;  1YNR A;  2A06 D;  1NTM D;  3KZI V;  1BGY D;  5TJH A;  2C9X B;  1CRY A;  4WQB A;  1OCD A;  1HZV A;  1COT A;  1E2R A;  3PHL A;  2AI5 A;  1H31 A;  1HRO A;  2OZ1 B;  1HJ5 A;  2YIU B;  1C6S A;  1NMI A;  4V2K A;  3L71 D;  2XTS B;  2N3B A;  1YIQ A;  5C0Z A;  4O1W A;  2B0Z B;  4AAL A;  1H9Y A;  2VHD A;  2YQB A;  3H1H D;  1FJ0 A;  1SQX D;  1CSV A;  1ZZH A;  4MU8 A;  4Y5R A;  4AX3 A;  2JQR A;  1FI9 A;  4RJT A;  1I5T A;  1NTZ D;  3TYI A;  2C1D B;  3JBT B;  4L3G A;  1RZ6 A;  3ZIY A;  3WFC C;  3DMI A;  3RN1 A;  3PXW A;  1MG3 D;  2C1D A;  2ZOO A;  1QKS A;  2IBZ D;  4K3I A;  3ITK A;  2FYN B;  1F1C A;  4FAV A;  1CHH A;  1CRC A;  4WQ7 A;  1BCC D;  4FAN A;  351C A;  4L1Q A;  3CYT I;  2LIR A;  1C2R A;  3CWB D;  1CO6 A;  2B10 B;  3O5C A;  1QN2 A;  3HQ6 A;  3CX5 W;  1H33 A;  1GDV A;  1A8C A;  3PTZ A;  1NTK D;  1H1O A;  1I55 A;  3OCD B;  4FA4 A;  2L91 A;  2YCC A;  3SJL A;  2CXB A;  2QJK B;  3RMZ A;  2V08 A;  3VYM A;  3TDK A;  1LC1 A;  1KYO D;  1CYI A;  1NU1 D;  3MK7 C;  3C2C A;  4PD4 D;  2LIT A;  2BH5 X;  3CXH W;  1CRJ A;  1S6V B;  3WU2 V;  1YCC A;  2GB8 B;  4YE1 A;  1E8E A;  2JWA A;  5DFS A;  5CIC B;  1A56 A;  3RN0 A;  1E29 A;  1FI7 A;  4L3H A;  4H0J A;  2D0W A;  3H1I D;  4U3F D;  1CED A;  1KB9 D;  3L4M A;  5EXQ A;  1N50 A;  1HRC A;  5CIB B;  1SQP D;  1CC5 A;  4EIF A;  3H1K D;  2BLF B;  1EB7 A;  4A7P A;  3CP5 A;  4PWA A;  5CIH B;  1YFC A;  5KLI B;  4DY9 A;  3ORV A;  2Y0E A;  2BCN B;  1HZU A;  1GQ1 A;  1IQC A;  1QL4 A;  1CHJ A;  4WQA A;  1CIF A;  2PAC A;  1HCM A;  1OAE A;  1KIB A;  1IZL 0;  1I6E A;  3ZOW A;  2N9J A;  1L9J C;  3SWS A;  451C A;  5KAI V;  4XXL A;  5B66 V;  1H32 B;  1BE3 D;  4WQ9 A;  1C52 A;  1LS9 A;  4P4Q B;  1C6R A;  2BGV X;  1NML A;  1L0L D;  2BCC D;  3KHU A;  1CHI A;  1CIG A;  2GIW A;  2V07 A;  5C9M A;  1YIC A;  5KKZ B;  1DII C;  3VRD A;  3DP5 A;  3TGU D;  2N18 C;  1H33 B;  1MG2 D;  4AAM A;  5B6Q A;  2ZBO A;  5GTH V;  1CIE A;  1SQV D;  3A0H V;  1GU2 A;  1RZ5 A;  3GW6 A;  1L9B C;  1W5C T;  1IRV A;  4UB6 V;  4WQ8 A;  3ZOO A;  3OA8 A;  3L74 D;  3L4O A;  1WVE C;  4N0K A;  2I8F A;  2B12 B;  3PXT A;  5AUR A;  1I6D A;  1YEB A;  1AOF A;  2HV4 A;  3CXH D;  3L73 D;  1BL9 A;  3HQ7 A;  1YEA A;  1C6O A;  1DVH A;  1DW1 A;  1VYD A;  4FB1 A;  2CE1 A;  5CID B;  2Y0C A;  1CSU A;  3ZOY A;  155C A;  2QJP B;  2Y0D A;  1SQB D;  1KV9 A;  4LJI A;  2CA4 B;  2N18 B;  5CIG B;  1IRW A;  1CTJ A;  3CU4 A;  5CYT R;  1GKS A;  5IY5 1;  1L0N D;  2QJY B;  1KYO W;  4AAN A;  1CXA A;  3L72 D;  4WQD A;  2ZZS 1;  2BH4 X;  2PCB B;  3M97 X;  3MK7 B;  5GTI V;  2DGE A;  1N9C A;  1SQQ D;  1LFM A;  2BPB B;  2L4D A;  1ZRT D;  2ZXY A;  1KX7 A;  4UB8 V;  3ZOX A;  1CCH A;  3PRJ A;  2YK3 A;  1WEJ F;  1CTY A;  3VNW A;  5H2F V;  3HQ8 A;  1U75 B;  3RLM A;  1N15 A;  1C75 A;  3GG2 A;  2C8S A;  4PJ0 V;  1CCR A;  1N90 A;  2N3Y A;  4AAO A;  2AXT V;  2CE0 A;  1CTZ A;  1CSW A;  1CXC A;  2KNC B;  1DVV A;  1LC2 A;  2B4Z A;  4EID A;  1HJ3 A;  3BCC D;  1KB0 A;  4RSZ A;  2C2C A;  1C7M A;  1CRH A;  4WQE A;  1NNO A;  1AKK A;  1K3H A;  2DVH A;  4FA5 A;  1RAQ A;  1LMS A;  2GC7 D;  1AOQ A;  5E79 V;  4H0K A;  4XYD B;  3WUI A;  1CYJ A;  5B5E V;  3NWV A;  4IL6 V;  4EDF A;  3CX5 D;  1U74 B;  4NFG B;  3FWL A;  1CRG A;  4FA1 A;  1JDL A;  2FYU D;  2FWL A;  1FI3 A;  3NBT A;  1KX2 A;  2D0S A;  4EIC A;  1EZV D;  3SVW A;  3WC8 A;  1PP9 D;  5DJQ C;  1C2N A;  2O3J A;  2N9Y B;  1P84 D;  1QYZ A;  1S5L V;  1CIH A;  3DR0 A;  3L70 D;  1B7V A;  2ORL A;  2C1V A;  1F1F A;  2EXV A;  5DF5 A;  4EIE A;  3X39 A;  3H1J D;  3OCD A;  3H1L D;  1W2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...