1BE3G

Cytochrome bc1 complex from bovine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1be3G00
1P84H 3H1LG 3CXHH 3L75G 1NTKG 1PPJG 3BCCG 1NTZG 1SQXG 2IBZG 1PP9G 5KLVG 1BCCG 1L0NG 1L0LG 3L74G 3H1HG 2A06G 1KB9H 3H1KG 3H1IG 1BGYG 1SQQG 4U3FG 3H1JG 3TGUG 4D6TG 2FYUG 1BE3G 1SQVG 3L72G 3L73G 3L70G 4PD4H 2BCCG 3CWBG 1SQPG 1SQBG 1EZVG 1NTMG 3L71G 1NU1G 3CX5H 1KYOH
chains in the Genus database with same CATH superfamily
1SLQA 2YMKA 4RKUJ 3H1IJ 2QRXA 2E76B 5AW5B 3FX0A 3PRJA 5EFWB 2FYNC 2Q9IA 1BE3D 1DH3A 2I1JA 2RKLA 1LT1A 1RF1C 3PHLA 1SQQK 2FYNB 1RE4A 4ZMDA 1OXZA 1KORA 1J1EB 5E79H 2FXMA 1LTTC 3AECC 3MP7B 3CX5D 1VQ7P 2E75C 3H1LJ 2Q3EA 4AUWA 1OX3A 1KTMA 2FYUE 4ASVA 4EI2A 1VQKP 4UB8H 1GDTA 2AEMA 2E74C 2ZJSE 1KYOI 1YJNP 1T3UA 2AXCA 3M0DC 3V2QA 2Y0EA 2OYIA 3A2AA 4H44C 2KNCA 3L70D 5AVXB 2QJPC 1NOHA 3K5BA 1OVRA 3RBZA 2UWJE 3L73J 4H13C 1PP9G 1M7LA 1N8RQ 5AVQB 1PL5A 2HPCB 1PFIA 2O01N 2ZXXA 1M1JA 1AVOA 1JO5A 3P8MC 1SQXE 1JY2N 1RF0A 3A0BE 3IAOA 1VL2A 1SQPG 5KJ7C 2FFDA 1IK9A 2WT7A 4U3FJ 5CCHA 4PD4D 3H1LE 1K8AQ 4LC1A 2P2UA 3FWLA 1VQ9P 1AQTA 3W67A 3KZIH 1Y9BA 3VYIA 1BE3G 2B87A 1OWAA 1HGVA 5AW2B 2JEEA 1YIJP 1X0TA 1X9VA 2HYNA 1CZQA 4TT3H 5BVZA 2C0XA 2IYPA 1IFNA 3AE4C 2YKQA 1NAYA 3Q2YA 2PGDA 3UIAA 2N1TD 1GL2C 4N6JA 3MTUE 3PP5A 1VQ5P 2LKMA 3L70G 3V4WA 1IFDA 1S2EA 1FZEA 2OTKE 3M9HA 4Y99C 5APXA 1VPCA 3GG2A 4PJ0H 1NU1J 1AFOA 3A5TA 3L72D 1VQ8P 3P8CE 1AVYA 3ZDMA 1K9MQ 3H1HJ 1M90Q 5AW7B 3CCEP 3I55P 1CW5A 1JY3N 2GUSA 4RO0A 1VF5C 3OA7A 3GLMA 4W7ZA 1FE6A 3H32B 4ZKUA 1EZVI 1NO4A 1X79B 3LIEA 1MV8A 3L75J 2N1TB 5AW9B 2WVRA 1NTMD 1NGMB 1IFIA 5AVZB 2ZAEB 1N73A 1VQLP 4C7RA 1QGKB 1HUCA 2IX7C 1FZCC 1JOCA 2KSEA 3FXEA 4MN4C 2XDJA 2KK7A 4UB8E 3VOPA 2HLOA 2B88A 5AVYB 4ZNCA 5AVWB 3GF7A 1TU3F 3V4QA 4Y28J 3H1JJ 1HJBA 3RK2D 5APSA 1LTJA 1URQA 1LWUC 2A45I 2XKMA 3U1CA 3T97B 2M3BA 1L0LJ 4KHXA 1KN7A 1N7LA 3CXHI 5AVRB 3BCCE 4I6MC 3ABVC 1D7MA 1UIXA 3H1HE 3JCUE 5KAIH 3AE7C 2XNDH 3GHGB 3O8ZA 3LW5H 4GKGA 3U1AA 2J59M 3F89A 3M06A 1NTKD 1BGYJ 2YMYA 2KP8A 3TSIA 1QVGO 2FBWC 3EWKA 2WITA 3MUDA 1LP1B 3L72G 3RK2B 1GMJA 3RL0g 3WUTA 2WZ7A 1L0NJ 1ZRTD 1JNMA 3VMAA 1FOSF 1Q81Q 1FZGA 2XV5A 5C39A 3KZIE 1RY3A 1JMBA 2QVAA 1FZAA 5TJHA 3L71J 3CL3D 4R4LA 3RBXA 4XFJA 4H0LD 3HE4B 4C7NA 2KLUA 3L36A 1EZVD 2IDBA 3H1JE 1BCCJ 2LXCB 1NTMG 1ZMEC 1KQLA 2PP6A 1NWQA 1LNQA 1IZNB 1GU5A 1OVUA 3H1KD 2C9NY 2K9JA 2WSFJ 1CI6A 4I7ZB 1PGJA 1EDIA 1OMIA 3M91A 1S5LH 1HF9A 1W5CE 5B66H 2CPBA 3MHVA 3VTPC 1W2EA 1QX8A 3A0BH 4H0LB 1EXIA 4D6TJ 4PJ0E 3TDKA 4OGQD 2P1JA 2V7QH 3JC22 1AV1A 3HTKA 2KNCB 1L0NE 2ZT9D 2Z4EA 2Q5UA 3SFDC 4EIJA 5APUA 1U7JA 3HE5A 5KLVJ 4BWNA 1FZCA 3R4YA 3VN0A 1EQ7A 3L71E 1NTKG 3HUSA 1SQXD 1DIPA 2Q3IA 4YXWH 1FZFA 3M9QA 1ZLLA 1DEBA 3CD6P 1BCCE 1NVOA 3AEEC 2KS1A 1P84H 1FJPA 3B4SA 1LWUA 1N7SC 5KKZC 4OVNF 4WY4D 2QJYB 2W6JH 1X8YA 4U7JA 4OGQB 5CCGC 1K73Q 1J1DB 4EYYQ 1ZR4A 1IK7A 2BCCD 2W27A 2ZT9B 2M3EA 3TGUE 1EZVG 2WPVB 1IFPA 1BDCA 1L4AC 1X22A 5CJ4A 2H88C 1SQVJ 2IBZE 3WUVA 5AW0B 3H1KG 2B87B 1PGPA 1IC2A 3SWKA 3CWBD 1HVVA 1MZ9A 1U57A 2E76C 3KQGA 4GT1A 4WY4C 3P32A 2G8YA 5KAIE 5KLVE 3RK3E 4WY4B 1N86A 1KB9H 3GMAA 2BEQD 1J1EC 1GK6A 2Y9ZA 3NMDA 3VMZA 2O1JA 2A45G 1EDJA 1RQVA 1DX7A 5M1BA 1ZV8A 3P8CD 2V7QJ 2FY8A 1SS1A 5APQA 3B8EB 1YITP 1S9KE 4R4MA 1HBWA 1PPJG 1SQXG 1Y8AA 3Q5SA 5CMZA 2KB7P 1KZUB 1KILD 2DW3A 1OW7A 1H0TB 2YO2A 3P7KA 2XU6A 5KAFE 1SQVE 3IR9A 2OYHB 3HD7A 5AVVB 2P10A 1E5WA 1URQD 3C8VA 1HJ0A 1T6AA 3BRVB 5CBOA 1KC8Q 2P67A 1JY3P 2BCCG 3H1IE 1N73B 1GW4A 3JCUH 2ZVOB 3IN6A 4BRYA 1KILC 2NPSA 3C1LA 3TNUA 1S1CX 1S5LE 1SQPJ 5B66E 2ZXEB 1KILB 1GU4A 4JF7A 3CWBG 3BVHA 3KPEA 1SFCA 3BCCD 1R5LA 3O6QA 1BE3J 3L4FA 2R44A 4Z1MH 1YBKA 1LTJB 2BASA 1URQB 1YJWP 4BXLA 3RL0D 1N7SA 1FAVA 4RJTA 2FKWB 1T2KD 3FGAD 3W68A 4GDOA 1LT9A 4YXDC 1SQQJ 2QIWA 3AE3C 3CLQA 3M9BA 1L4AA 5AVUB 2G3AA 4UB6E 2A06E 1P84E 2RH0A 1VQPP 5GTHE 3TF5A 1PIXA 4K3AA 1N2DC 1NH4A 3L73E 1LTSC 1KYOH 1KQGB 1G2CB 1G1JA 2M5AA 5AW8B 3KDPB 3L70J 3H1JD 2ZYDA 1E79H 5B5EH 3NTNA 3L37A 1JEKA 1R8EA 2W83C 3RL0B 5AW3B 4OH8B 3Q3DA 3MD0A 4A7PA 1SQBK 2JKVA 1AA0A 3V2PA 1RF1A 3D70A 2KSJA 2Q7CA 1YTZI 4C7NB 4JBZA 1SQBD 1JMMA 4U3FE 1EC5A 2KZIA 2PRRA 2L5GB 3B5ND 1XTCC 2QG4A 1NTMK 2E43A 5TISH 1KB9E 4YPCA 2N1TC 1RE3C 3KHUA 3VMXA 2FYZA 3BRTB 1IO4A 3CX5E 2QE7H 1HH0A 3WMM0 5APYA 1M8OB 1SQQE 1FS0E 3M0DA 1AJYA 4KJMA 2OTJP 2MJZA 2K88A 3BCCG 1ZN5A 2JJLA 1YTZT 2K9YA 2H43A 3LIDA 2KIKA 1NHLA 4IFMA 1KV4A 3EFGA 3TYYA 3B5NC 2WSFH 1YQ4C 1WT6A 3B5NB 1WRGA 1NTZK 3KYQA 3VP9A 3HE5B 2FXOA 3AE1C 2GUVA 1AQ5A 3E1RA 2KYVA 1NTZD 1NU1E 1YQ3C 2QM7A 4HYTB 1FDIA 1IFMA 3GHGC 1NTKK 5KJ7A 3TGUD 1A02J 1Q86Q 3H1JG 2YIUB 1JTHB 1S5LX 2KS1B 3CMEP 2XZRA 1U7MA 3CCUP 2IPPA 2HODB 1Q2NA 1EDLA 3RK2C 3JSVC 3L75E 2QJKB 3L74D 1LTBC 4PD4E 1S72P 2ZVNB 1LGHB 4N78E 1SQBG 4GOFA 4RESB 3H25A 4DJGA 5KLVD 3RK3D 1QLED 1PV3A 1YI2P 1CSBA 2FXPA 2HR3A 2FYUK 2JP3A 1GL2A 3AEAC 1BDDA 3WUUA 5KAFH 2LR2A 4M3LA 3CCRP 1VQ4P 1BSNA 1MKMA 1S9KD 2FYUD 3AE5C 3C9IA 3HD7D 1L0LE 1EDKA 2OTLP 1KYOE 4I7ZC 5APVA 1ZP0C 3AE2C 1DD4A 1GTWA 2M0BA 4W7YA 1WMKA 3RK3B 5B5EE 2A45H 4IL6H 2IFMA 3WU2H 1KFMA 3H32A 4H0LC 3FWNA 1SQVD 1JY3O 1RE3A 4WBAA 1BGYE 2NPSD 1SP4A 4PV1B 2OYIC 1JUNA 4GOEA 3SWFA 2VRSA 3CXHH 4OWFA 1NTZG 3OJAB 3CCJP 2OYIB 1KFNA 3ITKA 1SQXK 2YKPA 3H1ID 1JB0J 1EXJA 3TGUG 3CC7P 1NTKJ 1SFCD 4IFFA 1L2PA 1FDMA 5CCHD 3HD7B 1VQMP 1OW8A 5KTBA 5TISE 3V6IA 2ZFCA 3G9RA 3QWOC 3CCMP 4DCKA 3SWYA 1H88A 2QA4P 2Y9YA 2OYOA 3L74G 5AW1B 5H2FH 2OARA 4K35A 3A3YB 2QJYC 1USDA 4BRYB 3H1LD 4NPEA 2HG5D 4OGQC 1RF0C 4UB6H 3V2NA 3R2PA 5GTHH 1M1JB 2NPSB 4L76A 2C9LY 2AEFA 1J1DC 3PJSK 3E1IA 2ZT9C 1KMIZ 3GW6A 3AEGC 3L35A 1QL1A 2FFDB 1SFCB 1JY2P 2KLVA 1MFZA 2WT7B 2AEJA 3H1KJ 2BEZF 2JWAA 3S1KA 4JYCA 1K04A 2A06D 3G3ZA 3PLNA 2WSEJ 3L73D 1ZW0A 2FYUG 4QMAA 1LP1A 4D6TE 4I1LA 2PAJA 5APTA 1LT9B 4LLHA 2WWWA 3PTZA 5DJTB 3MGNA 2YO3A 2WPSA 2PFXA 2E75D 5AW4B 3V2RA 3Q1MA 1SQVG 2Y0CA 3QH9A 3S9OA 2ITAA 2H7HA 4GIFA 3HE4A 2JO1A 3CX5H 3NFQA 2M5AB 3CCVP 2ZYAA 2E74D 1ZRTE 2AXTE 1QL2A 5AVTB 1M57D 4U3FD 4HH2A 2KUBA 5CBNA 1MFTA 3H1IG 3VP8A 1SQXJ 4H44D 2P7JA 1HTLC 1KB9D 4W80A 1EZVE 1RF1B 3IFMA 1NJIQ 1VQNP 5CJ0A 2GM4A 4H13D 2R32A 2Q6QA 1SQQD 2OYHC 2OGUA 3H1KE 4I2LC 1Y47A 5AVSB 2E75B 1PP9J 2KOGA 3H1LG 3MZWB 3AEDC 1FBMA 2JDIH 1JM0A 2BCCJ 2I8DA 1N73C 4JYBA 2E74B 2IZ0A 3D6ZA 4NPDA 2YXQB 1QEXA 3G71P 5KJ7D 4H44B 4ZKPA 1NU1K 4IL6E 3WU2E 2H8PD 2QJPB 4B86A 2WMMA 5K5GB 1FU1A 1RHZB 3CWBJ 3Q5PA 3Q5RA 2A06G 2N9BA 4H13B 3L73G 1OFCX 1HWTC 1R5SA 4PD4H 2B9BA 3CXHE 1T3JA 1NU1D 3I56P 1LJ2A 1LTJC 1URQC 4WVZA 2J58A 4L75A 1FC2C 1PPJE 3HRNA 3H1HD 2Z5IA 2LXBA 3A0HH 5AW6B 5GTIH 1S3JA 3D71A 1FDOA 2I1KA 2Q1KA 3L75D 5CCGA 4O9BA 3NXSA 5H2FE 3CCQP 4N78D 1PP9E 4U3FG 3CCLP 1GL2D 3V5BA 4IOIH 2IYOA 2BCCE 4ASWA 2RMZA 4HJGH 3MUDC 2QM8A 3AEBC 2K1AA 2C0WA 3AE6C 4DOJA 3RL0C 4AYCA 2YNYA 4WY4A 2Y0DA 1SQQG 1GD2E 1L0LK 4WWIA 1T2KC 1ZXGA 2IBZI 3CWBE 1FJKA 1OIPA 1SQPE 2IFNA 3A7OA 3OW2O 1L0LD 1KD1Q 1KYOD 2ZYGA 1VF5D 3KXDA 2N9YB 1GL2B 1BE3E 3II6A 1IJDB 2W90A 1VQ6P 2W8ZA 3OAKA 2K9JB 2WTYA 1BGYD 4Y99B 1L0NK 1W2BO 3BCCJ 2IZ1A 1H0TA 1VDFA 1Q90D 2E42A 1NKZB 1NU1G 1CI6B 2GA1A 2OYHA 1NYHA 2R3CA 1YHQP 2YKOA 4EDFA 1L0ND 3BATA 4YTPC 1IFJA 2JR8A 2W6AA 1H8AA 3H1HG 1YJ9P 1UIIA 2QSIA 2WSSH 2HPCA 1KILE 1VF5B 2R5BA 1K05A 3SFEC 2O3JA 3L71D 5E79E 1J2JB 1KQFB 2K3RA 3L70E 2KI7B 3L75G 1A02F 2QEXP 1Z56A 1BCCD 4TLFA 3HTKB 5BU8B 2NRGA 3HUSC 3PH0A 1KQSO 4DZOA 3H6PA 1FZCB 1KILA 1JCCA 3HUSB 1JY2O 2J5UA 4CPGA 2YIUC 1JCDA 5CHXA 1YYCA 3RGUA 3I5CA 4IL6X 3GF3A 3SSUA 3CPWO 1PGQA 2P58A 2QJKC 2E5YA 1LWUB 1M56D 4GODA 2IBZD 3U59A 3G6EP 3L72J 2CPSA 2MKVA 4C46A 1L0LG 1SQBJ 3CC4P 5KLVK 4D6TD 2AXTH 1Q7YQ 1M1KQ 3CCSP 1HGZA 1LTIC 3N4XA 3S4RA 2YXRB 3D6YA 2R5DA 3E7KA 3AE9C 2WQYC 2POHA 1OVVA 1G2CA 1DEEG 1H89A 3TK1A 3A0HE 1GZLA 1ZOYC 5GTIE 2WSCH 1NTMJ 1BGYG 2O01H 2RN0A 4PV1D 2D2CD 3EQ2A 4IFDK 4JPZB 1P84I 4XA4A 1L0NG 3USSA 2WSEH 1RE4C 3CMAP 4L73A 3L71G 1RH5B 1SQVK 3RK3C 3CI9A 1RQUA 4KT0J 1BCCG 4L74A 4PV1C 1OZHA 4HKZH 3AE8C 2D2CC 4JQ0D 1MUUA 3BASA 1NTZJ 4N3YB 3B71A 2N1TA 4NPFX 3L72E 1T8ZA 2D2CB 1SQBE 5BU5A 5L8RJ 3TGUJ 1NAFA 3HD7C 5APWA 4LGDE 3N7NA 1KB9I 2H89C 2E5TA 3M0AA 2JWDA 3EFFK 3L74J 1SVFA 3CX5I 1QVFO 1NTME 5KLIC 2IBZG 1N7SD 3B5NA 3CXHD 5DJUB 4AQRD 4D6TG 5KLIB 5CCGD 1M1JC 2KXPB 2NPSC 1G1IA 1USEA 3LW5J 3T97A 1PPJD 1DD3A 1L4AD 5KLVG 3TNUB 2FFDC 4HB1A 1SFCC 2WSCJ 2NZ2A 5CCHC 2O01J 1BSHA 1JTHA 3CC2P 2OQQA 2O1KA 1LTGC 2L91A 1Q82Q 4XE5B 3GHGA 1LTAC 1NKNA 2Z5HA 3MIWA 2E76D 3O6QB 1S4XA 1VQOP 4WB4A 1PP9D 1FOSE 2FYUJ 1OW6A 2HODA 2HFED 1NTZE 2B89A 2XNXA 2W6BA 3F5HA 1ZR2A 1N7SB 1P84D 5KKZB 1LT9C 1GK4A 4EOTA 3IF4A 2V4HA 2KZJA 1PZQA 2R3SA 1SQPK 4DT0A 1FZBA 3FXDA 2M8RA 2WPRA 1PGOA 2SPZA 1NTKE 3AEFC 1L4AB 3G4SP 2CK3H 3VMYA 3L74E 2K37A 2WPQA 1XTGB 1SQPD 4PD4I 1GW3A
chains in the Genus database with same CATH topology
1P84H 3H1LG 3CXHH 3L75G 1NTKG 1PPJG 3BCCG 1NTZG 1SQXG 2IBZG 1PP9G 5KLVG 1BCCG 1L0NG 1L0LG 3L74G 3H1HG 2A06G 1KB9H 3H1KG 3H1IG 1BGYG 1SQQG 4U3FG 3H1JG 3TGUG 4D6TG 2FYUG 1BE3G 1SQVG 3L72G 3L73G 3L70G 4PD4H 2BCCG 3CWBG 1SQPG 1SQBG 1EZVG 1NTMG 3L71G 1NU1G 3CX5H 1KYOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 H;  3H1L G;  3CXH H;  3L75 G;  1NTK G;  1PPJ G;  3BCC G;  1NTZ G;  1SQX G;  2IBZ G;  1PP9 G;  5KLV G;  1BCC G;  1L0N G;  1L0L G;  3L74 G;  3H1H G;  2A06 G;  1KB9 H;  3H1K G;  3H1I G;  1BGY G;  1SQQ G;  4U3F G;  3H1J G;  3TGU G;  4D6T G;  2FYU G;  1BE3 G;  1SQV G;  3L72 G;  3L73 G;  3L70 G;  4PD4 H;  2BCC G;  3CWB G;  1SQP G;  1SQB G;  1EZV G;  1NTM G;  3L71 G;  1NU1 G;  3CX5 H;  1KYO H; 
#chains in the Genus database with same CATH topology
 1SLQ A;  2YMK A;  4RKU J;  3H1I J;  2QRX A;  2E76 B;  5AW5 B;  3FX0 A;  3PRJ A;  5EFW B;  2FYN C;  2Q9I A;  1BE3 D;  1DH3 A;  2I1J A;  2RKL A;  1LT1 A;  1RF1 C;  3PHL A;  1SQQ K;  2FYN B;  1RE4 A;  4ZMD A;  1OXZ A;  1KOR A;  1J1E B;  5E79 H;  2FXM A;  1LTT C;  3AEC C;  3MP7 B;  3CX5 D;  1VQ7 P;  2E75 C;  3H1L J;  2Q3E A;  4AUW A;  1OX3 A;  1KTM A;  2FYU E;  4ASV A;  4EI2 A;  1VQK P;  4UB8 H;  1GDT A;  2AEM A;  2E74 C;  2ZJS E;  1KYO I;  1YJN P;  1T3U A;  2AXC A;  3M0D C;  3V2Q A;  2Y0E A;  2OYI A;  3A2A A;  4H44 C;  2KNC A;  3L70 D;  5AVX B;  2QJP C;  1NOH A;  3K5B A;  1OVR A;  3RBZ A;  2UWJ E;  3L73 J;  4H13 C;  1PP9 G;  1M7L A;  1N8R Q;  5AVQ B;  1PL5 A;  2HPC B;  1PFI A;  2O01 N;  2ZXX A;  1M1J A;  1AVO A;  1JO5 A;  3P8M C;  1SQX E;  1JY2 N;  1RF0 A;  3A0B E;  3IAO A;  1VL2 A;  1SQP G;  5KJ7 C;  2FFD A;  1IK9 A;  2WT7 A;  4U3F J;  5CCH A;  4PD4 D;  3H1L E;  1K8A Q;  4LC1 A;  2P2U A;  3FWL A;  1VQ9 P;  1AQT A;  3W67 A;  3KZI H;  1Y9B A;  3VYI A;  1BE3 G;  2B87 A;  1OWA A;  1HGV A;  5AW2 B;  2JEE A;  1YIJ P;  1X0T A;  1X9V A;  2HYN A;  1CZQ A;  4TT3 H;  5BVZ A;  2C0X A;  2IYP A;  1IFN A;  3AE4 C;  2YKQ A;  1NAY A;  3Q2Y A;  2PGD A;  3UIA A;  2N1T D;  1GL2 C;  4N6J A;  3MTU E;  3PP5 A;  1VQ5 P;  2LKM A;  3L70 G;  3V4W A;  1IFD A;  1S2E A;  1FZE A;  2OTK E;  3M9H A;  4Y99 C;  5APX A;  1VPC A;  3GG2 A;  4PJ0 H;  1NU1 J;  1AFO A;  3A5T A;  3L72 D;  1VQ8 P;  3P8C E;  1AVY A;  3ZDM A;  1K9M Q;  3H1H J;  1M90 Q;  5AW7 B;  3CCE P;  3I55 P;  1CW5 A;  1JY3 N;  2GUS A;  4RO0 A;  1VF5 C;  3OA7 A;  3GLM A;  4W7Z A;  1FE6 A;  3H32 B;  4ZKU A;  1EZV I;  1NO4 A;  1X79 B;  3LIE A;  1MV8 A;  3L75 J;  2N1T B;  5AW9 B;  2WVR A;  1NTM D;  1NGM B;  1IFI A;  5AVZ B;  2ZAE B;  1N73 A;  1VQL P;  4C7R A;  1QGK B;  1HUC A;  2IX7 C;  1FZC C;  1JOC A;  2KSE A;  3FXE A;  4MN4 C;  2XDJ A;  2KK7 A;  4UB8 E;  3VOP A;  2HLO A;  2B88 A;  5AVY B;  4ZNC A;  5AVW B;  3GF7 A;  1TU3 F;  3V4Q A;  4Y28 J;  3H1J J;  1HJB A;  3RK2 D;  5APS A;  1LTJ A;  1URQ A;  1LWU C;  2A45 I;  2XKM A;  3U1C A;  3T97 B;  2M3B A;  1L0L J;  4KHX A;  1KN7 A;  1N7L A;  3CXH I;  5AVR B;  3BCC E;  4I6M C;  3ABV C;  1D7M A;  1UIX A;  3H1H E;  3JCU E;  5KAI H;  3AE7 C;  2XND H;  3GHG B;  3O8Z A;  3LW5 H;  4GKG A;  3U1A A;  2J59 M;  3F89 A;  3M06 A;  1NTK D;  1BGY J;  2YMY A;  2KP8 A;  3TSI A;  1QVG O;  2FBW C;  3EWK A;  2WIT A;  3MUD A;  1LP1 B;  3L72 G;  3RK2 B;  1GMJ A;  3RL0 g;  3WUT A;  2WZ7 A;  1L0N J;  1ZRT D;  1JNM A;  3VMA A;  1FOS F;  1Q81 Q;  1FZG A;  2XV5 A;  5C39 A;  3KZI E;  1RY3 A;  1JMB A;  2QVA A;  1FZA A;  5TJH A;  3L71 J;  3CL3 D;  4R4L A;  3RBX A;  4XFJ A;  4H0L D;  3HE4 B;  4C7N A;  2KLU A;  3L36 A;  1EZV D;  2IDB A;  3H1J E;  1BCC J;  2LXC B;  1NTM G;  1ZME C;  1KQL A;  2PP6 A;  1NWQ A;  1LNQ A;  1IZN B;  1GU5 A;  1OVU A;  3H1K D;  2C9N Y;  2K9J A;  2WSF J;  1CI6 A;  4I7Z B;  1PGJ A;  1EDI A;  1OMI A;  3M91 A;  1S5L H;  1HF9 A;  1W5C E;  5B66 H;  2CPB A;  3MHV A;  3VTP C;  1W2E A;  1QX8 A;  3A0B H;  4H0L B;  1EXI A;  4D6T J;  4PJ0 E;  3TDK A;  4OGQ D;  2P1J A;  2V7Q H;  3JC2 2;  1AV1 A;  3HTK A;  2KNC B;  1L0N E;  2ZT9 D;  2Z4E A;  2Q5U A;  3SFD C;  4EIJ A;  5APU A;  1U7J A;  3HE5 A;  5KLV J;  4BWN A;  1FZC A;  3R4Y A;  3VN0 A;  1EQ7 A;  3L71 E;  1NTK G;  3HUS A;  1SQX D;  1DIP A;  2Q3I A;  4YXW H;  1FZF A;  3M9Q A;  1ZLL A;  1DEB A;  3CD6 P;  1BCC E;  1NVO A;  3AEE C;  2KS1 A;  1P84 H;  1FJP A;  3B4S A;  1LWU A;  1N7S C;  5KKZ C;  4OVN F;  4WY4 D;  2QJY B;  2W6J H;  1X8Y A;  4U7J A;  4OGQ B;  5CCG C;  1K73 Q;  1J1D B;  4EYY Q;  1ZR4 A;  1IK7 A;  2BCC D;  2W27 A;  2ZT9 B;  2M3E A;  3TGU E;  1EZV G;  2WPV B;  1IFP A;  1BDC A;  1L4A C;  1X22 A;  5CJ4 A;  2H88 C;  1SQV J;  2IBZ E;  3WUV A;  5AW0 B;  3H1K G;  2B87 B;  1PGP A;  1IC2 A;  3SWK A;  3CWB D;  1HVV A;  1MZ9 A;  1U57 A;  2E76 C;  3KQG A;  4GT1 A;  4WY4 C;  3P32 A;  2G8Y A;  5KAI E;  5KLV E;  3RK3 E;  4WY4 B;  1N86 A;  1KB9 H;  3GMA A;  2BEQ D;  1J1E C;  1GK6 A;  2Y9Z A;  3NMD A;  3VMZ A;  2O1J A;  2A45 G;  1EDJ A;  1RQV A;  1DX7 A;  5M1B A;  1ZV8 A;  3P8C D;  2V7Q J;  2FY8 A;  1SS1 A;  5APQ A;  3B8E B;  1YIT P;  1S9K E;  4R4M A;  1HBW A;  1PPJ G;  1SQX G;  1Y8A A;  3Q5S A;  5CMZ A;  2KB7 P;  1KZU B;  1KIL D;  2DW3 A;  1OW7 A;  1H0T B;  2YO2 A;  3P7K A;  2XU6 A;  5KAF E;  1SQV E;  3IR9 A;  2OYH B;  3HD7 A;  5AVV B;  2P10 A;  1E5W A;  1URQ D;  3C8V A;  1HJ0 A;  1T6A A;  3BRV B;  5CBO A;  1KC8 Q;  2P67 A;  1JY3 P;  2BCC G;  3H1I E;  1N73 B;  1GW4 A;  3JCU H;  2ZVO B;  3IN6 A;  4BRY A;  1KIL C;  2NPS A;  3C1L A;  3TNU A;  1S1C X;  1S5L E;  1SQP J;  5B66 E;  2ZXE B;  1KIL B;  1GU4 A;  4JF7 A;  3CWB G;  3BVH A;  3KPE A;  1SFC A;  3BCC D;  1R5L A;  3O6Q A;  1BE3 J;  3L4F A;  2R44 A;  4Z1M H;  1YBK A;  1LTJ B;  2BAS A;  1URQ B;  1YJW P;  4BXL A;  3RL0 D;  1N7S A;  1FAV A;  4RJT A;  2FKW B;  1T2K D;  3FGA D;  3W68 A;  4GDO A;  1LT9 A;  4YXD C;  1SQQ J;  2QIW A;  3AE3 C;  3CLQ A;  3M9B A;  1L4A A;  5AVU B;  2G3A A;  4UB6 E;  2A06 E;  1P84 E;  2RH0 A;  1VQP P;  5GTH E;  3TF5 A;  1PIX A;  4K3A A;  1N2D C;  1NH4 A;  3L73 E;  1LTS C;  1KYO H;  1KQG B;  1G2C B;  1G1J A;  2M5A A;  5AW8 B;  3KDP B;  3L70 J;  3H1J D;  2ZYD A;  1E79 H;  5B5E H;  3NTN A;  3L37 A;  1JEK A;  1R8E A;  2W83 C;  3RL0 B;  5AW3 B;  4OH8 B;  3Q3D A;  3MD0 A;  4A7P A;  1SQB K;  2JKV A;  1AA0 A;  3V2P A;  1RF1 A;  3D70 A;  2KSJ A;  2Q7C A;  1YTZ I;  4C7N B;  4JBZ A;  1SQB D;  1JMM A;  4U3F E;  1EC5 A;  2KZI A;  2PRR A;  2L5G B;  3B5N D;  1XTC C;  2QG4 A;  1NTM K;  2E43 A;  5TIS H;  1KB9 E;  4YPC A;  2N1T C;  1RE3 C;  3KHU A;  3VMX A;  2FYZ A;  3BRT B;  1IO4 A;  3CX5 E;  2QE7 H;  1HH0 A;  3WMM 0;  5APY A;  1M8O B;  1SQQ E;  1FS0 E;  3M0D A;  1AJY A;  4KJM A;  2OTJ P;  2MJZ A;  2K88 A;  3BCC G;  1ZN5 A;  2JJL A;  1YTZ T;  2K9Y A;  2H43 A;  3LID A;  2KIK A;  1NHL A;  4IFM A;  1KV4 A;  3EFG A;  3TYY A;  3B5N C;  2WSF H;  1YQ4 C;  1WT6 A;  3B5N B;  1WRG A;  1NTZ K;  3KYQ A;  3VP9 A;  3HE5 B;  2FXO A;  3AE1 C;  2GUV A;  1AQ5 A;  3E1R A;  2KYV A;  1NTZ D;  1NU1 E;  1YQ3 C;  2QM7 A;  4HYT B;  1FDI A;  1IFM A;  3GHG C;  1NTK K;  5KJ7 A;  3TGU D;  1A02 J;  1Q86 Q;  3H1J G;  2YIU B;  1JTH B;  1S5L X;  2KS1 B;  3CME P;  2XZR A;  1U7M A;  3CCU P;  2IPP A;  2HOD B;  1Q2N A;  1EDL A;  3RK2 C;  3JSV C;  3L75 E;  2QJK B;  3L74 D;  1LTB C;  4PD4 E;  1S72 P;  2ZVN B;  1LGH B;  4N78 E;  1SQB G;  4GOF A;  4RES B;  3H25 A;  4DJG A;  5KLV D;  3RK3 D;  1QLE D;  1PV3 A;  1YI2 P;  1CSB A;  2FXP A;  2HR3 A;  2FYU K;  2JP3 A;  1GL2 A;  3AEA C;  1BDD A;  3WUU A;  5KAF H;  2LR2 A;  4M3L A;  3CCR P;  1VQ4 P;  1BSN A;  1MKM A;  1S9K D;  2FYU D;  3AE5 C;  3C9I A;  3HD7 D;  1L0L E;  1EDK A;  2OTL P;  1KYO E;  4I7Z C;  5APV A;  1ZP0 C;  3AE2 C;  1DD4 A;  1GTW A;  2M0B A;  4W7Y A;  1WMK A;  3RK3 B;  5B5E E;  2A45 H;  4IL6 H;  2IFM A;  3WU2 H;  1KFM A;  3H32 A;  4H0L C;  3FWN A;  1SQV D;  1JY3 O;  1RE3 A;  4WBA A;  1BGY E;  2NPS D;  1SP4 A;  4PV1 B;  2OYI C;  1JUN A;  4GOE A;  3SWF A;  2VRS A;  3CXH H;  4OWF A;  1NTZ G;  3OJA B;  3CCJ P;  2OYI B;  1KFN A;  3ITK A;  1SQX K;  2YKP A;  3H1I D;  1JB0 J;  1EXJ A;  3TGU G;  3CC7 P;  1NTK J;  1SFC D;  4IFF A;  1L2P A;  1FDM A;  5CCH D;  3HD7 B;  1VQM P;  1OW8 A;  5KTB A;  5TIS E;  3V6I A;  2ZFC A;  3G9R A;  3QWO C;  3CCM P;  4DCK A;  3SWY A;  1H88 A;  2QA4 P;  2Y9Y A;  2OYO A;  3L74 G;  5AW1 B;  5H2F H;  2OAR A;  4K35 A;  3A3Y B;  2QJY C;  1USD A;  4BRY B;  3H1L D;  4NPE A;  2HG5 D;  4OGQ C;  1RF0 C;  4UB6 H;  3V2N A;  3R2P A;  5GTH H;  1M1J B;  2NPS B;  4L76 A;  2C9L Y;  2AEF A;  1J1D C;  3PJS K;  3E1I A;  2ZT9 C;  1KMI Z;  3GW6 A;  3AEG C;  3L35 A;  1QL1 A;  2FFD B;  1SFC B;  1JY2 P;  2KLV A;  1MFZ A;  2WT7 B;  2AEJ A;  3H1K J;  2BEZ F;  2JWA A;  3S1K A;  4JYC A;  1K04 A;  2A06 D;  3G3Z A;  3PLN A;  2WSE J;  3L73 D;  1ZW0 A;  2FYU G;  4QMA A;  1LP1 A;  4D6T E;  4I1L A;  2PAJ A;  5APT A;  1LT9 B;  4LLH A;  2WWW A;  3PTZ A;  5DJT B;  3MGN A;  2YO3 A;  2WPS A;  2PFX A;  2E75 D;  5AW4 B;  3V2R A;  3Q1M A;  1SQV G;  2Y0C A;  3QH9 A;  3S9O A;  2ITA A;  2H7H A;  4GIF A;  3HE4 A;  2JO1 A;  3CX5 H;  3NFQ A;  2M5A B;  3CCV P;  2ZYA A;  2E74 D;  1ZRT E;  2AXT E;  1QL2 A;  5AVT B;  1M57 D;  4U3F D;  4HH2 A;  2KUB A;  5CBN A;  1MFT A;  3H1I G;  3VP8 A;  1SQX J;  4H44 D;  2P7J A;  1HTL C;  1KB9 D;  4W80 A;  1EZV E;  1RF1 B;  3IFM A;  1NJI Q;  1VQN P;  5CJ0 A;  2GM4 A;  4H13 D;  2R32 A;  2Q6Q A;  1SQQ D;  2OYH C;  2OGU A;  3H1K E;  4I2L C;  1Y47 A;  5AVS B;  2E75 B;  1PP9 J;  2KOG A;  3H1L G;  3MZW B;  3AED C;  1FBM A;  2JDI H;  1JM0 A;  2BCC J;  2I8D A;  1N73 C;  4JYB A;  2E74 B;  2IZ0 A;  3D6Z A;  4NPD A;  2YXQ B;  1QEX A;  3G71 P;  5KJ7 D;  4H44 B;  4ZKP A;  1NU1 K;  4IL6 E;  3WU2 E;  2H8P D;  2QJP B;  4B86 A;  2WMM A;  5K5G B;  1FU1 A;  1RHZ B;  3CWB J;  3Q5P A;  3Q5R A;  2A06 G;  2N9B A;  4H13 B;  3L73 G;  1OFC X;  1HWT C;  1R5S A;  4PD4 H;  2B9B A;  3CXH E;  1T3J A;  1NU1 D;  3I56 P;  1LJ2 A;  1LTJ C;  1URQ C;  4WVZ A;  2J58 A;  4L75 A;  1FC2 C;  1PPJ E;  3HRN A;  3H1H D;  2Z5I A;  2LXB A;  3A0H H;  5AW6 B;  5GTI H;  1S3J A;  3D71 A;  1FDO A;  2I1K A;  2Q1K A;  3L75 D;  5CCG A;  4O9B A;  3NXS A;  5H2F E;  3CCQ P;  4N78 D;  1PP9 E;  4U3F G;  3CCL P;  1GL2 D;  3V5B A;  4IOI H;  2IYO A;  2BCC E;  4ASW A;  2RMZ A;  4HJG H;  3MUD C;  2QM8 A;  3AEB C;  2K1A A;  2C0W A;  3AE6 C;  4DOJ A;  3RL0 C;  4AYC A;  2YNY A;  4WY4 A;  2Y0D A;  1SQQ G;  1GD2 E;  1L0L K;  4WWI A;  1T2K C;  1ZXG A;  2IBZ I;  3CWB E;  1FJK A;  1OIP A;  1SQP E;  2IFN A;  3A7O A;  3OW2 O;  1L0L D;  1KD1 Q;  1KYO D;  2ZYG A;  1VF5 D;  3KXD A;  2N9Y B;  1GL2 B;  1BE3 E;  3II6 A;  1IJD B;  2W90 A;  1VQ6 P;  2W8Z A;  3OAK A;  2K9J B;  2WTY A;  1BGY D;  4Y99 B;  1L0N K;  1W2B O;  3BCC J;  2IZ1 A;  1H0T A;  1VDF A;  1Q90 D;  2E42 A;  1NKZ B;  1NU1 G;  1CI6 B;  2GA1 A;  2OYH A;  1NYH A;  2R3C A;  1YHQ P;  2YKO A;  4EDF A;  1L0N D;  3BAT A;  4YTP C;  1IFJ A;  2JR8 A;  2W6A A;  1H8A A;  3H1H G;  1YJ9 P;  1UII A;  2QSI A;  2WSS H;  2HPC A;  1KIL E;  1VF5 B;  2R5B A;  1K05 A;  3SFE C;  2O3J A;  3L71 D;  5E79 E;  1J2J B;  1KQF B;  2K3R A;  3L70 E;  2KI7 B;  3L75 G;  1A02 F;  2QEX P;  1Z56 A;  1BCC D;  4TLF A;  3HTK B;  5BU8 B;  2NRG A;  3HUS C;  3PH0 A;  1KQS O;  4DZO A;  3H6P A;  1FZC B;  1KIL A;  1JCC A;  3HUS B;  1JY2 O;  2J5U A;  4CPG A;  2YIU C;  1JCD A;  5CHX A;  1YYC A;  3RGU A;  3I5C A;  4IL6 X;  3GF3 A;  3SSU A;  3CPW O;  1PGQ A;  2P58 A;  2QJK C;  2E5Y A;  1LWU B;  1M56 D;  4GOD A;  2IBZ D;  3U59 A;  3G6E P;  3L72 J;  2CPS A;  2MKV A;  4C46 A;  1L0L G;  1SQB J;  3CC4 P;  5KLV K;  4D6T D;  2AXT H;  1Q7Y Q;  1M1K Q;  3CCS P;  1HGZ A;  1LTI C;  3N4X A;  3S4R A;  2YXR B;  3D6Y A;  2R5D A;  3E7K A;  3AE9 C;  2WQY C;  2POH A;  1OVV A;  1G2C A;  1DEE G;  1H89 A;  3TK1 A;  3A0H E;  1GZL A;  1ZOY C;  5GTI E;  2WSC H;  1NTM J;  1BGY G;  2O01 H;  2RN0 A;  4PV1 D;  2D2C D;  3EQ2 A;  4IFD K;  4JPZ B;  1P84 I;  4XA4 A;  1L0N G;  3USS A;  2WSE H;  1RE4 C;  3CMA P;  4L73 A;  3L71 G;  1RH5 B;  1SQV K;  3RK3 C;  3CI9 A;  1RQU A;  4KT0 J;  1BCC G;  4L74 A;  4PV1 C;  1OZH A;  4HKZ H;  3AE8 C;  2D2C C;  4JQ0 D;  1MUU A;  3BAS A;  1NTZ J;  4N3Y B;  3B71 A;  2N1T A;  4NPF X;  3L72 E;  1T8Z A;  2D2C B;  1SQB E;  5BU5 A;  5L8R J;  3TGU J;  1NAF A;  3HD7 C;  5APW A;  4LGD E;  3N7N A;  1KB9 I;  2H89 C;  2E5T A;  3M0A A;  2JWD A;  3EFF K;  3L74 J;  1SVF A;  3CX5 I;  1QVF O;  1NTM E;  5KLI C;  2IBZ G;  1N7S D;  3B5N A;  3CXH D;  5DJU B;  4AQR D;  4D6T G;  5KLI B;  5CCG D;  1M1J C;  2KXP B;  2NPS C;  1G1I A;  1USE A;  3LW5 J;  3T97 A;  1PPJ D;  1DD3 A;  1L4A D;  5KLV G;  3TNU B;  2FFD C;  4HB1 A;  1SFC C;  2WSC J;  2NZ2 A;  5CCH C;  2O01 J;  1BSH A;  1JTH A;  3CC2 P;  2OQQ A;  2O1K A;  1LTG C;  2L91 A;  1Q82 Q;  4XE5 B;  3GHG A;  1LTA C;  1NKN A;  2Z5H A;  3MIW A;  2E76 D;  3O6Q B;  1S4X A;  1VQO P;  4WB4 A;  1PP9 D;  1FOS E;  2FYU J;  1OW6 A;  2HOD A;  2HFE D;  1NTZ E;  2B89 A;  2XNX A;  2W6B A;  3F5H A;  1ZR2 A;  1N7S B;  1P84 D;  5KKZ B;  1LT9 C;  1GK4 A;  4EOT A;  3IF4 A;  2V4H A;  2KZJ A;  1PZQ A;  2R3S A;  1SQP K;  4DT0 A;  1FZB A;  3FXD A;  2M8R A;  2WPR A;  1PGO A;  2SPZ A;  1NTK E;  3AEF C;  1L4A B;  3G4S P;  2CK3 H;  3VMY A;  3L74 E;  2K37 A;  2WPQ A;  1XTG B;  1SQP D;  4PD4 I;  1GW3 A; 
#chains in the Genus database with same CATH homology
 1P84 H;  3H1L G;  3CXH H;  3L75 G;  1NTK G;  1PPJ G;  3BCC G;  1NTZ G;  1SQX G;  2IBZ G;  1PP9 G;  5KLV G;  1BCC G;  1L0N G;  1L0L G;  3L74 G;  3H1H G;  2A06 G;  1KB9 H;  3H1K G;  3H1I G;  1BGY G;  1SQQ G;  4U3F G;  3H1J G;  3TGU G;  4D6T G;  2FYU G;  1BE3 G;  1SQV G;  3L72 G;  3L73 G;  3L70 G;  4PD4 H;  2BCC G;  3CWB G;  1SQP G;  1SQB G;  1EZV G;  1NTM G;  3L71 G;  1NU1 G;  3CX5 H;  1KYO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...