1BE3G

Cytochrome bc1 complex from bovine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1be3G00
3BCCG 3L71G 1SQBG 3CX5H 3CXHH 2IBZG 2A06G 3L75G 3H1HG 3L70G 3H1LG 1SQVG 1NTMG 1L0NG 1SQPG 2FYUG 3H1KG 3L74G 1NU1G 4U3FG 4D6TG 1BE3G 1L0LG 2BCCG 4PD4H 3TGUG 1PP9G 3H1JG 1KYOH 1NTZG 1NTKG 3CWBG 5KLVG 3L73G 1PPJG 1BCCG 1SQXG 3L72G 1EZVG 3H1IG 1BGYG 1SQQG 1P84H 1KB9H
chains in the Genus database with same CATH superfamily
3BASA 3MP7B 2BASA 1NKNA 1URQD 1MKMA 5KKZB 2OYHC 5KAFE 3CCEP 3L74G 3HD7B 2C9LY 1LJ2A 3HD7C 2QJYB 2A06E 3L73G 1Y8AA 5CCHC 1GD2E 2J58A 1OMIA 3NMDA 3OAKA 1PL5A 2N9YB 1P84I 3AE3C 2NPSA 1EZVE 2OQQA 3WUUA 1RH5B 4U3FJ 1SQXD 5APXA 3TNUB 4A7PA 3CX5H 1JMMA 4WY4C 3M9BA 1CI6A 2FYUG 4IL6X 3H1JE 1Q86Q 3MTUE 4ZMDA 3B8EB 2FYNB 2G3AA 2Y0DA 1ZW0A 1FZBA 2DW3A 2FYNC 2ZT9D 1HH0A 2OTLP 3L71D 1NTZK 2W6AA 1HWTC 3D70A 5GTIE 1W2BO 5AW9B 3RBZA 1LTJB 1UIXA 1JY2O 2W8ZA 1T2KC 3G6EP 3A0HE 1QLED 1OXZA 2Q6QA 1KILB 2IBZD 1FU1A 3LIEA 3L75D 3I56P 1JEKA 4R4LA 1GL2D 1DEBA 2D2CB 1SQPJ 4RESB 1BE3G 1RF0A 1OW7A 1S1CX 1FS0E 2W90A 1LT1A 1R5LA 1VQ6P 3L36A 4H44B 3V6IA 1JTHA 3L4FA 2B9BA 1HF9A 1WT6A 4GODA 1FZEA 3WU2E 1K9MQ 3BRTB 3SWYA 4DZOA 2H43A 4CPGA 1GW4A 1M1JB 2Q1KA 4WWIA 2E74B 2J59M 3TGUG 1AVYA 3CL3D 3PH0A 5CCGC 1DIPA 2OYHB 1VPCA 2E74C 2HYNA 1USEA 2P67A 2ZVNB 3C8VA 1SQVD 2PAJA 3PLNA 2P58A 1VQ4P 4I7ZC 1H0TA 1NU1J 2YO3A 1YJNP 1RF1C 2POHA 4EYYQ 1GMJA 2BCCE 1NTKE 1ZOYC 2KS1A 3M91A 3V4WA 2IZ0A 1EDLA 1PP9D 3CWBD 3H1ID 2KNCA 3ZDMA 1KB9H 3PJSK 2G8YA 2K37A 4PJ0H 1S9KE 2M0BA 3WMM0 4C7NB 2Y9YA 1W2EA 5DJUB 1Q81Q 1PGPA 3M0DA 3CCLP 1PGQA 4PV1B 3K5BA 1OVUA 2IYPA 3HUSB 3Q5SA 1LP1B 1U7JA 4PV1C 2B87A 1BCCJ 2WT7B 3HUSC 2M5AB 3IN6A 2OYOA 4JBZA 4K3AA 4PD4E 2K1AA 2FXOA 2HPCA 1RQUA 1NTZG 3H32A 1IJDB 3AEFC 1GTWA 2AXTE 1FDMA 4XA4A 5GTHE 1RE4C 5B5EH 3CCRP 1FZFA 1YJWP 2K9YA 2KZIA 4IOIH 3H1HJ 4LC1A 1PGOA 3FGAD 1M90Q 1JCCA 1OW6A 1L0LD 1SQPK 3JCUE 5AVTB 1A02J 4N6JA 1YJ9P 2ZFCA 1X22A 4O9BA 5B66E 2QJPC 4BRYA 4GOEA 3G4SP 1L2PA 3L72E 1LNQA 3H1KJ 1P84E 2QG4A 4UB6H 1SQQD 2N1TD 3H1LE 2H89C 1BDCA 4TT3H 2E76C 4C46A 3D6YA 2IX7C 1LTGC 2NPSC 1DD3A 2KP8A 1NTMJ 3SWKA 5BU5A 2K3RA 3AE5C 3EFGA 5EFWB 1UIIA 2P10A 1NU1K 1GDTA 1NKZB 2E75D 3GW6A 4DOJA 1DD4A 3CMEP 3AE6C 4OGQD 3G9RA 4D6TD 1M57D 3CPWO 2GUVA 1BGYE 2R5BA 2WZ7A 1YYCA 2WPVB 2AEJA 1S72P 3L70E 1K05A 1EXIA 5AW2B 4YTPC 1E5WA 4JYBA 3VN0A 4HJGH 4Y28J 3OJAB 4U3FG 4IL6E 3GG2A 5AW1B 2XNDH 1GZLA 1SQBE 1M8OB 3QWOC 3D6ZA 1PGJA 2FKWB 2R44A 2QRXA 1ZR2A 3G3ZA 1AQ5A 3VOPA 1RF0C 1ZN5A 5BU8B 3QH9A 1N7SA 3W67A 3JSVC 3A3YB 3L74E 2RN0A 5KAIE 1JY3P 4L75A 1L0NJ 1G2CA 3L73E 1SLQA 4H13B 2JDIH 3BRVB 1WRGA 4H13C 3MZWB 3RL0D 2E5YA 2XV5A 5M1BA 1H0TB 5KTBA 5KLVJ 3CXHD 4H0LD 2R3CA 2Z4EA 2K88A 1SQPG 2ZYGA 1KZUB 2BEQD 1LTSC 3RK2D 1ZXGA 2JWAA 2QE7H 2KS1B 2D2CD 2ZYAA 1OVRA 2IDBA 2FYUE 5CMZA 3F89A 5C39A 1IK7A 4H44D 2W6JH 1SFCD 1NTMK 1S3JA 3AE8C 2ZXXA 2E43A 1YITP 1G1IA 3HRNA 2A06D 1SQXJ 1URQA 4XE5B 2YNYA 3M0DC 1LWUA 1NU1G 3NXSA 3ABVC 2R3SA 2FFDA 5BVZA 1EZVD 3CD6P 1QL1A 1L4AD 1EC5A 1VL2A 3L71J 3R2PA 4RO0A 1BE3E 1Q90D 3EQ2A 4YPCA 4W7ZA 2OYIA 2LKMA 3H1JD 3CLQA 2RH0A 1YI2P 1RE3A 2WMMA 1M7LA 1PV3A 2KIKA 1ZR4A 3TGUE 3L75J 2HODB 3PTZA 3KZIH 4BRYB 1DEEG 3R4YA 1IC2A 1PPJG 1BCCG 1R8EA 1HVVA 5KJ7C 3VP9A 1OX3A 1LT9A 2IFMA 1KYOI 2V4HA 3MIWA 2WSFH 4JF7A 3M9HA 1USDA 3BATA 2HG5D 1HTLC 2PP6A 3MGNA 4I2LC 2QJKB 3KQGA 1LTTC 3FWLA 1L0NK 3GLMA 3HE5A 2QJKC 4HKZH 4JPZB 3AECC 1U57A 3GF7A 5E79E 2M3BA 4WY4B 2Q3EA 3RGUA 3H1HG 2Q7CA 4GT1A 1JY2P 4HYTB 1KMIZ 1GL2A 3KPEA 2CPBA 1SQVJ 3H6PA 1KQGB 3A0BE 4YXWH 1S5LH 2XKMA 3B5NA 4I6MC 2JWDA 3RK3B 1N86A 4L74A 3CI9A 2FXPA 3RK3C 1KORA 3H1KG 2Q5UA 2Y9ZA 2E42A 1HJ0A 1AA0A 3H25A 2HR3A 1PP9J 2ZAEB 1WMKA 5APUA 3CWBJ 3VMZA 3MUDA 3H1IJ 1SQXK 2W6BA 1MFTA 1NTMG 4MN4C 4UB6E 1NTZE 4DJGA 1FAVA 2BCCD 3FWNA 1NH4A 1NTKD 5APSA 1LTBC 3B5ND 2WQYC 3E7KA 2W83C 1YQ4C 3RK2C 2LXBA 1N7SC 1S9KD 3CX5I 2VRSA 1LTAC 1HJBA 2I1KA 4TLFA 1FDOA 3KYQA 1KD1Q 1G2CB 5AW0B 2XNXA 2LR2A 4HB1A 4ZNCA 1KQFB 3AE2C 4I7ZB 1VF5D 2BEZF 1DH3A 1U7MA 2KXPB 1Y9BA 4NPEA 1RF1B 3U1AA 4PD4D 1VQPP 3L37A 2MKVA 1L0LJ 1GW3A 3CXHH 3V4QA 1KFNA 2WSFJ 3O6QB 2E5TA 1ZP0C 1QVGO 2WWWA 2OGUA 2A45H 2AEFA 5APWA 2KYVA 1NWQA 1T8ZA 1Y47A 1SQQJ 3TF5A 1VQOP 1L0NG 3P8CE 3V2RA 1YQ3C 1SQVK 5AVQB 1URQB 1XTCC 4W80A 1IFPA 3P32A 2YKOA 3P8MC 1URQC 5KLVG 3L72D 1J1EC 3O8ZA 1LWUB 1P84D 1JNMA 1FZGA 5KLIC 4DCKA 2CPSA 1LWUC 3H1LD 3VYIA 4U3FE 1HBWA 5CJ0A 3W68A 2WSCJ 3HE4A 2PRRA 4D6TJ 3GMAA 1IZNB 4B86A 2N1TA 4N78E 2OYIB 4EIJA 1KFMA 5AVWB 2OYIC 3I5CA 2J5UA 3AEDC 3CCMP 1RE3C 1D7MA 4M3LA 2PGDA 2IYOA 4YXDC 1SQXG 1BGYD 2QJPB 1H89A 4U7JA 3I55P 2WVRA 3L70D 1KTMA 1CZQA 1Q82Q 5CBNA 1AVOA 3OW2O 3A7OA 2ZT9B 5GTIH 1AJYA 3GHGA 3HTKA 1KB9I 1KYOE 2ZT9C 3MHVA 3PP5A 2GM4A 4NPDA 1W5CE 2FBWC 1LT9C 5AW4B 2E76B 3A0HH 1SQPE 1SQBD 3L71G 1OIPA 2NPSB 3HE5B 1SS1A 2R5DA 1OWAA 3AEEC 1ZRTE 4OWFA 2C0WA 2LXCB 5CJ4A 4UB8E 4WB4A 3S1KA 2HLOA 3M0AA 1CI6B 1L0LK 1IFDA 1VQ7P 1GL2C 2IBZG 4OVNF 1JM0A 3L75G 2KSJA 1KC8Q 1S2EA 2ITAA 5H2FE 1OW8A 3WU2H 3L74D 3TNUA 1JO5A 3B5NC 3L73D 2YMYA 1VQNP 3OA7A 3HD7D 4BWNA 2O01H 3B71A 1NU1E 1SQQK 1HGZA 5CCHD 1OZHA 2N9BA 2WSSH 2M8RA 1N8RQ 3JC22 4ASVA 3MUDC 1LTJA 1JY3N 5AVUB 4QMAA 4Y99B 3AE7C 1RY3A 1SQVG 2FYUD 4Y99C 1BDDA 3L35A 4WY4D 1KILA 1JTHB 1NGMB 1SQQE 1FZAA 1PZQA 3CX5E 2K9JA 4DT0A 4WVZA 2C0XA 2XZRA 1NHLA 2WSEH 3VMYA 1G1JA 3KXDA 2YXQB 3U1CA 1SFCA 1PPJE 1BCCE 3FXEA 1PP9G 3CWBG 5CHXA 4JQ0D 2L5GB 2Z5IA 1IFJA 1T2KD 3H1IG 3H1JJ 1M1JA 4KHXA 5APYA 3BCCJ 4GOFA 1MFZA 1PIXA 4OH8B 1KILD 1BE3D 2KZJA 4PD4H 1KQLA 1NOHA 1CW5A 3H1HE 3C9IA 1L4AA 1YTZI 3SFDC 5AW7B 1XTGB 5GTHH 1J2JB 2KNCB 1T3JA 5AVVB 2IBZI 1K8AQ 1LGHB 1GU5A 2HFED 2P7JA 3TGUD 4AUWA 4KT0J 2ZJSE 3KHUA 3EWKA 3Q5RA 4W7YA 5CCGD 5B66H 3H1KE 2E74D 2YXRB 1VQLP 2NZ2A 2UWJE 1FE6A 1IK9A 2YKPA 1BSHA 3U59A 3RK3E 3CCSP 2GA1A 1IO4A 2B87B 1L0LG 4N3YB 1NJIQ 3S4RA 1P84H 1NTME 2FY8A 2ZVOB 2HPCB 3CCJP 3H32B 3RL0g 2WPQA 2O01J 5AW6B 1LP1A 2RMZA 3EFFK 2WT7A 2N1TC 1EDKA 4EDFA 1SQQG 1N73A 2WPSA 3VTPC 4GKGA 5L8RJ 2E75B 1KV4A 1IFIA 2I8DA 4ZKUA 2E75C 1KB9E 2BCCJ 2OARA 4PJ0E 1NTKJ 3GHGC 4OGQC 2AEMA 2Q3IA 2WSEJ 5KKZC 5AW5B 4PV1D 2QEXP 1NVOA 4D6TG 2YKQA 1NTZD 3T97A 2KSEA 4IL6H 2C9NY 2B88A 2QJYC 3C1LA 5KLVK 3NTNA 2YMKA 1T3UA 4GIFA 1FC2C 2KK7A 2KI7B 2JJLA 1K73Q 3AE1C 1QVFO 5B5EE 1RHZB 1FBMA 1J1DB 1X79B 1L0NE 2P2UA 1J1DC 1QGKB 1ZV8A 4HH2A 4IFDK 2WSCH 5KAIH 2Y0EA 5KLVE 3SSUA 1SP4A 3BCCE 3CCVP 3WUVA 5TISH 3Q1MA 3IF4A 5AVRB 1OFCX 2O3JA 2E76D 5APQA 2QA4P 3RL0B 1LTJC 1S5LX 2NPSD 4H0LB 3RL0C 1A02F 4H0LC 1FOSE 1X9VA 3L72J 1KILC 3RK2B 1N7SB 2K9JB 2O01N 3M06A 1FJPA 1R5SA 3H1LJ 3P8CD 1SQXE 1PFIA 2D2CC 2A45G 1SFCB 2QIWA 4H44C 4ZKPA 1SFCC 1FZCA 1GK6A 1OVVA 2JO1A 4L73A 1FDIA 4U3FD 3CCUP 1M1JC 3L71E 3AE9C 1VQ9P 2KOGA 1NTKK 3M9QA 2R32A 3CCQP 2A06G 1JMBA 1BGYJ 1Q2NA 1T6AA 4N78D 2PFXA 3AE4C 2O1KA 3II6A 1L4AB 5AW3B 3L70J 1QL2A 3FXDA 3UIAA 3V2PA 1L4AC 1JUNA 2JKVA 2QVAA 2IBZE 2M3EA 3L75E 1EZVG 3RBXA 1M1KQ 1N2DC 3KDPB 2WTYA 1SQBJ 1CSBA 2IFNA 5KAFH 2V7QH 2GUSA 3H1JG 1KYOD 1J1EB 1YTZT 2CK3H 3CC2P 2W27A 1IFNA 5KLIB 4IFMA 3BCCG 1KN7A 4LGDE 1HUCA 3B4SA 4RKUJ 4H13D 2SPZA 4EOTA 2FFDB 1SQPD 3S9OA 2FFDC 3A2AA 1ZRTD 3L74J 2L91A 5APVA 2OTJP 3USSA 1EDJA 5AVZB 1SQVE 3L73J 5E79H 2XDJA 2ZXEB 1N73B 3CXHI 3AEGC 1N73C 1M56D 2B89A 1VQ8P 5AVXB 3A0BH 4BXLA 1MZ9A 2MJZA 4EI2A 2A45I 3LW5H 1EXJA 3N7NA 1PP9E 1NU1D 2JP3A 2NRGA 3CWBE 5TJHA 1H8AA 2OYHA 3V2NA 1LT9B 1VDFA 2FYUJ 3WUTA 3H1IE 3E1RA 5K5GB 3VP8A 4ASWA 2KUBA 3HD7A 3CC7P 2HODA 4WBAA 3D71A 3T97B 1K04A 5KJ7A 5CCHA 1FOSF 1ZMEC 4Z1MH 4RJTA 1NAYA 1X8YA 3AEAC 3VMXA 1GL2B 3FX0A 3TK1A 1X0TA 4NPFX 3IFMA 3CX5D 3PHLA 4XFJA 1EZVI 2FXMA 1VQMP 4WY4A 1DX7A 1JB0J 3B5NB 1GU4A 2BCCG 2QM7A 1NTKG 2WITA 1PPJD 1BCCD 1BE3J 1MV8A 4AYCA 1RQVA 1E79H 5KJ7D 2Q9IA 1L0LE 1SQBK 3KZIE 5DJTB 5AVYB 3LIDA 1H88A 2XU6A 1GK4A 1VF5B 2JEEA 1FJKA 1YHQP 4IFFA 3TGUJ 2V7QJ 1NO4A 1VQ5P 1VF5C 1VQKP 1AV1A 3H1HD 1YIJP 1NAFA 3GF3A 1AFOA 2Z5HA 1SVFA 4R4MA 3TDKA 3NFQA 5AW8B 2OTKE 2WPRA 1BSNA 3BVHA 3H1KD 3E1IA 3N4XA 1AQTA 3VMAA 3Q2YA 1FZCB 3RK3D 1S5LE 4K35A 3ITKA 1FZCC 2IPPA 4GDOA 4AQRD 1YBKA 5CCGA 1NTMD 4D6TE 3G71P 2H88C 2AXCA 3Q3DA 3MD0A 3SFEC 1S4XA 3LW5J 5TISE 3A5TA 2FYUK 2KLVA 1QEXA 4JYCA 1MUUA 1EDIA 4LLHA 3L72G 1HGVA 1RF1A 1JCDA 2YO2A 3H1LG 1ZLLA 2AXTH 3CMAP 1JY3O 3PRJA 4I1LA 1N7SD 3Q5PA 3V5BA 3JCUH 1NTZJ 2FYZA 3O6QA 1KB9D 2IZ1A 2YIUB 3CC4P 4L76A 2YIUC 2QM8A 3V2QA 5CBOA 4C7RA 5AVSB 3F5HA 1KYOH 2QSIA 2ZYDA 1IFMA 1JOCA 2JR8A 4C7NA 3IR9A 2H7HA 1BGYG 2RKLA 3IAOA 5APTA 2Y0CA 1LTIC 2KB7P 3L70G 3HE4B 1Q7YQ 4KJMA 3TSIA 2N1TB 3HUSA 1Z56A 2KLUA 1N7LA 4UB8H 2M5AA 3CXHE 3SWFA 1EQ7A 1TU3F 1SQBG 4PD4I 1KQSO 3P7KA 1KILE 1NYHA 1QX8A 2H8PD 1L0ND 2P1JA 1RE4A 5H2FH 1JY2N 5KLVD 2O1JA 3TYYA 3GHGB 3HTKB 3AEBC 4OGQB 3BCCD 2I1JA
chains in the Genus database with same CATH topology
3BCCG 3L71G 1SQBG 3CX5H 3CXHH 2IBZG 2A06G 3L75G 3H1HG 3L70G 3H1LG 1SQVG 1NTMG 1L0NG 1SQPG 2FYUG 3H1KG 3L74G 1NU1G 4U3FG 4D6TG 1BE3G 1L0LG 2BCCG 4PD4H 3TGUG 1PP9G 3H1JG 1KYOH 1NTZG 1NTKG 3CWBG 5KLVG 3L73G 1PPJG 1BCCG 1SQXG 3L72G 1EZVG 3H1IG 1BGYG 1SQQG 1P84H 1KB9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC G;  3L71 G;  1SQB G;  3CX5 H;  3CXH H;  2IBZ G;  2A06 G;  3L75 G;  3H1H G;  3L70 G;  3H1L G;  1SQV G;  1NTM G;  1L0N G;  1SQP G;  2FYU G;  3H1K G;  3L74 G;  1NU1 G;  4U3F G;  4D6T G;  1BE3 G;  1L0L G;  2BCC G;  4PD4 H;  3TGU G;  1PP9 G;  3H1J G;  1KYO H;  1NTZ G;  1NTK G;  3CWB G;  5KLV G;  3L73 G;  1PPJ G;  1BCC G;  1SQX G;  3L72 G;  1EZV G;  3H1I G;  1BGY G;  1SQQ G;  1P84 H;  1KB9 H; 
#chains in the Genus database with same CATH topology
 3BAS A;  3MP7 B;  2BAS A;  1NKN A;  1URQ D;  1MKM A;  5KKZ B;  2OYH C;  5KAF E;  3CCE P;  3L74 G;  3HD7 B;  2C9L Y;  1LJ2 A;  3HD7 C;  2QJY B;  2A06 E;  3L73 G;  1Y8A A;  5CCH C;  1GD2 E;  2J58 A;  1OMI A;  3NMD A;  3OAK A;  1PL5 A;  2N9Y B;  1P84 I;  3AE3 C;  2NPS A;  1EZV E;  2OQQ A;  3WUU A;  1RH5 B;  4U3F J;  1SQX D;  5APX A;  3TNU B;  4A7P A;  3CX5 H;  1JMM A;  4WY4 C;  3M9B A;  1CI6 A;  2FYU G;  4IL6 X;  3H1J E;  1Q86 Q;  3MTU E;  4ZMD A;  3B8E B;  2FYN B;  2G3A A;  2Y0D A;  1ZW0 A;  1FZB A;  2DW3 A;  2FYN C;  2ZT9 D;  1HH0 A;  2OTL P;  3L71 D;  1NTZ K;  2W6A A;  1HWT C;  3D70 A;  5GTI E;  1W2B O;  5AW9 B;  3RBZ A;  1LTJ B;  1UIX A;  1JY2 O;  2W8Z A;  1T2K C;  3G6E P;  3A0H E;  1QLE D;  1OXZ A;  2Q6Q A;  1KIL B;  2IBZ D;  1FU1 A;  3LIE A;  3L75 D;  3I56 P;  1JEK A;  4R4L A;  1GL2 D;  1DEB A;  2D2C B;  1SQP J;  4RES B;  1BE3 G;  1RF0 A;  1OW7 A;  1S1C X;  1FS0 E;  2W90 A;  1LT1 A;  1R5L A;  1VQ6 P;  3L36 A;  4H44 B;  3V6I A;  1JTH A;  3L4F A;  2B9B A;  1HF9 A;  1WT6 A;  4GOD A;  1FZE A;  3WU2 E;  1K9M Q;  3BRT B;  3SWY A;  4DZO A;  2H43 A;  4CPG A;  1GW4 A;  1M1J B;  2Q1K A;  4WWI A;  2E74 B;  2J59 M;  3TGU G;  1AVY A;  3CL3 D;  3PH0 A;  5CCG C;  1DIP A;  2OYH B;  1VPC A;  2E74 C;  2HYN A;  1USE A;  2P67 A;  2ZVN B;  3C8V A;  1SQV D;  2PAJ A;  3PLN A;  2P58 A;  1VQ4 P;  4I7Z C;  1H0T A;  1NU1 J;  2YO3 A;  1YJN P;  1RF1 C;  2POH A;  4EYY Q;  1GMJ A;  2BCC E;  1NTK E;  1ZOY C;  2KS1 A;  3M91 A;  3V4W A;  2IZ0 A;  1EDL A;  1PP9 D;  3CWB D;  3H1I D;  2KNC A;  3ZDM A;  1KB9 H;  3PJS K;  2G8Y A;  2K37 A;  4PJ0 H;  1S9K E;  2M0B A;  3WMM 0;  4C7N B;  2Y9Y A;  1W2E A;  5DJU B;  1Q81 Q;  1PGP A;  3M0D A;  3CCL P;  1PGQ A;  4PV1 B;  3K5B A;  1OVU A;  2IYP A;  3HUS B;  3Q5S A;  1LP1 B;  1U7J A;  4PV1 C;  2B87 A;  1BCC J;  2WT7 B;  3HUS C;  2M5A B;  3IN6 A;  2OYO A;  4JBZ A;  4K3A A;  4PD4 E;  2K1A A;  2FXO A;  2HPC A;  1RQU A;  1NTZ G;  3H32 A;  1IJD B;  3AEF C;  1GTW A;  2AXT E;  1FDM A;  4XA4 A;  5GTH E;  1RE4 C;  5B5E H;  3CCR P;  1FZF A;  1YJW P;  2K9Y A;  2KZI A;  4IOI H;  3H1H J;  4LC1 A;  1PGO A;  3FGA D;  1M90 Q;  1JCC A;  1OW6 A;  1L0L D;  1SQP K;  3JCU E;  5AVT B;  1A02 J;  4N6J A;  1YJ9 P;  2ZFC A;  1X22 A;  4O9B A;  5B66 E;  2QJP C;  4BRY A;  4GOE A;  3G4S P;  1L2P A;  3L72 E;  1LNQ A;  3H1K J;  1P84 E;  2QG4 A;  4UB6 H;  1SQQ D;  2N1T D;  3H1L E;  2H89 C;  1BDC A;  4TT3 H;  2E76 C;  4C46 A;  3D6Y A;  2IX7 C;  1LTG C;  2NPS C;  1DD3 A;  2KP8 A;  1NTM J;  3SWK A;  5BU5 A;  2K3R A;  3AE5 C;  3EFG A;  5EFW B;  1UII A;  2P10 A;  1NU1 K;  1GDT A;  1NKZ B;  2E75 D;  3GW6 A;  4DOJ A;  1DD4 A;  3CME P;  3AE6 C;  4OGQ D;  3G9R A;  4D6T D;  1M57 D;  3CPW O;  2GUV A;  1BGY E;  2R5B A;  2WZ7 A;  1YYC A;  2WPV B;  2AEJ A;  1S72 P;  3L70 E;  1K05 A;  1EXI A;  5AW2 B;  4YTP C;  1E5W A;  4JYB A;  3VN0 A;  4HJG H;  4Y28 J;  3OJA B;  4U3F G;  4IL6 E;  3GG2 A;  5AW1 B;  2XND H;  1GZL A;  1SQB E;  1M8O B;  3QWO C;  3D6Z A;  1PGJ A;  2FKW B;  2R44 A;  2QRX A;  1ZR2 A;  3G3Z A;  1AQ5 A;  3VOP A;  1RF0 C;  1ZN5 A;  5BU8 B;  3QH9 A;  1N7S A;  3W67 A;  3JSV C;  3A3Y B;  3L74 E;  2RN0 A;  5KAI E;  1JY3 P;  4L75 A;  1L0N J;  1G2C A;  3L73 E;  1SLQ A;  4H13 B;  2JDI H;  3BRV B;  1WRG A;  4H13 C;  3MZW B;  3RL0 D;  2E5Y A;  2XV5 A;  5M1B A;  1H0T B;  5KTB A;  5KLV J;  3CXH D;  4H0L D;  2R3C A;  2Z4E A;  2K88 A;  1SQP G;  2ZYG A;  1KZU B;  2BEQ D;  1LTS C;  3RK2 D;  1ZXG A;  2JWA A;  2QE7 H;  2KS1 B;  2D2C D;  2ZYA A;  1OVR A;  2IDB A;  2FYU E;  5CMZ A;  3F89 A;  5C39 A;  1IK7 A;  4H44 D;  2W6J H;  1SFC D;  1NTM K;  1S3J A;  3AE8 C;  2ZXX A;  2E43 A;  1YIT P;  1G1I A;  3HRN A;  2A06 D;  1SQX J;  1URQ A;  4XE5 B;  2YNY A;  3M0D C;  1LWU A;  1NU1 G;  3NXS A;  3ABV C;  2R3S A;  2FFD A;  5BVZ A;  1EZV D;  3CD6 P;  1QL1 A;  1L4A D;  1EC5 A;  1VL2 A;  3L71 J;  3R2P A;  4RO0 A;  1BE3 E;  1Q90 D;  3EQ2 A;  4YPC A;  4W7Z A;  2OYI A;  2LKM A;  3H1J D;  3CLQ A;  2RH0 A;  1YI2 P;  1RE3 A;  2WMM A;  1M7L A;  1PV3 A;  2KIK A;  1ZR4 A;  3TGU E;  3L75 J;  2HOD B;  3PTZ A;  3KZI H;  4BRY B;  1DEE G;  3R4Y A;  1IC2 A;  1PPJ G;  1BCC G;  1R8E A;  1HVV A;  5KJ7 C;  3VP9 A;  1OX3 A;  1LT9 A;  2IFM A;  1KYO I;  2V4H A;  3MIW A;  2WSF H;  4JF7 A;  3M9H A;  1USD A;  3BAT A;  2HG5 D;  1HTL C;  2PP6 A;  3MGN A;  4I2L C;  2QJK B;  3KQG A;  1LTT C;  3FWL A;  1L0N K;  3GLM A;  3HE5 A;  2QJK C;  4HKZ H;  4JPZ B;  3AEC C;  1U57 A;  3GF7 A;  5E79 E;  2M3B A;  4WY4 B;  2Q3E A;  3RGU A;  3H1H G;  2Q7C A;  4GT1 A;  1JY2 P;  4HYT B;  1KMI Z;  1GL2 A;  3KPE A;  2CPB A;  1SQV J;  3H6P A;  1KQG B;  3A0B E;  4YXW H;  1S5L H;  2XKM A;  3B5N A;  4I6M C;  2JWD A;  3RK3 B;  1N86 A;  4L74 A;  3CI9 A;  2FXP A;  3RK3 C;  1KOR A;  3H1K G;  2Q5U A;  2Y9Z A;  2E42 A;  1HJ0 A;  1AA0 A;  3H25 A;  2HR3 A;  1PP9 J;  2ZAE B;  1WMK A;  5APU A;  3CWB J;  3VMZ A;  3MUD A;  3H1I J;  1SQX K;  2W6B A;  1MFT A;  1NTM G;  4MN4 C;  4UB6 E;  1NTZ E;  4DJG A;  1FAV A;  2BCC D;  3FWN A;  1NH4 A;  1NTK D;  5APS A;  1LTB C;  3B5N D;  2WQY C;  3E7K A;  2W83 C;  1YQ4 C;  3RK2 C;  2LXB A;  1N7S C;  1S9K D;  3CX5 I;  2VRS A;  1LTA C;  1HJB A;  2I1K A;  4TLF A;  1FDO A;  3KYQ A;  1KD1 Q;  1G2C B;  5AW0 B;  2XNX A;  2LR2 A;  4HB1 A;  4ZNC A;  1KQF B;  3AE2 C;  4I7Z B;  1VF5 D;  2BEZ F;  1DH3 A;  1U7M A;  2KXP B;  1Y9B A;  4NPE A;  1RF1 B;  3U1A A;  4PD4 D;  1VQP P;  3L37 A;  2MKV A;  1L0L J;  1GW3 A;  3CXH H;  3V4Q A;  1KFN A;  2WSF J;  3O6Q B;  2E5T A;  1ZP0 C;  1QVG O;  2WWW A;  2OGU A;  2A45 H;  2AEF A;  5APW A;  2KYV A;  1NWQ A;  1T8Z A;  1Y47 A;  1SQQ J;  3TF5 A;  1VQO P;  1L0N G;  3P8C E;  3V2R A;  1YQ3 C;  1SQV K;  5AVQ B;  1URQ B;  1XTC C;  4W80 A;  1IFP A;  3P32 A;  2YKO A;  3P8M C;  1URQ C;  5KLV G;  3L72 D;  1J1E C;  3O8Z A;  1LWU B;  1P84 D;  1JNM A;  1FZG A;  5KLI C;  4DCK A;  2CPS A;  1LWU C;  3H1L D;  3VYI A;  4U3F E;  1HBW A;  5CJ0 A;  3W68 A;  2WSC J;  3HE4 A;  2PRR A;  4D6T J;  3GMA A;  1IZN B;  4B86 A;  2N1T A;  4N78 E;  2OYI B;  4EIJ A;  1KFM A;  5AVW B;  2OYI C;  3I5C A;  2J5U A;  3AED C;  3CCM P;  1RE3 C;  1D7M A;  4M3L A;  2PGD A;  2IYO A;  4YXD C;  1SQX G;  1BGY D;  2QJP B;  1H89 A;  4U7J A;  3I55 P;  2WVR A;  3L70 D;  1KTM A;  1CZQ A;  1Q82 Q;  5CBN A;  1AVO A;  3OW2 O;  3A7O A;  2ZT9 B;  5GTI H;  1AJY A;  3GHG A;  3HTK A;  1KB9 I;  1KYO E;  2ZT9 C;  3MHV A;  3PP5 A;  2GM4 A;  4NPD A;  1W5C E;  2FBW C;  1LT9 C;  5AW4 B;  2E76 B;  3A0H H;  1SQP E;  1SQB D;  3L71 G;  1OIP A;  2NPS B;  3HE5 B;  1SS1 A;  2R5D A;  1OWA A;  3AEE C;  1ZRT E;  4OWF A;  2C0W A;  2LXC B;  5CJ4 A;  4UB8 E;  4WB4 A;  3S1K A;  2HLO A;  3M0A A;  1CI6 B;  1L0L K;  1IFD A;  1VQ7 P;  1GL2 C;  2IBZ G;  4OVN F;  1JM0 A;  3L75 G;  2KSJ A;  1KC8 Q;  1S2E A;  2ITA A;  5H2F E;  1OW8 A;  3WU2 H;  3L74 D;  3TNU A;  1JO5 A;  3B5N C;  3L73 D;  2YMY A;  1VQN P;  3OA7 A;  3HD7 D;  4BWN A;  2O01 H;  3B71 A;  1NU1 E;  1SQQ K;  1HGZ A;  5CCH D;  1OZH A;  2N9B A;  2WSS H;  2M8R A;  1N8R Q;  3JC2 2;  4ASV A;  3MUD C;  1LTJ A;  1JY3 N;  5AVU B;  4QMA A;  4Y99 B;  3AE7 C;  1RY3 A;  1SQV G;  2FYU D;  4Y99 C;  1BDD A;  3L35 A;  4WY4 D;  1KIL A;  1JTH B;  1NGM B;  1SQQ E;  1FZA A;  1PZQ A;  3CX5 E;  2K9J A;  4DT0 A;  4WVZ A;  2C0X A;  2XZR A;  1NHL A;  2WSE H;  3VMY A;  1G1J A;  3KXD A;  2YXQ B;  3U1C A;  1SFC A;  1PPJ E;  1BCC E;  3FXE A;  1PP9 G;  3CWB G;  5CHX A;  4JQ0 D;  2L5G B;  2Z5I A;  1IFJ A;  1T2K D;  3H1I G;  3H1J J;  1M1J A;  4KHX A;  5APY A;  3BCC J;  4GOF A;  1MFZ A;  1PIX A;  4OH8 B;  1KIL D;  1BE3 D;  2KZJ A;  4PD4 H;  1KQL A;  1NOH A;  1CW5 A;  3H1H E;  3C9I A;  1L4A A;  1YTZ I;  3SFD C;  5AW7 B;  1XTG B;  5GTH H;  1J2J B;  2KNC B;  1T3J A;  5AVV B;  2IBZ I;  1K8A Q;  1LGH B;  1GU5 A;  2HFE D;  2P7J A;  3TGU D;  4AUW A;  4KT0 J;  2ZJS E;  3KHU A;  3EWK A;  3Q5R A;  4W7Y A;  5CCG D;  5B66 H;  3H1K E;  2E74 D;  2YXR B;  1VQL P;  2NZ2 A;  2UWJ E;  1FE6 A;  1IK9 A;  2YKP A;  1BSH A;  3U59 A;  3RK3 E;  3CCS P;  2GA1 A;  1IO4 A;  2B87 B;  1L0L G;  4N3Y B;  1NJI Q;  3S4R A;  1P84 H;  1NTM E;  2FY8 A;  2ZVO B;  2HPC B;  3CCJ P;  3H32 B;  3RL0 g;  2WPQ A;  2O01 J;  5AW6 B;  1LP1 A;  2RMZ A;  3EFF K;  2WT7 A;  2N1T C;  1EDK A;  4EDF A;  1SQQ G;  1N73 A;  2WPS A;  3VTP C;  4GKG A;  5L8R J;  2E75 B;  1KV4 A;  1IFI A;  2I8D A;  4ZKU A;  2E75 C;  1KB9 E;  2BCC J;  2OAR A;  4PJ0 E;  1NTK J;  3GHG C;  4OGQ C;  2AEM A;  2Q3I A;  2WSE J;  5KKZ C;  5AW5 B;  4PV1 D;  2QEX P;  1NVO A;  4D6T G;  2YKQ A;  1NTZ D;  3T97 A;  2KSE A;  4IL6 H;  2C9N Y;  2B88 A;  2QJY C;  3C1L A;  5KLV K;  3NTN A;  2YMK A;  1T3U A;  4GIF A;  1FC2 C;  2KK7 A;  2KI7 B;  2JJL A;  1K73 Q;  3AE1 C;  1QVF O;  5B5E E;  1RHZ B;  1FBM A;  1J1D B;  1X79 B;  1L0N E;  2P2U A;  1J1D C;  1QGK B;  1ZV8 A;  4HH2 A;  4IFD K;  2WSC H;  5KAI H;  2Y0E A;  5KLV E;  3SSU A;  1SP4 A;  3BCC E;  3CCV P;  3WUV A;  5TIS H;  3Q1M A;  3IF4 A;  5AVR B;  1OFC X;  2O3J A;  2E76 D;  5APQ A;  2QA4 P;  3RL0 B;  1LTJ C;  1S5L X;  2NPS D;  4H0L B;  3RL0 C;  1A02 F;  4H0L C;  1FOS E;  1X9V A;  3L72 J;  1KIL C;  3RK2 B;  1N7S B;  2K9J B;  2O01 N;  3M06 A;  1FJP A;  1R5S A;  3H1L J;  3P8C D;  1SQX E;  1PFI A;  2D2C C;  2A45 G;  1SFC B;  2QIW A;  4H44 C;  4ZKP A;  1SFC C;  1FZC A;  1GK6 A;  1OVV A;  2JO1 A;  4L73 A;  1FDI A;  4U3F D;  3CCU P;  1M1J C;  3L71 E;  3AE9 C;  1VQ9 P;  2KOG A;  1NTK K;  3M9Q A;  2R32 A;  3CCQ P;  2A06 G;  1JMB A;  1BGY J;  1Q2N A;  1T6A A;  4N78 D;  2PFX A;  3AE4 C;  2O1K A;  3II6 A;  1L4A B;  5AW3 B;  3L70 J;  1QL2 A;  3FXD A;  3UIA A;  3V2P A;  1L4A C;  1JUN A;  2JKV A;  2QVA A;  2IBZ E;  2M3E A;  3L75 E;  1EZV G;  3RBX A;  1M1K Q;  1N2D C;  3KDP B;  2WTY A;  1SQB J;  1CSB A;  2IFN A;  5KAF H;  2V7Q H;  2GUS A;  3H1J G;  1KYO D;  1J1E B;  1YTZ T;  2CK3 H;  3CC2 P;  2W27 A;  1IFN A;  5KLI B;  4IFM A;  3BCC G;  1KN7 A;  4LGD E;  1HUC A;  3B4S A;  4RKU J;  4H13 D;  2SPZ A;  4EOT A;  2FFD B;  1SQP D;  3S9O A;  2FFD C;  3A2A A;  1ZRT D;  3L74 J;  2L91 A;  5APV A;  2OTJ P;  3USS A;  1EDJ A;  5AVZ B;  1SQV E;  3L73 J;  5E79 H;  2XDJ A;  2ZXE B;  1N73 B;  3CXH I;  3AEG C;  1N73 C;  1M56 D;  2B89 A;  1VQ8 P;  5AVX B;  3A0B H;  4BXL A;  1MZ9 A;  2MJZ A;  4EI2 A;  2A45 I;  3LW5 H;  1EXJ A;  3N7N A;  1PP9 E;  1NU1 D;  2JP3 A;  2NRG A;  3CWB E;  5TJH A;  1H8A A;  2OYH A;  3V2N A;  1LT9 B;  1VDF A;  2FYU J;  3WUT A;  3H1I E;  3E1R A;  5K5G B;  3VP8 A;  4ASW A;  2KUB A;  3HD7 A;  3CC7 P;  2HOD A;  4WBA A;  3D71 A;  3T97 B;  1K04 A;  5KJ7 A;  5CCH A;  1FOS F;  1ZME C;  4Z1M H;  4RJT A;  1NAY A;  1X8Y A;  3AEA C;  3VMX A;  1GL2 B;  3FX0 A;  3TK1 A;  1X0T A;  4NPF X;  3IFM A;  3CX5 D;  3PHL A;  4XFJ A;  1EZV I;  2FXM A;  1VQM P;  4WY4 A;  1DX7 A;  1JB0 J;  3B5N B;  1GU4 A;  2BCC G;  2QM7 A;  1NTK G;  2WIT A;  1PPJ D;  1BCC D;  1BE3 J;  1MV8 A;  4AYC A;  1RQV A;  1E79 H;  5KJ7 D;  2Q9I A;  1L0L E;  1SQB K;  3KZI E;  5DJT B;  5AVY B;  3LID A;  1H88 A;  2XU6 A;  1GK4 A;  1VF5 B;  2JEE A;  1FJK A;  1YHQ P;  4IFF A;  3TGU J;  2V7Q J;  1NO4 A;  1VQ5 P;  1VF5 C;  1VQK P;  1AV1 A;  3H1H D;  1YIJ P;  1NAF A;  3GF3 A;  1AFO A;  2Z5H A;  1SVF A;  4R4M A;  3TDK A;  3NFQ A;  5AW8 B;  2OTK E;  2WPR A;  1BSN A;  3BVH A;  3H1K D;  3E1I A;  3N4X A;  1AQT A;  3VMA A;  3Q2Y A;  1FZC B;  3RK3 D;  1S5L E;  4K35 A;  3ITK A;  1FZC C;  2IPP A;  4GDO A;  4AQR D;  1YBK A;  5CCG A;  1NTM D;  4D6T E;  3G71 P;  2H88 C;  2AXC A;  3Q3D A;  3MD0 A;  3SFE C;  1S4X A;  3LW5 J;  5TIS E;  3A5T A;  2FYU K;  2KLV A;  1QEX A;  4JYC A;  1MUU A;  1EDI A;  4LLH A;  3L72 G;  1HGV A;  1RF1 A;  1JCD A;  2YO2 A;  3H1L G;  1ZLL A;  2AXT H;  3CMA P;  1JY3 O;  3PRJ A;  4I1L A;  1N7S D;  3Q5P A;  3V5B A;  3JCU H;  1NTZ J;  2FYZ A;  3O6Q A;  1KB9 D;  2IZ1 A;  2YIU B;  3CC4 P;  4L76 A;  2YIU C;  2QM8 A;  3V2Q A;  5CBO A;  4C7R A;  5AVS B;  3F5H A;  1KYO H;  2QSI A;  2ZYD A;  1IFM A;  1JOC A;  2JR8 A;  4C7N A;  3IR9 A;  2H7H A;  1BGY G;  2RKL A;  3IAO A;  5APT A;  2Y0C A;  1LTI C;  2KB7 P;  3L70 G;  3HE4 B;  1Q7Y Q;  4KJM A;  3TSI A;  2N1T B;  3HUS A;  1Z56 A;  2KLU A;  1N7L A;  4UB8 H;  2M5A A;  3CXH E;  3SWF A;  1EQ7 A;  1TU3 F;  1SQB G;  4PD4 I;  1KQS O;  3P7K A;  1KIL E;  1NYH A;  1QX8 A;  2H8P D;  1L0N D;  2P1J A;  1RE4 A;  5H2F H;  1JY2 N;  5KLV D;  2O1J A;  3TYY A;  3GHG B;  3HTK B;  3AEB C;  4OGQ B;  3BCC D;  2I1J A; 
#chains in the Genus database with same CATH homology
 3BCC G;  3L71 G;  1SQB G;  3CX5 H;  3CXH H;  2IBZ G;  2A06 G;  3L75 G;  3H1H G;  3L70 G;  3H1L G;  1SQV G;  1NTM G;  1L0N G;  1SQP G;  2FYU G;  3H1K G;  3L74 G;  1NU1 G;  4U3F G;  4D6T G;  1BE3 G;  1L0L G;  2BCC G;  4PD4 H;  3TGU G;  1PP9 G;  3H1J G;  1KYO H;  1NTZ G;  1NTK G;  3CWB G;  5KLV G;  3L73 G;  1PPJ G;  1BCC G;  1SQX G;  3L72 G;  1EZV G;  3H1I G;  1BGY G;  1SQQ G;  1P84 H;  1KB9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...