1BE3D

Cytochrome bc1 complex from bovine
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 61
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1be3D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1be3D01
3ORVA 2ZBOA 1R0QA 1SQXD 1OAEA 1ETPA 2C2CA 3ZIYA 2RN0A 1S5LV 3CX5W 2N3BA 1H9XA 1C2RA 4EICA 2BLFB 3VYMA 1AKKA 5DJQB 2FYUD 1AYGA 4D6TD 2Q3EA 5GTIV 1RAQA 5CIBB 1NMLA 5TISV 4WQ9A 2Y0DA 3O20A 1QL4A 1SQQD 3PH2B 3TGUD 3L73D 1L0LD 1CHIA 3WFCC 1H32A 1KYOW 2CE1A 1MG2D 5E79V 3CU4A 5GTHV 4EIFA 1L9BC 3PTZA 1RAPA 5DF5A 1C7MA 1CC5A 1DIIC 5H2FV 3CWBD 2N9JA 1LMSA 3ZOYA 4AALA 1I8OA 3NWVA 1KX2A 2BGVX 1CTJA 1F1FA 4Y5RA 1QYZA 1IO3A 1NU1D 1QKSA 1C6SA 4AAMA 1CCHA 3CP5A 1J3SA 1CRCA 4FA1A 2RMZA 1P84D 3WFBC 3A9FA 4FA5A 2YCCA 2MHMA 3OA8A 4EDFA 1GU2A 3L4MA 1HH7A 1CORA 2PCBB 1SQVD 2LIRA 3RMZA 2CE0A 1DW3A 1CRGA 2ZZS1 1YTCA 5KLVD 2N3YA 3ZBMA 1FI7A 3ZOWA 1CCRA 2GB8B 1FCDC 1M70A 1IZL0 3RN1A 1H32B 4PW9B 2PCCB 1CIFA 3KHUA 1ZRTD 3WC8A 4H0KA 4FA4A 1LC2A 2BH4X 1COTA 1FI9A 1HZUA 3FWLA 2CA3B 4A7PA 1FHBA 1YIQA 1I54A 3JBTB 5CIHB 4FA9A 1DW0A 2VHDA 1B7VA 1CTZA 3C2CA 1NIRA 1M6ZA 3VMAA 4WQAA 4EIEA 5DFSA 2BCCD 1H31A 1K3GA 1KV9A 2HV4A 1W5CT 2K9JB 3RLMA 3L75D 1KB9D 3DMIA 3WFDC 1CRYA 4U3FD 1CSUA 3PRJA 1MZ4A 1AOFA 1RZ5A 4WQ8A 3DP5A 3GG2A 1CHJA 4WQBA 4L3GA 5KLIB 1M60A 5TJHA 1I6DA 5CYTR 3M97X 1H1OA 3H1KD 3L74D 4MU8A 3OA8B 5CIDB 1I5TA 4IL6V 5DJQC 2BH5X 2V07A 1C6RA 3PXWA 1H33A 1E29A 2D0SA 2FRCA 4LJIA 1DW1A 2JTIB 2C1VA 2O3JA 2FWLA 2BPBB 1W2LA 1IRVA 3WFEC 1EZVD 3TYIA 1DVHA 1NNOA 1IQCA 2AXTV 1A2SA 4PWAA 2XTSB 1VYDA 2PACA 1RZ6A 1CO6A 1YEAA 3L71D 2JWAA 3WU2V 3RN0A 2B10B 1NMIA 1SQBD 2ZXYA 5B5EV 2N9YB 4L3HA 1WVEC 1CRIA 4P4QB 2DGEA 2LITA 1CIHA 4UB6V 5CIFB 4KMGA 1FOCA 3DR0A 1GIWA 3H1ID 1C52A 4WQ7A 1H31B 3OCDA 1I6EA 1HJ3A 3HQ7A 1BGYD 1YFCA 4FB1A 3CYTI 3HQ6A 2YK3A 2C1DA 1NTZD 2N18C 3SLEA 4FAVA 1I8PA 2GC4D 5B66V 3WUIA 1AOQA 3PLNA 1CIGA 3A0BV 3MK7C 1CYCA 1U74B 2B12B 1N15A 1H33B 2ORLA 4NFGB 1S6VB 4UB8V 1K3HA 1CRJA 2OZ1A 1CTYA 3ZOOA 4L1QA 2B4ZA 1GKSA 3H1JD 4O1WA 1I55A 1LS9A 1HJ4A 3H1LD 1GDVA 3ITKA 4AAOA 155CA 1HJ5A 4QAOA 1A56A 1HROA 4PJ0V 3PHLA 2YQBA 3SXTA 2L91A 4Q5PA 1DIQC 5C9MA 1LC1A 4AANA 5CIEB 2D0WA 1QL3A 2QJKB 5C0ZA 1CIEA 1YCCA 4K3IA 1BCCD 2GC7D 4FANA 2BCNB 5AURA 1N9CA 2C8SA 3OCDB 3VRDA 5IY51 1CYIA 2GIWA 1C75A 4H0JA 2AIUA 3PXTA 2AI5A 1IRWA 2C1DB 1EB7A 1HRCA 2IBZD 2MTAC 3KZIV 4GYDA 3TF5A 5CIGB 3CXHD 5KAIV 1H9YA 3L70D 1KB0A 3SJLA 1BL9A 3L72D 4RJTA 1CRHA 3GW6A 1QN2A 1NTKD 2JQRA 2OZ1B 1NTMD 2A06D 1C6OA 1YEBA 2FYNB 2ZONG 4V2KA 4PD4D 3ZOXA 3HQ8A 2YIUB 5B6QA 4XXLA 3SWSA 1BE3D 4RSZA 3A0HV 1WEJF 2N9IA 1U75B 2C1UA 1CSWA 2L4DA 2KNCB 2DVHA 1YNRA 1A8CA 3HQ9A 4EIDA 2Y0CA 1SQPD 3NBSA 1CYJA 2QG4A 1CXCA 1OCDA 2CA4B 3BCCD 1LFMA 3VNWA 1CSXA 1PP9D 3PXSA 2QJYB 1CHHA 2B11B 4AX3A 3CX5D 5EXQA 1KIBA 4N0KA 2N18B 1YICA 2I8FA 3X39A 3O5CA 1L9JC 1FI3A 5CICB 4WQEA 2Y0EA 2CXBA 3CXHW 1HZVA 2ZOOA 1KX7A 1N90A 4J20A 3TDKA 2V08A 3MK7B 451CA 4WQCA 4GEDB 1CSVA 2KS1A 1ZZHA 1N50A 1MG3D 2EXVA 4O1QA 3ZCFA 1GQ1A 1KYOD 3L4OA 4JCGA 1E2RA 5KKZB 1FJ0A 1GJQA 2B0ZB 3SVWA 1CNOA 4XYDB 4WQDA 4YE1A 351CA 2QJPB 1HCMA 3O1YA 1C2NA 5KAFV 4DY9A 1E8EA 3NBTA 1JDLA 3H1HD 1F1CA 1DT1A 1CXAA 1L0ND 3O0RC 1CEDA 1DVVA 1DW2A 2C9XB 1PPJD
chains in the Genus database with same CATH superfamily
3ORVA 4B86A 1SQXD 2J5UA 1OWAA 4PJ0H 1FZCA 2W6JH 1U7MA 3FGAD 2QJKC 4GKGA 3HD7C 1S3JA 1S5LV 2ZXXA 1SS1A 2OQQA 1URQB 1KB9I 4EICA 2W6AA 1QL2A 1N7SB 1AA0A 3RL0B 2E74B 1RAQA 1Q86Q 1DIPA 2OYIC 2IDBA 4Y99B 2NPSA 1SQQD 3PH2B 3CX5E 3D0WA 3L73D 1BSNA 1MUUA 1X0TA 1MG2D 1FAVA 4I7ZC 4L75A 1L0LK 4Z1MH 4WB4A 2KSEA 1JCCA 1SQVE 3AECC 4JYCA 1C7MA 1J1DB 1MZ9A 3ZOYA 4AALA 2KB7P 2QM8A 4ZMDA 4HH2A 1KILA 1GK4A 2WSFJ 1QKSA 1Z56A 1C6SA 2K9JA 3EWKA 3G3ZA 3H1HE 1W5CE 1LTJC 4FA1A 1M1JB 3WFBC 3G4SP 1T3UA 3A9FA 3G71P 1CW5A 1DX7A 4C46A 2WSCJ 1CORA 1RE3A 4C7NA 3GF3A 5APTA 3WUVA 1G2CA 1GU4A 1DW3A 1YTCA 3HE4A 2FYUJ 2BCCG 3ZOWA 1CCRA 2KZJA 2YKOA 4D6TJ 2Y9YA 1IZL0 2KLVA 3BRVB 1SFCB 2ZT9D 3H32A 1ZRTD 3MTUE 4U3FG 1COTA 3V5BA 1HWTC 1LT9B 3A5TA 1MV8A 2JJLA 2A45H 1JY3N 3LW5J 1B7VA 4PJ0E 2HPCA 3M9QA 1DD4A 3AE2C 2BCCD 2FFDA 1H31A 2V4HA 1VL2A 5APUA 2O01J 3L35A 3HD7B 2C0WA 2V7QJ 1KFMA 4H44D 1IFNA 4DCKA 3G9RA 1EZVG 4U3FD 3L71E 1S9KE 5APYA 1NU1J 3GG2A 5KLIB 1IC2A 3UIAA 2IZ0A 1M60A 4AUWA 1IFMA 2OYIB 3LIDA 4WY4D 1RF0A 4WBAA 2KUBA 1FOSF 2C9NY 2IBZI 1Q90D 4LJIA 1DW1A 5KAIE 4I7ZB 2YKPA 2K3RA 3H1IG 4RO0A 3V4QA 1EZVD 2CPSA 1RE4A 1ZW0A 4IL6H 1NNOA 1NKNA 1IJDB 1FOSE 1A2SA 1VYDA 3P8CE 1RZ6A 3RK3D 1NTKK 1E79H 2BEZF 2OYHC 3MZWB 3RN0A 1WRGA 1KQLA 2DW3A 2N9YB 4L3HA 1T8ZA 1CRIA 2YXRB 3ABVC 3DR0A 4AYCA 3CCUP 5DJTB 1KILE 1KYOH 3MUDA 1LTJB 3H1ID 3OCDA 2KSJA 3H1JG 1I6EA 3E7KA 2WSFH 3OA7A 2R3SA 3HQ7A 2WSSH 3CC2P 2WT7B 3R2PA 4FB1A 1S1CX 2C1DA 2N18C 4K35A 1YITP 4IL6X 1AOQA 1QX8A 3VMZA 1DH3A 1CYCA 2WSCH 1S6VB 2QRXA 1S2EA 3JC22 2YNYA 3ZOOA 3H1KJ 4L1QA 3N4XA 1GKSA 4GDOA 3AE8C 1BDCA 3H1JD 3Q5SA 1NYHA 2LKMA 1LS9A 1D7MA 4HB1A 4AAOA 1HJ5A 1A56A 4PJ0V 3CCEP 3L70E 2ZT9C 3BATA 2NRGA 4AANA 3CCMP 2KI7B 1CIEA 3RBXA 2LXCB 5CMZA 3L72G 3CC4P 1VQLP 1NTKG 5AURA 3S9OA 4N3YB 3EQ2A 2N1TA 1NKZB 5IY51 2GIWA 1RQUA 3BRTB 2V7QH 4C7NB 3TSIA 2W83C 3QWOC 1EB7A 4H44C 1G2CB 1GTWA 1YJNP 3CXHD 1LT1A 5KAIV 3V2RA 5M1BA 3O8ZA 1BGYJ 1KD1Q 3TYYA 1KB0A 3G6EP 1NTZE 1BL9A 3A3YB 3L72D 1J2JB 1OVVA 1NTKD 1UIXA 5APWA 2OARA 2OZ1B 1C6OA 4GIFA 1MKMA 1TU3F 3SWSA 2ZYAA 2QM7A 1Q82Q 1U75B 2C1UA 2OYHB 2L4DA 1EZVI 2KNCB 3NXSA 1A8CA 3HQ9A 1R5SA 2Q3IA 4EIDA 2WTYA 3U1AA 2AXTH 4K3AA 3H1LJ 1KYOE 2Q7CA 3WU2H 1FJPA 3VNWA 1GL2D 1GMJA 3C9IA 1URQA 4TLFA 1Y9BA 2PFXA 1N7SA 3VTPC 2B11B 4AX3A 3CX5D 1R5LA 5C39A 1P84I 1RQVA 3W68A 2N18B 4U7JA 2I8FA 3CCRP 1BCCE 1FI3A 3LIEA 5CCHA 2Y0EA 3CI9A 3CXHW 2W90A 3H1HG 2GUSA 2YMKA 2ZOOA 1GD2E 3TDKA 1LP1B 1NH4A 4GOFA 1YTZI 2Y9ZA 5B66H 2KOGA 2FYUE 1L4AA 2RH0A 3A0BH 3ZCFA 2P7JA 5AW4B 4XYDB 1T6AA 2D2CB 3AE6C 3GLMA 4WQDA 2GA1A 4BRYB 1AVYA 2NZ2A 1FU1A 1JDLA 3H1HD 3WUUA 1DT1A 1KMIZ 1DW2A 2C9XB 1U57A 1FDOA 2K1AA 1PFIA 1VQKP 1SP4A 1ETPA 3ZIYA 2RN0A 1M1JA 3CX5W 1ZMEC 2AXCA 1JY2N 1C2RA 1K05A 1PGQA 2IPPA 2WWWA 1AYGA 1IK7A 2W6BA 2AEMA 3BCCE 1NU1E 2XKMA 5CIBB 2M5AB 1J1EB 1NMLA 2Y0DA 1PP9J 4L73A 1AQTA 2HODB 5AW7B 2P2UA 2Z5IA 3E1IA 2L5GB 1SFCA 1CHIA 1G1JA 4EIFA 5GTIH 3PTZA 1OVRA 1LT9A 2H43A 1DIIC 1YBKA 5KJ7C 2AXTE 1I8OA 3F89A 4O9BA 3WUTA 1EC5A 2IFNA 2BGVX 5E79H 1N7LA 1F1FA 3WU2E 5AVYB 1S9KD 1YJWP 3A0HH 4ASWA 3HD7A 1CCHA 2M0BA 1J3SA 1PGPA 1SQBK 4OGQC 1GU5A 2CK3H 1LTBC 1HUCA 1L0NE 1QVFO 3E1RA 1OX3A 1E5WA 1PPJE 4BXLA 2IYOA 2R3CA 2OYIA 4EDFA 2RKLA 1SQXJ 3D6YA 1JB0J 3SFEC 1HH7A 2VRSA 3FX0A 1KC8Q 5B66E 1CRGA 2ZZS1 2Q5UA 3VP8A 1KB9H 2N3YA 1NTZK 3A0BE 1FCDC 3P8CD 4JPZB 1AFOA 2IX7C 1SQQJ 1LC2A 2W8ZA 3L73J 1QLED 2OYOA 5KKZC 1YI2P 3L74G 1YIQA 1EXIA 3JBTB 1KILD 4KT0J 1VQ9P 1CI6B 2B87B 1NIRA 1M6ZA 2QE7H 3VMAA 4WQAA 4EIEA 4WWIA 1JNMA 3CWBE 1LTJA 1RF1C 1KV9A 1GW4A 3VMXA 1W5CT 3RLMA 2WT7A 2AEJA 1GK6A 1M90Q 4WQ8A 1FDMA 1CHJA 1A02F 4L3GA 1I6DA 1H1OA 1LTSC 3L74D 2ZYDA 1Q7YQ 5DJQC 1SQBG 2HLOA 3PXWA 1E29A 2WPVB 2D0SA 3FXEA 3AEBC 1Q2NA 1VF5D 2IZ1A 1L4AB 5TISH 4JYBA 4PV1D 2BPBB 1YQ4C 5CBNA 1W2LA 3B5NB 3WFEC 1FZFA 1DVHA 2FYNC 4LGDE 5KLVE 2B89A 4PD4I 2AXTV 1NTZG 5E79E 3AE7C 5GTHH 3WU2V 1K9MQ 2B10B 3A0HE 1IFIA 1SQBD 2PAJA 1WVEC 1LTTC 2WQYC 2DGEA 1OXZA 2LITA 4RKUJ 1CIHA 5CIFB 1ZP0C 4H13D 3RK2C 5K5GB 1M57D 1JMBA 2E76D 1IFJA 3HTKA 2YO3A 4GT1A 3CMAP 4OGQB 1GIWA 1C52A 2N9BA 1SQPK 1YFCA 1IFDA 1NTZD 2BCCJ 1I8PA 3CC7P 5B66V 3WUIA 1X8YA 3L75E 1KB9E 3PLNA 1CIGA 3A0BV 4U3FJ 3MK7C 4C7RA 2B12B 1N15A 2OTJP 1KQGB 1M8OB 1BCCG 2OZ1A 1HVVA 3AE5C 1MFTA 1RY3A 1OIPA 1UIIA 1N73C 2B4ZA 1EQ7A 1L0LJ 5DJUB 1I55A 1HGZA 3V2NA 3O6QB 1GDVA 3ITKA 2OYHA 1YIJP 2KNCA 1KTMA 4QAOA 1KFNA 2QJPC 3T97B 2YQBA 2L91A 5AVVB 4YXWH 1LC1A 2D0WA 1OMIA 3M9BA 2QJKB 3IF4A 1RF1B 4K3IA 1BCCD 2GC7D 4FANA 2BCNB 1KILC 2P67A 3GF7A 1L0NK 5AVUB 4MN4C 3M0AA 1BE3G 2BEQD 4ZNCA 4H0JA 2OTLP 3BASA 2AIUA 2K88A 1LP1A 3H1IJ 1PP9E 5TISE 1SQPG 1EDIA 4OH8B 3SJLA 3BCCG 1Y47A 3GW6A 3D70A 1QGKB 2JQRA 1HTLC 3HRNA 4OWFA 2KZIA 2POHA 3AEDC 1YEBA 2G3AA 2FYNB 4V2KA 2YMYA 4DJGA 3HQ8A 3KZIH 1XTCC 4BRYA 5B6QA 3U1CA 5GTHE 1BE3D 3A0HV 2WZ7A 1VF5C 4PV1C 3V2PA 3H1JJ 2JDIH 3F5HA 3RK2B 1SQPD 1PV3A 4AQRD 1AV1A 2QG4A 3BCCD 2ZFCA 1CSXA 3HUSC 3NTNA 1WT6A 4N6JA 1KV4A 2E75D 1KIBA 4N0KA 4H13C 2FFDC 1LWUC 2M5AA 2E76C 2ITAA 4WQEA 2HODA 1SQXE 1PGJA 5AW6B 3I55P 1VPCA 2V08A 3MK7B 451CA 1L0NG 1NOHA 1PPJG 2R5DA 4W7YA 1N50A 3MD0A 1FZGA 4L76A 1SQVK 1N73B 5AVSB 1RF0C 2E5TA 2IBZE 1HBWA 3B71A 1GJQA 1L2PA 4TT3H 5KLVK 1SQQE 2QJPB 1VQOP 3O1YA 3L72J 3L73E 3OAKA 2QA4P 1LTIC 1NTKJ 4I6MC 1NTME 2Q6QA 1L0ND 1CEDA 4CPGA 3LW5H 3TGUG 3BVHA 1PPJD 3HTKB 1OAEA 2E42A 2C2CA 3U59A 1X79B 1JUNA 3PP5A 3AEFC 3CCLP 2FBWC 3RL0D 1KZUB 1H9XA 2O01H 1NJIQ 3AEGC 1AKKA 3M0DC 1KORA 3CWBG 5CCHD 1S72P 5TISV 1RHZB 1QL4A 5CJ4A 3V2QA 4IL6E 3TGUD 3MIWA 4XFJA 4WY4C 1P84H 4WVZA 2LR2A 3KPEA 3CU4A 5GTHV 4NPFX 1RAPA 1CC5A 3VMYA 3RBZA 3CWBD 3D6ZA 5APSA 2P10A 1CI6A 1SQVG 2B87A 2GUVA 5KTBA 4YXDC 1IZNB 3AE3C 4KJMA 1KX2A 4Y5RA 3RK3C 1IO3A 5KLVG 1OVUA 3IFMA 1EDJA 2FXOA 1CRCA 3H1HJ 3Q5PA 5CHXA 4H13B 3PJSK 4FA5A 1IFPA 1LWUB 2YCCA 2E76B 3VOPA 1GU2A 2WSEJ 2QJYC 1AVOA 2XNDH 3CL3D 1SQVD 1FS0E 2LIRA 3RMZA 2BCCE 1FZBA 3MGNA 2E75C 5KLVD 1SFCD 4H0LD 3ZBMA 4D6TE 1FI7A 3B5NA 1JOCA 2SPZA 3KQGA 1XTGB 5CCGD 3L75G 3Q3DA 4IFMA 1H32B 2PCCB 3WC8A 3H6PA 1USDA 4FA4A 1X9VA 5KJ7A 2BH4X 4GOEA 5AVWB 1FI9A 1L0LE 2ZT9B 3II6A 4IFFA 2J58A 2WPRA 1FHBA 5CIHB 4FA9A 4DZOA 3CPWO 1YJ9P 4R4MA 2J59M 1WMKA 3HD7D 3SWKA 1EZVE 3GMAA 5KAFH 4XE5B 2HV4A 4NPDA 1G1IA 3L75D 3IAOA 1KB9D 3DMIA 1CSUA 1NAFA 1JO5A 4LC1A 3DP5A 1HJ0A 4H44B 5TJHA 5CYTR 3M97X 3L71G 1W2EA 3Q2YA 3OA8B 2B9BA 1I5TA 4IL6V 2R44A 2V07A 5CJ0A 1DEBA 3RL0C 4ASVA 1P84E 3GHGC 3H1IE 3CCVP 1NO4A 4WY4B 3CXHI 4Y99C 5CCHC 2HYNA 2OGUA 2FWLA 5BU8B 3VYIA 3O6QA 2K9YA 3K5BA 3SWFA 3CD6P 1LTGC 1AQ5A 3VN0A 1IQCA 3T97A 1OW6A 1PL5A 2KYVA 2PACA 1CO6A 3L71D 2JEEA 3CMEP 3N7NA 1NMIA 1NTMK 1GDTA 3RK3B 1RF1A 3B8EB 3H1JE 5H2FH 4KMGA 3H25A 1U7JA 1FOCA 1KQSO 2HR3A 5CBOA 4WQ7A 1VQMP 1ZV8A 2XDJA 1HJ3A 4HYTB 4HKZH 1GL2C 5APVA 3CYTI 3HQ6A 2YK3A 2FYZA 2NPSD 2P1JA 3KXDA 3CX5I 3SLEA 2R32A 2GC4D 4DT0A 1JY2O 2E75B 1VQNP 1U74B 1ZXGA 2WSEH 3AEAC 1H33B 2MJZA 1K3HA 1CRJA 3H1KE 1CTYA 2Z5HA 3L74J 3V6IA 4O1WA 2JP3A 1JM0A 2M3BA 1HJ4A 4H0LC 1SFCC 4W80A 2WVRA 2ZAEB 2I8DA 3QH9A 3OJAB 3VP9A 5AW8B 4JQ0D 1K04A 3M91A 3PHLA 2A45G 2PP6A 5CCGC 2IBZG 1IO4A 1GZLA 1LT9C 3L72E 1X22A 5CIEB 5KAFE 4XA4A 2PRRA 1QL3A 3L70G 2JWDA 3EFFK 3RGUA 5C0ZA 1Q81Q 1YCCA 4PD4H 2OTKE 3HE5B 1KQFB 1EDKA 3L4FA 4EIJA 1N9CA 1NTMG 1SQBJ 1JTHB 1ZR4A 2ZVNB 2C8SA 1T2KD 5AW9B 3VRDA 2W27A 3P32A 4I2LC 5AW5B 2MTAC 2IBZD 5KLIC 5CIGB 5GTIE 3GHGB 1LTAC 5EFWB 2FYUK 1BGYE 1H9YA 1N73A 3L70D 4QMAA 2QEXP 1NTZJ 4RJTA 4ZKUA 1QN2A 5AW2B 5AVQB 1NTMD 2E43A 4XXLA 5AVTB 5KAIH 1CSWA 4N78E 3TNUB 5H2FE 1YNRA 3W67A 1JEKA 2Y0CA 3H1LE 3JSVC 5APXA 3A2AA 1EXJA 3MHVA 1CXCA 5AVRB 1LFMA 5B5EH 2HFED 4EYYQ 1FZCC 3PXSA 4UB6H 1NU1K 1GL2B 1H0TB 1OZHA 1YICA 3X39A 3O5CA 5CICB 1BCCJ 3L37A 2CXBA 1FE6A 2KXPB 1N90A 3WMM0 4GEDB 1LGHB 1CSVA 3CLQA 2NPSC 1H88A 1MG3D 3M9HA 1FJKA 2D2CD 2XU6A 3IN6A 1GQ1A 1KYOD 1FZAA 5KKZB 3AEEC 1FJ0A 3D71A 4H0LB 3Q5RA 1CNOA 2FYUG 4UB8H 1OW8A 4YE1A 351CA 3S1KA 4D6TG 1HCMA 5KAFV 1E8EA 2A06E 1JY3P 1F1CA 5AVXB 4PD4E 3P8MC 3AE4C 1L0LG 1BE3J 3HUSA 2ZBOA 3USSA 1R0QA 2H88C 3IR9A 5APQA 3JCUH 2Q1KA 1FZEA 2N3BA 1LWUA 1VQPP 4LLHA 2BLFB 3VYMA 4YTPC 5DJQB 2FYUD 1SQPJ 4D6TD 2Q3EA 5GTIV 2PGDA 3BCCJ 2FXPA 1CSBA 3PH0A 4WQ9A 3O20A 1RE3C 2O1JA 1NU1G 1T2KC 4JBZA 2ZYGA 1L0LD 2JR8A 3A7OA 3WFCC 2A45I 1H32A 3P7KA 1KYOW 2FY8A 2KS1B 2CE1A 1SVFA 3FWNA 5E79V 2IYPA 3EFGA 1L9BC 2XV5A 3SSUA 5DF5A 3I5CA 1QVGO 5H2FV 2N9JA 1LMSA 3NWVA 1H8AA 4IOIH 1NGMB 1CTJA 4YPCA 1QYZA 1NU1D 5B5EE 1JY3O 2FXMA 4AAMA 2N1TD 3CP5A 4UB6E 1W2BO 3M0DA 1FZCB 2RMZA 1P84D 2H7HA 1L0NJ 4OVNF 2ZXEB 2MHMA 3OA8A 2CPBA 1FBMA 3L4MA 1NHLA 2PCBB 1PGOA 3CCSP 2CE0A 2C0XA 4JF7A 4WY4A 1T3JA 1GW3A 2NPSB 3V4WA 4I1LA 2LXBA 2GB8B 1M70A 1VQ6P 3FXDA 1N8RQ 3RN1A 4PW9B 4UB8E 1CIFA 1YYCA 1QL1A 3KHUA 3L74E 4H0KA 1FDIA 2O01N 3TGUJ 1RE4C 2ZVOB 1HZUA 3FWLA 2O1KA 1KN7A 2CA3B 1KYOI 2R5BA 3H1KG 4A7PA 1I54A 1PIXA 2D2CC 1DW0A 2VHDA 1CTZA 3C2CA 1ZOYC 1URQD 3JCUE 5DFSA 1KILB 2HG5D 1N7SD 3CWBJ 1K3GA 1HH0A 2E74D 2K9JB 1MFZA 1NVOA 3WFDC 1CRYA 1LNQA 4L74A 3PRJA 1HJBA 1MZ4A 3MUDC 1SQBE 1AOFA 4IFDK 1RZ5A 1ZN5A 2H89C 2YO2A 1HF9A 4WQBA 1N86A 2P58A 3H1KD 4MU8A 4W7ZA 1S5LH 5CIDB 2BH5X 2M3EA 1C6RA 4GODA 1M7LA 1H33A 2XZRA 5AVZB 1L4AD 2FRCA 1J1EC 3KZIE 3B5ND 2JTIB 2C1VA 1N2DC 1YQ3C 2O3JA 3HE4B 1A02J 1SQVJ 2QIWA 1IRVA 5KJ7D 2G8YA 3TYIA 1VF5B 2JO1A 5BU5A 2YIUC 1VQ4P 3H32B 1BGYG 4PV1B 5AW3B 2IFMA 4PWAA 5KLVJ 2XTSB 1NAYA 1DD3A 1YEAA 2JWAA 1CZQA 4M3LA 2ZXYA 5B5EV 1ZRTE 4P4QB 3CCQP 2C9LY 4OGQD 3HE5A 4UB6V 3HUSB 1S5LX 1VQ5P 2HPCB 1Y8AA 3RL0g 2ZJSE 1ZR2A 1JTHA 2FFDB 1H31B 3CCJP 3H1LG 2WPQA 1BGYD 3B4SA 3C8VA 2N1TC 4FAVA 1QEXA 3GHGA 4EOTA 2I1JA 3L75J 4U3FE 2AEFA 1LJ2A 2QVAA 3NFQA 2ORLA 4NFGB 4UB8V 4NPEA 2XNXA 4N78D 5L8RJ 1YTZT 3H1LD 3KDPB 155CA 3TNUA 1HROA 2I1KA 1BSHA 3CXHH 2KK7A 3SXTA 4Q5PA 1DIQC 1IK9A 5C9MA 1AJYA 2Q9IA 1FC2C 3R4YA 3RK3E 1H89A 4EI2A 1BE3E 3L71J 4BWNA 3AE1C 2JKVA 3KYQA 1K8AQ 1GL2A 2A06G 3TK1A 1H0TA 1JY2P 1URQC 1VQ8P 3OCDB 2K37A 1S5LE 1CYIA 1SQXK 1C75A 2WITA 2B88A 2YXQB 3PXTA 1N7SC 2GM4A 5AW1B 2AI5A 2E74C 1IRWA 1SQPE 2C1DB 1HRCA 3KZIV 4GYDA 3TF5A 1EDLA 5AW0B 2KLUA 2M8RA 2WMMA 3M06A 1CRHA 3CX5H 1PP9G 1SQQK 2A06D 2ZONG 4PD4D 3ZOXA 2YIUB 1L4AC 2FKWB 1M56D 1K73Q 4RSZA 1J1DC 3B5NC 5CCGA 1WEJF 3NMDA 2N9IA 2QSIA 1NWQA 2DVHA 3RK2D 2BASA 1HGVA 4KHXA 1USEA 3L36A 3NBSA 5BVZA 1CYJA 1OCDA 2CA4B 2KIKA 4ZKPA 1PP9D 4RESB 2QJYB 4R4LA 1M1JC 1CHHA 1RH5B 1OW7A 1ZLLA 3SWYA 5EXQA 1JCDA 2KP8A 3OW2O 2N1TB 2YKQA 3I56P 1L9JC 1S4XA 2Z4EA 4Y28J 1R8EA 1HZVA 1M1KQ 1KX7A 4J20A 3MP7B 2MKVA 2H8PD 4WQCA 1PZQA 3S4RA 3SFDC 2KS1A 1ZZHA 2E5YA 1SQXG 1SLQA 4HJGH 1JMMA 2EXVA 4O1QA 1OFCX 3AE9C 3C1LA 3L4OA 4JCGA 1E2RA 2UWJE 3CXHE 1BDDA 2B0ZB 3SVWA 4DOJA 3L70J 1DEEG 3Q1MA 2WPSA 1YHQP 3ZDMA 3TGUE 1C2NA 4DY9A 1NTKE 1VDFA 1VQ7P 3NBTA 1NTMJ 1SQQG 1CXAA 3O0RC 1DVVA 3L73G
chains in the Genus database with same CATH topology
3ORVA 2ZBOA 1R0QA 1SQXD 1OAEA 1ETPA 2C2CA 3ZIYA 2RN0A 1S5LV 3CX5W 2N3BA 1H9XA 1C2RA 4EICA 2BLFB 3VYMA 1AKKA 5DJQB 2FYUD 1AYGA 4D6TD 2Q3EA 5GTIV 1RAQA 5CIBB 1NMLA 5TISV 4WQ9A 2Y0DA 3O20A 1QL4A 1SQQD 3PH2B 3TGUD 3L73D 1L0LD 1CHIA 3WFCC 1H32A 1KYOW 2CE1A 1MG2D 5E79V 3CU4A 5GTHV 4EIFA 1L9BC 3PTZA 1RAPA 5DF5A 1C7MA 1CC5A 1DIIC 5H2FV 3CWBD 2N9JA 1LMSA 3ZOYA 4AALA 1I8OA 3NWVA 1KX2A 2BGVX 1CTJA 1F1FA 4Y5RA 1QYZA 1IO3A 1NU1D 1QKSA 1C6SA 4AAMA 1CCHA 3CP5A 1J3SA 1CRCA 4FA1A 2RMZA 1P84D 3WFBC 3A9FA 4FA5A 2YCCA 2MHMA 3OA8A 4EDFA 1GU2A 3L4MA 1HH7A 1CORA 2PCBB 1SQVD 2LIRA 3RMZA 2CE0A 1DW3A 1CRGA 2ZZS1 1YTCA 5KLVD 2N3YA 3ZBMA 1FI7A 3ZOWA 1CCRA 2GB8B 1FCDC 1M70A 1IZL0 3RN1A 1H32B 4PW9B 2PCCB 1CIFA 3KHUA 1ZRTD 3WC8A 4H0KA 4FA4A 1LC2A 2BH4X 1COTA 1FI9A 1HZUA 3FWLA 2CA3B 4A7PA 1FHBA 1YIQA 1I54A 3JBTB 5CIHB 4FA9A 1DW0A 2VHDA 1B7VA 1CTZA 3C2CA 1NIRA 1M6ZA 3VMAA 4WQAA 4EIEA 5DFSA 2BCCD 1H31A 1K3GA 1KV9A 2HV4A 1W5CT 2K9JB 3RLMA 3L75D 1KB9D 3DMIA 3WFDC 1CRYA 4U3FD 1CSUA 3PRJA 1MZ4A 1AOFA 1RZ5A 4WQ8A 3DP5A 3GG2A 1CHJA 4WQBA 4L3GA 5KLIB 1M60A 5TJHA 1I6DA 5CYTR 3M97X 1H1OA 3H1KD 3L74D 4MU8A 3OA8B 5CIDB 1I5TA 4IL6V 5DJQC 2BH5X 2V07A 1C6RA 3PXWA 1H33A 1E29A 2D0SA 2FRCA 4LJIA 1DW1A 2JTIB 2C1VA 2O3JA 2FWLA 2BPBB 1W2LA 1IRVA 3WFEC 1EZVD 3TYIA 1DVHA 1NNOA 1IQCA 2AXTV 1A2SA 4PWAA 2XTSB 1VYDA 2PACA 1RZ6A 1CO6A 1YEAA 3L71D 2JWAA 3WU2V 3RN0A 2B10B 1NMIA 1SQBD 2ZXYA 5B5EV 2N9YB 4L3HA 1WVEC 1CRIA 4P4QB 2DGEA 2LITA 1CIHA 4UB6V 5CIFB 4KMGA 1FOCA 3DR0A 1GIWA 3H1ID 1C52A 4WQ7A 1H31B 3OCDA 1I6EA 1HJ3A 3HQ7A 1BGYD 1YFCA 4FB1A 3CYTI 3HQ6A 2YK3A 2C1DA 1NTZD 2N18C 3SLEA 4FAVA 1I8PA 2GC4D 5B66V 3WUIA 1AOQA 3PLNA 1CIGA 3A0BV 3MK7C 1CYCA 1U74B 2B12B 1N15A 1H33B 2ORLA 4NFGB 1S6VB 4UB8V 1K3HA 1CRJA 2OZ1A 1CTYA 3ZOOA 4L1QA 2B4ZA 1GKSA 3H1JD 4O1WA 1I55A 1LS9A 1HJ4A 3H1LD 1GDVA 3ITKA 4AAOA 155CA 1HJ5A 4QAOA 1A56A 1HROA 4PJ0V 3PHLA 2YQBA 3SXTA 2L91A 4Q5PA 1DIQC 5C9MA 1LC1A 4AANA 5CIEB 2D0WA 1QL3A 2QJKB 5C0ZA 1CIEA 1YCCA 4K3IA 1BCCD 2GC7D 4FANA 2BCNB 5AURA 1N9CA 2C8SA 3OCDB 3VRDA 5IY51 1CYIA 2GIWA 1C75A 4H0JA 2AIUA 3PXTA 2AI5A 1IRWA 2C1DB 1EB7A 1HRCA 2IBZD 2MTAC 3KZIV 4GYDA 3TF5A 5CIGB 3CXHD 5KAIV 1H9YA 3L70D 1KB0A 3SJLA 1BL9A 3L72D 4RJTA 1CRHA 3GW6A 1QN2A 1NTKD 2JQRA 2OZ1B 1NTMD 2A06D 1C6OA 1YEBA 2FYNB 2ZONG 4V2KA 4PD4D 3ZOXA 3HQ8A 2YIUB 5B6QA 4XXLA 3SWSA 1BE3D 4RSZA 3A0HV 1WEJF 2N9IA 1U75B 2C1UA 1CSWA 2L4DA 2KNCB 2DVHA 1YNRA 1A8CA 3HQ9A 4EIDA 2Y0CA 1SQPD 3NBSA 1CYJA 2QG4A 1CXCA 1OCDA 2CA4B 3BCCD 1LFMA 3VNWA 1CSXA 1PP9D 3PXSA 2QJYB 1CHHA 2B11B 4AX3A 3CX5D 5EXQA 1KIBA 4N0KA 2N18B 1YICA 2I8FA 3X39A 3O5CA 1L9JC 1FI3A 5CICB 4WQEA 2Y0EA 2CXBA 3CXHW 1HZVA 2ZOOA 1KX7A 1N90A 4J20A 3TDKA 2V08A 3MK7B 451CA 4WQCA 4GEDB 1CSVA 2KS1A 1ZZHA 1N50A 1MG3D 2EXVA 4O1QA 3ZCFA 1GQ1A 1KYOD 3L4OA 4JCGA 1E2RA 5KKZB 1FJ0A 1GJQA 2B0ZB 3SVWA 1CNOA 4XYDB 4WQDA 4YE1A 351CA 2QJPB 1HCMA 3O1YA 1C2NA 5KAFV 4DY9A 1E8EA 3NBTA 1JDLA 3H1HD 1F1CA 1DT1A 1CXAA 1L0ND 3O0RC 1CEDA 1DVVA 1DW2A 2C9XB 1PPJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ORV A;  2ZBO A;  1R0Q A;  1SQX D;  1OAE A;  1ETP A;  2C2C A;  3ZIY A;  2RN0 A;  1S5L V;  3CX5 W;  2N3B A;  1H9X A;  1C2R A;  4EIC A;  2BLF B;  3VYM A;  1AKK A;  5DJQ B;  2FYU D;  1AYG A;  4D6T D;  2Q3E A;  5GTI V;  1RAQ A;  5CIB B;  1NML A;  5TIS V;  4WQ9 A;  2Y0D A;  3O20 A;  1QL4 A;  1SQQ D;  3PH2 B;  3TGU D;  3L73 D;  1L0L D;  1CHI A;  3WFC C;  1H32 A;  1KYO W;  2CE1 A;  1MG2 D;  5E79 V;  3CU4 A;  5GTH V;  4EIF A;  1L9B C;  3PTZ A;  1RAP A;  5DF5 A;  1C7M A;  1CC5 A;  1DII C;  5H2F V;  3CWB D;  2N9J A;  1LMS A;  3ZOY A;  4AAL A;  1I8O A;  3NWV A;  1KX2 A;  2BGV X;  1CTJ A;  1F1F A;  4Y5R A;  1QYZ A;  1IO3 A;  1NU1 D;  1QKS A;  1C6S A;  4AAM A;  1CCH A;  3CP5 A;  1J3S A;  1CRC A;  4FA1 A;  2RMZ A;  1P84 D;  3WFB C;  3A9F A;  4FA5 A;  2YCC A;  2MHM A;  3OA8 A;  4EDF A;  1GU2 A;  3L4M A;  1HH7 A;  1COR A;  2PCB B;  1SQV D;  2LIR A;  3RMZ A;  2CE0 A;  1DW3 A;  1CRG A;  2ZZS 1;  1YTC A;  5KLV D;  2N3Y A;  3ZBM A;  1FI7 A;  3ZOW A;  1CCR A;  2GB8 B;  1FCD C;  1M70 A;  1IZL 0;  3RN1 A;  1H32 B;  4PW9 B;  2PCC B;  1CIF A;  3KHU A;  1ZRT D;  3WC8 A;  4H0K A;  4FA4 A;  1LC2 A;  2BH4 X;  1COT A;  1FI9 A;  1HZU A;  3FWL A;  2CA3 B;  4A7P A;  1FHB A;  1YIQ A;  1I54 A;  3JBT B;  5CIH B;  4FA9 A;  1DW0 A;  2VHD A;  1B7V A;  1CTZ A;  3C2C A;  1NIR A;  1M6Z A;  3VMA A;  4WQA A;  4EIE A;  5DFS A;  2BCC D;  1H31 A;  1K3G A;  1KV9 A;  2HV4 A;  1W5C T;  2K9J B;  3RLM A;  3L75 D;  1KB9 D;  3DMI A;  3WFD C;  1CRY A;  4U3F D;  1CSU A;  3PRJ A;  1MZ4 A;  1AOF A;  1RZ5 A;  4WQ8 A;  3DP5 A;  3GG2 A;  1CHJ A;  4WQB A;  4L3G A;  5KLI B;  1M60 A;  5TJH A;  1I6D A;  5CYT R;  3M97 X;  1H1O A;  3H1K D;  3L74 D;  4MU8 A;  3OA8 B;  5CID B;  1I5T A;  4IL6 V;  5DJQ C;  2BH5 X;  2V07 A;  1C6R A;  3PXW A;  1H33 A;  1E29 A;  2D0S A;  2FRC A;  4LJI A;  1DW1 A;  2JTI B;  2C1V A;  2O3J A;  2FWL A;  2BPB B;  1W2L A;  1IRV A;  3WFE C;  1EZV D;  3TYI A;  1DVH A;  1NNO A;  1IQC A;  2AXT V;  1A2S A;  4PWA A;  2XTS B;  1VYD A;  2PAC A;  1RZ6 A;  1CO6 A;  1YEA A;  3L71 D;  2JWA A;  3WU2 V;  3RN0 A;  2B10 B;  1NMI A;  1SQB D;  2ZXY A;  5B5E V;  2N9Y B;  4L3H A;  1WVE C;  1CRI A;  4P4Q B;  2DGE A;  2LIT A;  1CIH A;  4UB6 V;  5CIF B;  4KMG A;  1FOC A;  3DR0 A;  1GIW A;  3H1I D;  1C52 A;  4WQ7 A;  1H31 B;  3OCD A;  1I6E A;  1HJ3 A;  3HQ7 A;  1BGY D;  1YFC A;  4FB1 A;  3CYT I;  3HQ6 A;  2YK3 A;  2C1D A;  1NTZ D;  2N18 C;  3SLE A;  4FAV A;  1I8P A;  2GC4 D;  5B66 V;  3WUI A;  1AOQ A;  3PLN A;  1CIG A;  3A0B V;  3MK7 C;  1CYC A;  1U74 B;  2B12 B;  1N15 A;  1H33 B;  2ORL A;  4NFG B;  1S6V B;  4UB8 V;  1K3H A;  1CRJ A;  2OZ1 A;  1CTY A;  3ZOO A;  4L1Q A;  2B4Z A;  1GKS A;  3H1J D;  4O1W A;  1I55 A;  1LS9 A;  1HJ4 A;  3H1L D;  1GDV A;  3ITK A;  4AAO A;  155C A;  1HJ5 A;  4QAO A;  1A56 A;  1HRO A;  4PJ0 V;  3PHL A;  2YQB A;  3SXT A;  2L91 A;  4Q5P A;  1DIQ C;  5C9M A;  1LC1 A;  4AAN A;  5CIE B;  2D0W A;  1QL3 A;  2QJK B;  5C0Z A;  1CIE A;  1YCC A;  4K3I A;  1BCC D;  2GC7 D;  4FAN A;  2BCN B;  5AUR A;  1N9C A;  2C8S A;  3OCD B;  3VRD A;  5IY5 1;  1CYI A;  2GIW A;  1C75 A;  4H0J A;  2AIU A;  3PXT A;  2AI5 A;  1IRW A;  2C1D B;  1EB7 A;  1HRC A;  2IBZ D;  2MTA C;  3KZI V;  4GYD A;  3TF5 A;  5CIG B;  3CXH D;  5KAI V;  1H9Y A;  3L70 D;  1KB0 A;  3SJL A;  1BL9 A;  3L72 D;  4RJT A;  1CRH A;  3GW6 A;  1QN2 A;  1NTK D;  2JQR A;  2OZ1 B;  1NTM D;  2A06 D;  1C6O A;  1YEB A;  2FYN B;  2ZON G;  4V2K A;  4PD4 D;  3ZOX A;  3HQ8 A;  2YIU B;  5B6Q A;  4XXL A;  3SWS A;  1BE3 D;  4RSZ A;  3A0H V;  1WEJ F;  2N9I A;  1U75 B;  2C1U A;  1CSW A;  2L4D A;  2KNC B;  2DVH A;  1YNR A;  1A8C A;  3HQ9 A;  4EID A;  2Y0C A;  1SQP D;  3NBS A;  1CYJ A;  2QG4 A;  1CXC A;  1OCD A;  2CA4 B;  3BCC D;  1LFM A;  3VNW A;  1CSX A;  1PP9 D;  3PXS A;  2QJY B;  1CHH A;  2B11 B;  4AX3 A;  3CX5 D;  5EXQ A;  1KIB A;  4N0K A;  2N18 B;  1YIC A;  2I8F A;  3X39 A;  3O5C A;  1L9J C;  1FI3 A;  5CIC B;  4WQE A;  2Y0E A;  2CXB A;  3CXH W;  1HZV A;  2ZOO A;  1KX7 A;  1N90 A;  4J20 A;  3TDK A;  2V08 A;  3MK7 B;  451C A;  4WQC A;  4GED B;  1CSV A;  2KS1 A;  1ZZH A;  1N50 A;  1MG3 D;  2EXV A;  4O1Q A;  3ZCF A;  1GQ1 A;  1KYO D;  3L4O A;  4JCG A;  1E2R A;  5KKZ B;  1FJ0 A;  1GJQ A;  2B0Z B;  3SVW A;  1CNO A;  4XYD B;  4WQD A;  4YE1 A;  351C A;  2QJP B;  1HCM A;  3O1Y A;  1C2N A;  5KAF V;  4DY9 A;  1E8E A;  3NBT A;  1JDL A;  3H1H D;  1F1C A;  1DT1 A;  1CXA A;  1L0N D;  3O0R C;  1CED A;  1DVV A;  1DW2 A;  2C9X B;  1PPJ D; 
#chains in the Genus database with same CATH topology
 3ORV A;  4B86 A;  1SQX D;  2J5U A;  1OWA A;  4PJ0 H;  1FZC A;  2W6J H;  1U7M A;  3FGA D;  2QJK C;  4GKG A;  3HD7 C;  1S3J A;  1S5L V;  2ZXX A;  1SS1 A;  2OQQ A;  1URQ B;  1KB9 I;  4EIC A;  2W6A A;  1QL2 A;  1N7S B;  1AA0 A;  3RL0 B;  2E74 B;  1RAQ A;  1Q86 Q;  1DIP A;  2OYI C;  2IDB A;  4Y99 B;  2NPS A;  1SQQ D;  3PH2 B;  3CX5 E;  3D0W A;  3L73 D;  1BSN A;  1MUU A;  1X0T A;  1MG2 D;  1FAV A;  4I7Z C;  4L75 A;  1L0L K;  4Z1M H;  4WB4 A;  2KSE A;  1JCC A;  1SQV E;  3AEC C;  4JYC A;  1C7M A;  1J1D B;  1MZ9 A;  3ZOY A;  4AAL A;  2KB7 P;  2QM8 A;  4ZMD A;  4HH2 A;  1KIL A;  1GK4 A;  2WSF J;  1QKS A;  1Z56 A;  1C6S A;  2K9J A;  3EWK A;  3G3Z A;  3H1H E;  1W5C E;  1LTJ C;  4FA1 A;  1M1J B;  3WFB C;  3G4S P;  1T3U A;  3A9F A;  3G71 P;  1CW5 A;  1DX7 A;  4C46 A;  2WSC J;  1COR A;  1RE3 A;  4C7N A;  3GF3 A;  5APT A;  3WUV A;  1G2C A;  1GU4 A;  1DW3 A;  1YTC A;  3HE4 A;  2FYU J;  2BCC G;  3ZOW A;  1CCR A;  2KZJ A;  2YKO A;  4D6T J;  2Y9Y A;  1IZL 0;  2KLV A;  3BRV B;  1SFC B;  2ZT9 D;  3H32 A;  1ZRT D;  3MTU E;  4U3F G;  1COT A;  3V5B A;  1HWT C;  1LT9 B;  3A5T A;  1MV8 A;  2JJL A;  2A45 H;  1JY3 N;  3LW5 J;  1B7V A;  4PJ0 E;  2HPC A;  3M9Q A;  1DD4 A;  3AE2 C;  2BCC D;  2FFD A;  1H31 A;  2V4H A;  1VL2 A;  5APU A;  2O01 J;  3L35 A;  3HD7 B;  2C0W A;  2V7Q J;  1KFM A;  4H44 D;  1IFN A;  4DCK A;  3G9R A;  1EZV G;  4U3F D;  3L71 E;  1S9K E;  5APY A;  1NU1 J;  3GG2 A;  5KLI B;  1IC2 A;  3UIA A;  2IZ0 A;  1M60 A;  4AUW A;  1IFM A;  2OYI B;  3LID A;  4WY4 D;  1RF0 A;  4WBA A;  2KUB A;  1FOS F;  2C9N Y;  2IBZ I;  1Q90 D;  4LJI A;  1DW1 A;  5KAI E;  4I7Z B;  2YKP A;  2K3R A;  3H1I G;  4RO0 A;  3V4Q A;  1EZV D;  2CPS A;  1RE4 A;  1ZW0 A;  4IL6 H;  1NNO A;  1NKN A;  1IJD B;  1FOS E;  1A2S A;  1VYD A;  3P8C E;  1RZ6 A;  3RK3 D;  1NTK K;  1E79 H;  2BEZ F;  2OYH C;  3MZW B;  3RN0 A;  1WRG A;  1KQL A;  2DW3 A;  2N9Y B;  4L3H A;  1T8Z A;  1CRI A;  2YXR B;  3ABV C;  3DR0 A;  4AYC A;  3CCU P;  5DJT B;  1KIL E;  1KYO H;  3MUD A;  1LTJ B;  3H1I D;  3OCD A;  2KSJ A;  3H1J G;  1I6E A;  3E7K A;  2WSF H;  3OA7 A;  2R3S A;  3HQ7 A;  2WSS H;  3CC2 P;  2WT7 B;  3R2P A;  4FB1 A;  1S1C X;  2C1D A;  2N18 C;  4K35 A;  1YIT P;  4IL6 X;  1AOQ A;  1QX8 A;  3VMZ A;  1DH3 A;  1CYC A;  2WSC H;  1S6V B;  2QRX A;  1S2E A;  3JC2 2;  2YNY A;  3ZOO A;  3H1K J;  4L1Q A;  3N4X A;  1GKS A;  4GDO A;  3AE8 C;  1BDC A;  3H1J D;  3Q5S A;  1NYH A;  2LKM A;  1LS9 A;  1D7M A;  4HB1 A;  4AAO A;  1HJ5 A;  1A56 A;  4PJ0 V;  3CCE P;  3L70 E;  2ZT9 C;  3BAT A;  2NRG A;  4AAN A;  3CCM P;  2KI7 B;  1CIE A;  3RBX A;  2LXC B;  5CMZ A;  3L72 G;  3CC4 P;  1VQL P;  1NTK G;  5AUR A;  3S9O A;  4N3Y B;  3EQ2 A;  2N1T A;  1NKZ B;  5IY5 1;  2GIW A;  1RQU A;  3BRT B;  2V7Q H;  4C7N B;  3TSI A;  2W83 C;  3QWO C;  1EB7 A;  4H44 C;  1G2C B;  1GTW A;  1YJN P;  3CXH D;  1LT1 A;  5KAI V;  3V2R A;  5M1B A;  3O8Z A;  1BGY J;  1KD1 Q;  3TYY A;  1KB0 A;  3G6E P;  1NTZ E;  1BL9 A;  3A3Y B;  3L72 D;  1J2J B;  1OVV A;  1NTK D;  1UIX A;  5APW A;  2OAR A;  2OZ1 B;  1C6O A;  4GIF A;  1MKM A;  1TU3 F;  3SWS A;  2ZYA A;  2QM7 A;  1Q82 Q;  1U75 B;  2C1U A;  2OYH B;  2L4D A;  1EZV I;  2KNC B;  3NXS A;  1A8C A;  3HQ9 A;  1R5S A;  2Q3I A;  4EID A;  2WTY A;  3U1A A;  2AXT H;  4K3A A;  3H1L J;  1KYO E;  2Q7C A;  3WU2 H;  1FJP A;  3VNW A;  1GL2 D;  1GMJ A;  3C9I A;  1URQ A;  4TLF A;  1Y9B A;  2PFX A;  1N7S A;  3VTP C;  2B11 B;  4AX3 A;  3CX5 D;  1R5L A;  5C39 A;  1P84 I;  1RQV A;  3W68 A;  2N18 B;  4U7J A;  2I8F A;  3CCR P;  1BCC E;  1FI3 A;  3LIE A;  5CCH A;  2Y0E A;  3CI9 A;  3CXH W;  2W90 A;  3H1H G;  2GUS A;  2YMK A;  2ZOO A;  1GD2 E;  3TDK A;  1LP1 B;  1NH4 A;  4GOF A;  1YTZ I;  2Y9Z A;  5B66 H;  2KOG A;  2FYU E;  1L4A A;  2RH0 A;  3A0B H;  3ZCF A;  2P7J A;  5AW4 B;  4XYD B;  1T6A A;  2D2C B;  3AE6 C;  3GLM A;  4WQD A;  2GA1 A;  4BRY B;  1AVY A;  2NZ2 A;  1FU1 A;  1JDL A;  3H1H D;  3WUU A;  1DT1 A;  1KMI Z;  1DW2 A;  2C9X B;  1U57 A;  1FDO A;  2K1A A;  1PFI A;  1VQK P;  1SP4 A;  1ETP A;  3ZIY A;  2RN0 A;  1M1J A;  3CX5 W;  1ZME C;  2AXC A;  1JY2 N;  1C2R A;  1K05 A;  1PGQ A;  2IPP A;  2WWW A;  1AYG A;  1IK7 A;  2W6B A;  2AEM A;  3BCC E;  1NU1 E;  2XKM A;  5CIB B;  2M5A B;  1J1E B;  1NML A;  2Y0D A;  1PP9 J;  4L73 A;  1AQT A;  2HOD B;  5AW7 B;  2P2U A;  2Z5I A;  3E1I A;  2L5G B;  1SFC A;  1CHI A;  1G1J A;  4EIF A;  5GTI H;  3PTZ A;  1OVR A;  1LT9 A;  2H43 A;  1DII C;  1YBK A;  5KJ7 C;  2AXT E;  1I8O A;  3F89 A;  4O9B A;  3WUT A;  1EC5 A;  2IFN A;  2BGV X;  5E79 H;  1N7L A;  1F1F A;  3WU2 E;  5AVY B;  1S9K D;  1YJW P;  3A0H H;  4ASW A;  3HD7 A;  1CCH A;  2M0B A;  1J3S A;  1PGP A;  1SQB K;  4OGQ C;  1GU5 A;  2CK3 H;  1LTB C;  1HUC A;  1L0N E;  1QVF O;  3E1R A;  1OX3 A;  1E5W A;  1PPJ E;  4BXL A;  2IYO A;  2R3C A;  2OYI A;  4EDF A;  2RKL A;  1SQX J;  3D6Y A;  1JB0 J;  3SFE C;  1HH7 A;  2VRS A;  3FX0 A;  1KC8 Q;  5B66 E;  1CRG A;  2ZZS 1;  2Q5U A;  3VP8 A;  1KB9 H;  2N3Y A;  1NTZ K;  3A0B E;  1FCD C;  3P8C D;  4JPZ B;  1AFO A;  2IX7 C;  1SQQ J;  1LC2 A;  2W8Z A;  3L73 J;  1QLE D;  2OYO A;  5KKZ C;  1YI2 P;  3L74 G;  1YIQ A;  1EXI A;  3JBT B;  1KIL D;  4KT0 J;  1VQ9 P;  1CI6 B;  2B87 B;  1NIR A;  1M6Z A;  2QE7 H;  3VMA A;  4WQA A;  4EIE A;  4WWI A;  1JNM A;  3CWB E;  1LTJ A;  1RF1 C;  1KV9 A;  1GW4 A;  3VMX A;  1W5C T;  3RLM A;  2WT7 A;  2AEJ A;  1GK6 A;  1M90 Q;  4WQ8 A;  1FDM A;  1CHJ A;  1A02 F;  4L3G A;  1I6D A;  1H1O A;  1LTS C;  3L74 D;  2ZYD A;  1Q7Y Q;  5DJQ C;  1SQB G;  2HLO A;  3PXW A;  1E29 A;  2WPV B;  2D0S A;  3FXE A;  3AEB C;  1Q2N A;  1VF5 D;  2IZ1 A;  1L4A B;  5TIS H;  4JYB A;  4PV1 D;  2BPB B;  1YQ4 C;  5CBN A;  1W2L A;  3B5N B;  3WFE C;  1FZF A;  1DVH A;  2FYN C;  4LGD E;  5KLV E;  2B89 A;  4PD4 I;  2AXT V;  1NTZ G;  5E79 E;  3AE7 C;  5GTH H;  3WU2 V;  1K9M Q;  2B10 B;  3A0H E;  1IFI A;  1SQB D;  2PAJ A;  1WVE C;  1LTT C;  2WQY C;  2DGE A;  1OXZ A;  2LIT A;  4RKU J;  1CIH A;  5CIF B;  1ZP0 C;  4H13 D;  3RK2 C;  5K5G B;  1M57 D;  1JMB A;  2E76 D;  1IFJ A;  3HTK A;  2YO3 A;  4GT1 A;  3CMA P;  4OGQ B;  1GIW A;  1C52 A;  2N9B A;  1SQP K;  1YFC A;  1IFD A;  1NTZ D;  2BCC J;  1I8P A;  3CC7 P;  5B66 V;  3WUI A;  1X8Y A;  3L75 E;  1KB9 E;  3PLN A;  1CIG A;  3A0B V;  4U3F J;  3MK7 C;  4C7R A;  2B12 B;  1N15 A;  2OTJ P;  1KQG B;  1M8O B;  1BCC G;  2OZ1 A;  1HVV A;  3AE5 C;  1MFT A;  1RY3 A;  1OIP A;  1UII A;  1N73 C;  2B4Z A;  1EQ7 A;  1L0L J;  5DJU B;  1I55 A;  1HGZ A;  3V2N A;  3O6Q B;  1GDV A;  3ITK A;  2OYH A;  1YIJ P;  2KNC A;  1KTM A;  4QAO A;  1KFN A;  2QJP C;  3T97 B;  2YQB A;  2L91 A;  5AVV B;  4YXW H;  1LC1 A;  2D0W A;  1OMI A;  3M9B A;  2QJK B;  3IF4 A;  1RF1 B;  4K3I A;  1BCC D;  2GC7 D;  4FAN A;  2BCN B;  1KIL C;  2P67 A;  3GF7 A;  1L0N K;  5AVU B;  4MN4 C;  3M0A A;  1BE3 G;  2BEQ D;  4ZNC A;  4H0J A;  2OTL P;  3BAS A;  2AIU A;  2K88 A;  1LP1 A;  3H1I J;  1PP9 E;  5TIS E;  1SQP G;  1EDI A;  4OH8 B;  3SJL A;  3BCC G;  1Y47 A;  3GW6 A;  3D70 A;  1QGK B;  2JQR A;  1HTL C;  3HRN A;  4OWF A;  2KZI A;  2POH A;  3AED C;  1YEB A;  2G3A A;  2FYN B;  4V2K A;  2YMY A;  4DJG A;  3HQ8 A;  3KZI H;  1XTC C;  4BRY A;  5B6Q A;  3U1C A;  5GTH E;  1BE3 D;  3A0H V;  2WZ7 A;  1VF5 C;  4PV1 C;  3V2P A;  3H1J J;  2JDI H;  3F5H A;  3RK2 B;  1SQP D;  1PV3 A;  4AQR D;  1AV1 A;  2QG4 A;  3BCC D;  2ZFC A;  1CSX A;  3HUS C;  3NTN A;  1WT6 A;  4N6J A;  1KV4 A;  2E75 D;  1KIB A;  4N0K A;  4H13 C;  2FFD C;  1LWU C;  2M5A A;  2E76 C;  2ITA A;  4WQE A;  2HOD A;  1SQX E;  1PGJ A;  5AW6 B;  3I55 P;  1VPC A;  2V08 A;  3MK7 B;  451C A;  1L0N G;  1NOH A;  1PPJ G;  2R5D A;  4W7Y A;  1N50 A;  3MD0 A;  1FZG A;  4L76 A;  1SQV K;  1N73 B;  5AVS B;  1RF0 C;  2E5T A;  2IBZ E;  1HBW A;  3B71 A;  1GJQ A;  1L2P A;  4TT3 H;  5KLV K;  1SQQ E;  2QJP B;  1VQO P;  3O1Y A;  3L72 J;  3L73 E;  3OAK A;  2QA4 P;  1LTI C;  1NTK J;  4I6M C;  1NTM E;  2Q6Q A;  1L0N D;  1CED A;  4CPG A;  3LW5 H;  3TGU G;  3BVH A;  1PPJ D;  3HTK B;  1OAE A;  2E42 A;  2C2C A;  3U59 A;  1X79 B;  1JUN A;  3PP5 A;  3AEF C;  3CCL P;  2FBW C;  3RL0 D;  1KZU B;  1H9X A;  2O01 H;  1NJI Q;  3AEG C;  1AKK A;  3M0D C;  1KOR A;  3CWB G;  5CCH D;  1S72 P;  5TIS V;  1RHZ B;  1QL4 A;  5CJ4 A;  3V2Q A;  4IL6 E;  3TGU D;  3MIW A;  4XFJ A;  4WY4 C;  1P84 H;  4WVZ A;  2LR2 A;  3KPE A;  3CU4 A;  5GTH V;  4NPF X;  1RAP A;  1CC5 A;  3VMY A;  3RBZ A;  3CWB D;  3D6Z A;  5APS A;  2P10 A;  1CI6 A;  1SQV G;  2B87 A;  2GUV A;  5KTB A;  4YXD C;  1IZN B;  3AE3 C;  4KJM A;  1KX2 A;  4Y5R A;  3RK3 C;  1IO3 A;  5KLV G;  1OVU A;  3IFM A;  1EDJ A;  2FXO A;  1CRC A;  3H1H J;  3Q5P A;  5CHX A;  4H13 B;  3PJS K;  4FA5 A;  1IFP A;  1LWU B;  2YCC A;  2E76 B;  3VOP A;  1GU2 A;  2WSE J;  2QJY C;  1AVO A;  2XND H;  3CL3 D;  1SQV D;  1FS0 E;  2LIR A;  3RMZ A;  2BCC E;  1FZB A;  3MGN A;  2E75 C;  5KLV D;  1SFC D;  4H0L D;  3ZBM A;  4D6T E;  1FI7 A;  3B5N A;  1JOC A;  2SPZ A;  3KQG A;  1XTG B;  5CCG D;  3L75 G;  3Q3D A;  4IFM A;  1H32 B;  2PCC B;  3WC8 A;  3H6P A;  1USD A;  4FA4 A;  1X9V A;  5KJ7 A;  2BH4 X;  4GOE A;  5AVW B;  1FI9 A;  1L0L E;  2ZT9 B;  3II6 A;  4IFF A;  2J58 A;  2WPR A;  1FHB A;  5CIH B;  4FA9 A;  4DZO A;  3CPW O;  1YJ9 P;  4R4M A;  2J59 M;  1WMK A;  3HD7 D;  3SWK A;  1EZV E;  3GMA A;  5KAF H;  4XE5 B;  2HV4 A;  4NPD A;  1G1I A;  3L75 D;  3IAO A;  1KB9 D;  3DMI A;  1CSU A;  1NAF A;  1JO5 A;  4LC1 A;  3DP5 A;  1HJ0 A;  4H44 B;  5TJH A;  5CYT R;  3M97 X;  3L71 G;  1W2E A;  3Q2Y A;  3OA8 B;  2B9B A;  1I5T A;  4IL6 V;  2R44 A;  2V07 A;  5CJ0 A;  1DEB A;  3RL0 C;  4ASV A;  1P84 E;  3GHG C;  3H1I E;  3CCV P;  1NO4 A;  4WY4 B;  3CXH I;  4Y99 C;  5CCH C;  2HYN A;  2OGU A;  2FWL A;  5BU8 B;  3VYI A;  3O6Q A;  2K9Y A;  3K5B A;  3SWF A;  3CD6 P;  1LTG C;  1AQ5 A;  3VN0 A;  1IQC A;  3T97 A;  1OW6 A;  1PL5 A;  2KYV A;  2PAC A;  1CO6 A;  3L71 D;  2JEE A;  3CME P;  3N7N A;  1NMI A;  1NTM K;  1GDT A;  3RK3 B;  1RF1 A;  3B8E B;  3H1J E;  5H2F H;  4KMG A;  3H25 A;  1U7J A;  1FOC A;  1KQS O;  2HR3 A;  5CBO A;  4WQ7 A;  1VQM P;  1ZV8 A;  2XDJ A;  1HJ3 A;  4HYT B;  4HKZ H;  1GL2 C;  5APV A;  3CYT I;  3HQ6 A;  2YK3 A;  2FYZ A;  2NPS D;  2P1J A;  3KXD A;  3CX5 I;  3SLE A;  2R32 A;  2GC4 D;  4DT0 A;  1JY2 O;  2E75 B;  1VQN P;  1U74 B;  1ZXG A;  2WSE H;  3AEA C;  1H33 B;  2MJZ A;  1K3H A;  1CRJ A;  3H1K E;  1CTY A;  2Z5H A;  3L74 J;  3V6I A;  4O1W A;  2JP3 A;  1JM0 A;  2M3B A;  1HJ4 A;  4H0L C;  1SFC C;  4W80 A;  2WVR A;  2ZAE B;  2I8D A;  3QH9 A;  3OJA B;  3VP9 A;  5AW8 B;  4JQ0 D;  1K04 A;  3M91 A;  3PHL A;  2A45 G;  2PP6 A;  5CCG C;  2IBZ G;  1IO4 A;  1GZL A;  1LT9 C;  3L72 E;  1X22 A;  5CIE B;  5KAF E;  4XA4 A;  2PRR A;  1QL3 A;  3L70 G;  2JWD A;  3EFF K;  3RGU A;  5C0Z A;  1Q81 Q;  1YCC A;  4PD4 H;  2OTK E;  3HE5 B;  1KQF B;  1EDK A;  3L4F A;  4EIJ A;  1N9C A;  1NTM G;  1SQB J;  1JTH B;  1ZR4 A;  2ZVN B;  2C8S A;  1T2K D;  5AW9 B;  3VRD A;  2W27 A;  3P32 A;  4I2L C;  5AW5 B;  2MTA C;  2IBZ D;  5KLI C;  5CIG B;  5GTI E;  3GHG B;  1LTA C;  5EFW B;  2FYU K;  1BGY E;  1H9Y A;  1N73 A;  3L70 D;  4QMA A;  2QEX P;  1NTZ J;  4RJT A;  4ZKU A;  1QN2 A;  5AW2 B;  5AVQ B;  1NTM D;  2E43 A;  4XXL A;  5AVT B;  5KAI H;  1CSW A;  4N78 E;  3TNU B;  5H2F E;  1YNR A;  3W67 A;  1JEK A;  2Y0C A;  3H1L E;  3JSV C;  5APX A;  3A2A A;  1EXJ A;  3MHV A;  1CXC A;  5AVR B;  1LFM A;  5B5E H;  2HFE D;  4EYY Q;  1FZC C;  3PXS A;  4UB6 H;  1NU1 K;  1GL2 B;  1H0T B;  1OZH A;  1YIC A;  3X39 A;  3O5C A;  5CIC B;  1BCC J;  3L37 A;  2CXB A;  1FE6 A;  2KXP B;  1N90 A;  3WMM 0;  4GED B;  1LGH B;  1CSV A;  3CLQ A;  2NPS C;  1H88 A;  1MG3 D;  3M9H A;  1FJK A;  2D2C D;  2XU6 A;  3IN6 A;  1GQ1 A;  1KYO D;  1FZA A;  5KKZ B;  3AEE C;  1FJ0 A;  3D71 A;  4H0L B;  3Q5R A;  1CNO A;  2FYU G;  4UB8 H;  1OW8 A;  4YE1 A;  351C A;  3S1K A;  4D6T G;  1HCM A;  5KAF V;  1E8E A;  2A06 E;  1JY3 P;  1F1C A;  5AVX B;  4PD4 E;  3P8M C;  3AE4 C;  1L0L G;  1BE3 J;  3HUS A;  2ZBO A;  3USS A;  1R0Q A;  2H88 C;  3IR9 A;  5APQ A;  3JCU H;  2Q1K A;  1FZE A;  2N3B A;  1LWU A;  1VQP P;  4LLH A;  2BLF B;  3VYM A;  4YTP C;  5DJQ B;  2FYU D;  1SQP J;  4D6T D;  2Q3E A;  5GTI V;  2PGD A;  3BCC J;  2FXP A;  1CSB A;  3PH0 A;  4WQ9 A;  3O20 A;  1RE3 C;  2O1J A;  1NU1 G;  1T2K C;  4JBZ A;  2ZYG A;  1L0L D;  2JR8 A;  3A7O A;  3WFC C;  2A45 I;  1H32 A;  3P7K A;  1KYO W;  2FY8 A;  2KS1 B;  2CE1 A;  1SVF A;  3FWN A;  5E79 V;  2IYP A;  3EFG A;  1L9B C;  2XV5 A;  3SSU A;  5DF5 A;  3I5C A;  1QVG O;  5H2F V;  2N9J A;  1LMS A;  3NWV A;  1H8A A;  4IOI H;  1NGM B;  1CTJ A;  4YPC A;  1QYZ A;  1NU1 D;  5B5E E;  1JY3 O;  2FXM A;  4AAM A;  2N1T D;  3CP5 A;  4UB6 E;  1W2B O;  3M0D A;  1FZC B;  2RMZ A;  1P84 D;  2H7H A;  1L0N J;  4OVN F;  2ZXE B;  2MHM A;  3OA8 A;  2CPB A;  1FBM A;  3L4M A;  1NHL A;  2PCB B;  1PGO A;  3CCS P;  2CE0 A;  2C0X A;  4JF7 A;  4WY4 A;  1T3J A;  1GW3 A;  2NPS B;  3V4W A;  4I1L A;  2LXB A;  2GB8 B;  1M70 A;  1VQ6 P;  3FXD A;  1N8R Q;  3RN1 A;  4PW9 B;  4UB8 E;  1CIF A;  1YYC A;  1QL1 A;  3KHU A;  3L74 E;  4H0K A;  1FDI A;  2O01 N;  3TGU J;  1RE4 C;  2ZVO B;  1HZU A;  3FWL A;  2O1K A;  1KN7 A;  2CA3 B;  1KYO I;  2R5B A;  3H1K G;  4A7P A;  1I54 A;  1PIX A;  2D2C C;  1DW0 A;  2VHD A;  1CTZ A;  3C2C A;  1ZOY C;  1URQ D;  3JCU E;  5DFS A;  1KIL B;  2HG5 D;  1N7S D;  3CWB J;  1K3G A;  1HH0 A;  2E74 D;  2K9J B;  1MFZ A;  1NVO A;  3WFD C;  1CRY A;  1LNQ A;  4L74 A;  3PRJ A;  1HJB A;  1MZ4 A;  3MUD C;  1SQB E;  1AOF A;  4IFD K;  1RZ5 A;  1ZN5 A;  2H89 C;  2YO2 A;  1HF9 A;  4WQB A;  1N86 A;  2P58 A;  3H1K D;  4MU8 A;  4W7Z A;  1S5L H;  5CID B;  2BH5 X;  2M3E A;  1C6R A;  4GOD A;  1M7L A;  1H33 A;  2XZR A;  5AVZ B;  1L4A D;  2FRC A;  1J1E C;  3KZI E;  3B5N D;  2JTI B;  2C1V A;  1N2D C;  1YQ3 C;  2O3J A;  3HE4 B;  1A02 J;  1SQV J;  2QIW A;  1IRV A;  5KJ7 D;  2G8Y A;  3TYI A;  1VF5 B;  2JO1 A;  5BU5 A;  2YIU C;  1VQ4 P;  3H32 B;  1BGY G;  4PV1 B;  5AW3 B;  2IFM A;  4PWA A;  5KLV J;  2XTS B;  1NAY A;  1DD3 A;  1YEA A;  2JWA A;  1CZQ A;  4M3L A;  2ZXY A;  5B5E V;  1ZRT E;  4P4Q B;  3CCQ P;  2C9L Y;  4OGQ D;  3HE5 A;  4UB6 V;  3HUS B;  1S5L X;  1VQ5 P;  2HPC B;  1Y8A A;  3RL0 g;  2ZJS E;  1ZR2 A;  1JTH A;  2FFD B;  1H31 B;  3CCJ P;  3H1L G;  2WPQ A;  1BGY D;  3B4S A;  3C8V A;  2N1T C;  4FAV A;  1QEX A;  3GHG A;  4EOT A;  2I1J A;  3L75 J;  4U3F E;  2AEF A;  1LJ2 A;  2QVA A;  3NFQ A;  2ORL A;  4NFG B;  4UB8 V;  4NPE A;  2XNX A;  4N78 D;  5L8R J;  1YTZ T;  3H1L D;  3KDP B;  155C A;  3TNU A;  1HRO A;  2I1K A;  1BSH A;  3CXH H;  2KK7 A;  3SXT A;  4Q5P A;  1DIQ C;  1IK9 A;  5C9M A;  1AJY A;  2Q9I A;  1FC2 C;  3R4Y A;  3RK3 E;  1H89 A;  4EI2 A;  1BE3 E;  3L71 J;  4BWN A;  3AE1 C;  2JKV A;  3KYQ A;  1K8A Q;  1GL2 A;  2A06 G;  3TK1 A;  1H0T A;  1JY2 P;  1URQ C;  1VQ8 P;  3OCD B;  2K37 A;  1S5L E;  1CYI A;  1SQX K;  1C75 A;  2WIT A;  2B88 A;  2YXQ B;  3PXT A;  1N7S C;  2GM4 A;  5AW1 B;  2AI5 A;  2E74 C;  1IRW A;  1SQP E;  2C1D B;  1HRC A;  3KZI V;  4GYD A;  3TF5 A;  1EDL A;  5AW0 B;  2KLU A;  2M8R A;  2WMM A;  3M06 A;  1CRH A;  3CX5 H;  1PP9 G;  1SQQ K;  2A06 D;  2ZON G;  4PD4 D;  3ZOX A;  2YIU B;  1L4A C;  2FKW B;  1M56 D;  1K73 Q;  4RSZ A;  1J1D C;  3B5N C;  5CCG A;  1WEJ F;  3NMD A;  2N9I A;  2QSI A;  1NWQ A;  2DVH A;  3RK2 D;  2BAS A;  1HGV A;  4KHX A;  1USE A;  3L36 A;  3NBS A;  5BVZ A;  1CYJ A;  1OCD A;  2CA4 B;  2KIK A;  4ZKP A;  1PP9 D;  4RES B;  2QJY B;  4R4L A;  1M1J C;  1CHH A;  1RH5 B;  1OW7 A;  1ZLL A;  3SWY A;  5EXQ A;  1JCD A;  2KP8 A;  3OW2 O;  2N1T B;  2YKQ A;  3I56 P;  1L9J C;  1S4X A;  2Z4E A;  4Y28 J;  1R8E A;  1HZV A;  1M1K Q;  1KX7 A;  4J20 A;  3MP7 B;  2MKV A;  2H8P D;  4WQC A;  1PZQ A;  3S4R A;  3SFD C;  2KS1 A;  1ZZH A;  2E5Y A;  1SQX G;  1SLQ A;  4HJG H;  1JMM A;  2EXV A;  4O1Q A;  1OFC X;  3AE9 C;  3C1L A;  3L4O A;  4JCG A;  1E2R A;  2UWJ E;  3CXH E;  1BDD A;  2B0Z B;  3SVW A;  4DOJ A;  3L70 J;  1DEE G;  3Q1M A;  2WPS A;  1YHQ P;  3ZDM A;  3TGU E;  1C2N A;  4DY9 A;  1NTK E;  1VDF A;  1VQ7 P;  3NBT A;  1NTM J;  1SQQ G;  1CXA A;  3O0R C;  1DVV A;  3L73 G; 
#chains in the Genus database with same CATH homology
 3ORV A;  2ZBO A;  1R0Q A;  1SQX D;  1OAE A;  1ETP A;  2C2C A;  3ZIY A;  2RN0 A;  1S5L V;  3CX5 W;  2N3B A;  1H9X A;  1C2R A;  4EIC A;  2BLF B;  3VYM A;  1AKK A;  5DJQ B;  2FYU D;  1AYG A;  4D6T D;  2Q3E A;  5GTI V;  1RAQ A;  5CIB B;  1NML A;  5TIS V;  4WQ9 A;  2Y0D A;  3O20 A;  1QL4 A;  1SQQ D;  3PH2 B;  3TGU D;  3L73 D;  1L0L D;  1CHI A;  3WFC C;  1H32 A;  1KYO W;  2CE1 A;  1MG2 D;  5E79 V;  3CU4 A;  5GTH V;  4EIF A;  1L9B C;  3PTZ A;  1RAP A;  5DF5 A;  1C7M A;  1CC5 A;  1DII C;  5H2F V;  3CWB D;  2N9J A;  1LMS A;  3ZOY A;  4AAL A;  1I8O A;  3NWV A;  1KX2 A;  2BGV X;  1CTJ A;  1F1F A;  4Y5R A;  1QYZ A;  1IO3 A;  1NU1 D;  1QKS A;  1C6S A;  4AAM A;  1CCH A;  3CP5 A;  1J3S A;  1CRC A;  4FA1 A;  2RMZ A;  1P84 D;  3WFB C;  3A9F A;  4FA5 A;  2YCC A;  2MHM A;  3OA8 A;  4EDF A;  1GU2 A;  3L4M A;  1HH7 A;  1COR A;  2PCB B;  1SQV D;  2LIR A;  3RMZ A;  2CE0 A;  1DW3 A;  1CRG A;  2ZZS 1;  1YTC A;  5KLV D;  2N3Y A;  3ZBM A;  1FI7 A;  3ZOW A;  1CCR A;  2GB8 B;  1FCD C;  1M70 A;  1IZL 0;  3RN1 A;  1H32 B;  4PW9 B;  2PCC B;  1CIF A;  3KHU A;  1ZRT D;  3WC8 A;  4H0K A;  4FA4 A;  1LC2 A;  2BH4 X;  1COT A;  1FI9 A;  1HZU A;  3FWL A;  2CA3 B;  4A7P A;  1FHB A;  1YIQ A;  1I54 A;  3JBT B;  5CIH B;  4FA9 A;  1DW0 A;  2VHD A;  1B7V A;  1CTZ A;  3C2C A;  1NIR A;  1M6Z A;  3VMA A;  4WQA A;  4EIE A;  5DFS A;  2BCC D;  1H31 A;  1K3G A;  1KV9 A;  2HV4 A;  1W5C T;  2K9J B;  3RLM A;  3L75 D;  1KB9 D;  3DMI A;  3WFD C;  1CRY A;  4U3F D;  1CSU A;  3PRJ A;  1MZ4 A;  1AOF A;  1RZ5 A;  4WQ8 A;  3DP5 A;  3GG2 A;  1CHJ A;  4WQB A;  4L3G A;  5KLI B;  1M60 A;  5TJH A;  1I6D A;  5CYT R;  3M97 X;  1H1O A;  3H1K D;  3L74 D;  4MU8 A;  3OA8 B;  5CID B;  1I5T A;  4IL6 V;  5DJQ C;  2BH5 X;  2V07 A;  1C6R A;  3PXW A;  1H33 A;  1E29 A;  2D0S A;  2FRC A;  4LJI A;  1DW1 A;  2JTI B;  2C1V A;  2O3J A;  2FWL A;  2BPB B;  1W2L A;  1IRV A;  3WFE C;  1EZV D;  3TYI A;  1DVH A;  1NNO A;  1IQC A;  2AXT V;  1A2S A;  4PWA A;  2XTS B;  1VYD A;  2PAC A;  1RZ6 A;  1CO6 A;  1YEA A;  3L71 D;  2JWA A;  3WU2 V;  3RN0 A;  2B10 B;  1NMI A;  1SQB D;  2ZXY A;  5B5E V;  2N9Y B;  4L3H A;  1WVE C;  1CRI A;  4P4Q B;  2DGE A;  2LIT A;  1CIH A;  4UB6 V;  5CIF B;  4KMG A;  1FOC A;  3DR0 A;  1GIW A;  3H1I D;  1C52 A;  4WQ7 A;  1H31 B;  3OCD A;  1I6E A;  1HJ3 A;  3HQ7 A;  1BGY D;  1YFC A;  4FB1 A;  3CYT I;  3HQ6 A;  2YK3 A;  2C1D A;  1NTZ D;  2N18 C;  3SLE A;  4FAV A;  1I8P A;  2GC4 D;  5B66 V;  3WUI A;  1AOQ A;  3PLN A;  1CIG A;  3A0B V;  3MK7 C;  1CYC A;  1U74 B;  2B12 B;  1N15 A;  1H33 B;  2ORL A;  4NFG B;  1S6V B;  4UB8 V;  1K3H A;  1CRJ A;  2OZ1 A;  1CTY A;  3ZOO A;  4L1Q A;  2B4Z A;  1GKS A;  3H1J D;  4O1W A;  1I55 A;  1LS9 A;  1HJ4 A;  3H1L D;  1GDV A;  3ITK A;  4AAO A;  155C A;  1HJ5 A;  4QAO A;  1A56 A;  1HRO A;  4PJ0 V;  3PHL A;  2YQB A;  3SXT A;  2L91 A;  4Q5P A;  1DIQ C;  5C9M A;  1LC1 A;  4AAN A;  5CIE B;  2D0W A;  1QL3 A;  2QJK B;  5C0Z A;  1CIE A;  1YCC A;  4K3I A;  1BCC D;  2GC7 D;  4FAN A;  2BCN B;  5AUR A;  1N9C A;  2C8S A;  3OCD B;  3VRD A;  5IY5 1;  1CYI A;  2GIW A;  1C75 A;  4H0J A;  2AIU A;  3PXT A;  2AI5 A;  1IRW A;  2C1D B;  1EB7 A;  1HRC A;  2IBZ D;  2MTA C;  3KZI V;  4GYD A;  3TF5 A;  5CIG B;  3CXH D;  5KAI V;  1H9Y A;  3L70 D;  1KB0 A;  3SJL A;  1BL9 A;  3L72 D;  4RJT A;  1CRH A;  3GW6 A;  1QN2 A;  1NTK D;  2JQR A;  2OZ1 B;  1NTM D;  2A06 D;  1C6O A;  1YEB A;  2FYN B;  2ZON G;  4V2K A;  4PD4 D;  3ZOX A;  3HQ8 A;  2YIU B;  5B6Q A;  4XXL A;  3SWS A;  1BE3 D;  4RSZ A;  3A0H V;  1WEJ F;  2N9I A;  1U75 B;  2C1U A;  1CSW A;  2L4D A;  2KNC B;  2DVH A;  1YNR A;  1A8C A;  3HQ9 A;  4EID A;  2Y0C A;  1SQP D;  3NBS A;  1CYJ A;  2QG4 A;  1CXC A;  1OCD A;  2CA4 B;  3BCC D;  1LFM A;  3VNW A;  1CSX A;  1PP9 D;  3PXS A;  2QJY B;  1CHH A;  2B11 B;  4AX3 A;  3CX5 D;  5EXQ A;  1KIB A;  4N0K A;  2N18 B;  1YIC A;  2I8F A;  3X39 A;  3O5C A;  1L9J C;  1FI3 A;  5CIC B;  4WQE A;  2Y0E A;  2CXB A;  3CXH W;  1HZV A;  2ZOO A;  1KX7 A;  1N90 A;  4J20 A;  3TDK A;  2V08 A;  3MK7 B;  451C A;  4WQC A;  4GED B;  1CSV A;  2KS1 A;  1ZZH A;  1N50 A;  1MG3 D;  2EXV A;  4O1Q A;  3ZCF A;  1GQ1 A;  1KYO D;  3L4O A;  4JCG A;  1E2R A;  5KKZ B;  1FJ0 A;  1GJQ A;  2B0Z B;  3SVW A;  1CNO A;  4XYD B;  4WQD A;  4YE1 A;  351C A;  2QJP B;  1HCM A;  3O1Y A;  1C2N A;  5KAF V;  4DY9 A;  1E8E A;  3NBT A;  1JDL A;  3H1H D;  1F1C A;  1DT1 A;  1CXA A;  1L0N D;  3O0R C;  1CED A;  1DVV A;  1DW2 A;  2C9X B;  1PPJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...