1BE3G

Cytochrome bc1 complex from bovine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1be3G00
1KB9H 3CX5H 1SQBG 4PD4H 1SQPG 1BE3G 2A06G 1BGYG 1SQXG 3CWBG 2FYUG 1NTKG 3L73G 2BCCG 3L74G 1EZVG 3CXHH 3H1KG 1L0NG 3H1HG 2IBZG 1P84H 1KYOH 4U3FG 3H1JG 3BCCG 3L72G 3L75G 3H1IG 3H1LG 1BCCG 1L0LG 3L71G 3TGUG 3L70G 1NTZG 1SQVG 1SQQG 5KLVG 1PPJG 1NU1G 4D6TG 1NTMG 1PP9G
chains in the Genus database with same CATH superfamily
1YQ4C 1LTJA 2E76B 1BE3G 1JY3P 4KT0J 1RF1A 1OWAA 1N7SA 1OIPA 4IL6E 1M1JB 2HYNA 2E42A 3VMYA 1Q2NA 1SQPK 1DD4A 5KLVG 1YI2P 3U1AA 2J5UA 1GK6A 4Y28J 1YJWP 4TLFA 4OGQB 3IAOA 4XE5B 4M3LA 1KB9E 1URQA 3GG2A 3CCEP 2FYUK 1QL2A 1PGJA 3I56P 3CC7P 2RH0A 2FYZA 2FYUE 1EZVG 2W27A 5CJ0A 1W2BO 2QE7H 5KJ7D 4C7NB 1PGPA 1VQPP 1L4AD 3MD0A 2M8RA 4H0LD 1NU1G 2ZXEB 2V7QJ 1VQOP 1IFMA 2C9LY 1H0TA 2I1JA 3F89A 2QRXA 1OW7A 4EOTA 1NH4A 4MN4C 2N9YB 2KZIA 1FE6A 3PTZA 1SQBJ 2FXMA 3FX0A 1G2CB 3WMM0 4WY4C 1RF1B 4JYBA 1Y9BA 2BCCG 2Y0CA 1VQ6P 1YTZT 2FKWB 3Q5PA 3WU2H 1GD2E 5KJ7C 2H88C 2QJKC 4DT0A 2D2CD 1L4AC 3B5ND 2E74D 3IF4A 3HUSA 1FAVA 4GOFA 5AVZB 3SWKA 1JY3O 4BXLA 1PP9D 5BU5A 3BASA 5AVYB 1NTKK 1SQQE 5TISE 4HJGH 4JPZB 1HGZA 1NTKE 3L74E 2AEFA 3QWOC 2Y0DA 3H1IE 1P84I 2Q3EA 2KLVA 1HGVA 1S5LH 3NMDA 3PP5A 2JEEA 3RL0C 2LKMA 3VYIA 3L75J 3HE4A 4U3FG 1SQVJ 2KS1B 5AW4B 4JQ0D 1HTLC 2KIKA 1BSNA 3P32A 2PRRA 2OYIB 2H7HA 2WITA 2YO3A 1G1IA 1E79H 3D71A 2YMKA 1L0LJ 1NTZJ 2P7JA 1IFPA 1NKNA 2H89C 1NYHA 3TF5A 4LGDE 1FOSE 3WU2E 1FC2C 4RO0A 1IFJA 1SFCC 4R4MA 1BGYE 1SQXE 4OVNF 1T3JA 3L75D 1SQVD 3AE5C 1AQ5A 4UB8H 3R2PA 3L70E 3C1LA 3FXEA 3E1IA 3ZDMA 1LGHB 3V4QA 3ITKA 1L0LD 2E5TA 1NTZD 2FFDA 3VMXA 2YKOA 1RQVA 2P58A 3L72E 2NPSD 3H32B 1LJ2A 4IFFA 1QVFO 2I1KA 4H0LB 1LP1A 1OVVA 4N3YB 2M3EA 3M9BA 1P84H 1S5LE 1KQLA 5KLIC 2M0BA 2XZRA 5M1BA 2WWWA 4WVZA 2Q7CA 2ZT9B 3HD7B 1K05A 1EXJA 1KB9D 3AE3C 3Q5RA 2Q9IA 2YKPA 1LTAC 2GM4A 3GW6A 2GUSA 3H1JE 1HBWA 1NGMB 2E76D 2FYUD 3L71E 5DJUB 3H1KJ 4BRYA 2WZ7A 2YXRB 1BDDA 2IDBA 2HODB 1PGQA 1W2EA 3SWFA 4XA4A 4XFJA 1ZR4A 4ZNCA 2IYOA 3AE8C 2KYVA 2KI7B 1NWQA 5APWA 4OGQD 4I1LA 1OVRA 4IFMA 3L37A 4UB8E 4K35A 1X79B 1ZMEC 1GMJA 1JTHB 3RK2C 1SQQJ 5KTBA 1KMIZ 3SFDC 4JF7A 3L74J 2V4HA 1SQBG 5AW5B 3CLQA 1EXIA 1FZGA 1N8RQ 5AW7B 3O8ZA 2M5AA 1M1JC 4R4LA 1T2KC 2XDJA 3W67A 4GDOA 1KV4A 4KJMA 4RESB 4YPCA 2IZ1A 1WMKA 3CWBJ 5GTHH 1P84E 2ZAEB 2P2UA 1KD1Q 2R32A 3KXDA 3KPEA 2UWJE 1FS0E 1SQQD 1HJBA 1TU3F 1MKMA 1EDKA 4WBAA 3R4YA 1NTKD 2QVAA 3L74D 2R3CA 4BRYB 1JCDA 2A06E 1VF5B 1N73A 3H1ID 3O6QB 1VQKP 1JY2N 5AVVB 2Q5UA 1JOCA 3EQ2A 1HVVA 3BCCE 3OAKA 3N4XA 1Q82Q 5BVZA 1BGYJ 1SQXJ 2WSCH 2N1TB 2A45I 3A0HH 1J1DC 3Q1MA 1FZEA 1JM0A 3AEAC 4L75A 3L75G 5L8RJ 1HH0A 1SQVG 2WSSH 1YQ3C 2OGUA 3V2NA 2L91A 2KSJA 1YJ9P 2NPSB 2C9NY 4UB6H 2OYOA 2QJPB 5KKZB 1Q81Q 3L72J 1EDLA 5AW1B 1FJPA 3TNUA 3HE5B 1Z56A 4OH8B 1L0LG 3CCRP 1NTZG 1RQUA 1BGYD 1SQXD 3FXDA 3AE4C 1LWUA 1FU1A 1KILA 2IFMA 1SVFA 3A2AA 1VL2A 1K8AQ 2JDIH 3L70D 5GTHE 3CXHI 1NTMK 5AW0B 2OTJP 4I7ZB 1Q7YQ 5DJTB 1FZCB 2NZ2A 5APYA 3VP9A 3RGUA 2IBZI 2POHA 3L72D 5AVRB 3H1JJ 2FXPA 3P7KA 2KUBA 3RK3C 3L71J 3GLMA 3M0DA 4GKGA 3H1LE 3PLNA 3TGUE 3SFEC 1USEA 1PV3A 1VQ5P 2C0WA 1SQPE 1RH5B 1FZAA 1IFIA 1X8YA 3VOPA 5TISH 3A0HE 4C46A 2FYNB 1GL2B 2A45H 2WMMA 2HPCA 2OYIC 5APXA 2LXCB 3QH9A 1IK9A 2KNCB 1JB0J 1W5CE 1OX3A 1U57A 3H1JD 1T8ZA 2R5BA 3L71D 2O01H 1RE4C 4UB6E 1MV8A 1LTBC 3WUUA 1KILB 3VP8A 5CBOA 4D6TE 5CCGA 2XNDH 3H1KG 4RJTA 5CHXA 2JWAA 2ZT9D 3HD7D 1PP9J 2K9JB 3D6ZA 2IX7C 1LTJB 5KAIH 3L73E 5C39A 1N7SB 3CXHH 3CCUP 1FOSF 1NU1K 2W6BA 5E79H 2C0XA 1WT6A 1SQQG 2E43A 1PPJE 2PP6A 4H0LC 1KILE 2OARA 2ZFCA 1VQ9P 3JC22 1DEBA 3GHGC 2CK3H 3L74G 2W90A 1XTCC 3BCCJ 2OQQA 1N7LA 4PJ0H 1URQB 1P84D 2QJYB 5CCHD 2FXOA 2HG5D 3MTUE 1JCCA 1N2DC 2O1JA 3UIAA 2M3BA 3CWBG 2BCCE 2KK7A 3H1HE 3KHUA 2JWDA 3AE7C 2A06D 2K88A 3PH0A 1USDA 3CPWO 3KQGA 5AVQB 2D2CC 3B5NC 2YO2A 2E74C 4ZMDA 1H0TB 1R5SA 1SLQA 1DX7A 3BCCD 1AV1A 1CSBA 3FGAD 4WY4A 4Z1MH 5CCHC 2W6AA 4C7RA 4HKZH 5KJ7A 3CMEP 3SWYA 1L4AA 4PV1B 1NAFA 1DEEG 1BGYG 1SQXG 1PIXA 3V2RA 2N9BA 2AEMA 2AXTE 3M9HA 3GHGA 5KAIE 3HUSB 3CXHE 2VRSA 1VF5D 3RL0g 3P8CE 1OXZA 2B88A 5E79E 1M1KQ 3VTPC 4AYCA 4ZKUA 4U3FE 2IBZE 5AVXB 1GW4A 3L72G 2FY8A 2N1TD 1U7JA 5AW9B 2OYHC 1LT9C 1SQPJ 1ZRTE 2LR2A 1K9MQ 1QL1A 4PJ0E 3H6PA 2WSCJ 5AVWB 3B5NA 1KTMA 4DJGA 1JY3N 2AXCA 5AVUB 1U7MA 1YIJP 2FYUJ 2WSEH 2H43A 2WT7A 1S72P 2K3RA 1DD3A 4WY4B 3HE4B 3H1LD 1T3UA 3TGUD 2IZ0A 1S2EA 4W7YA 3H1JG 3S9OA 4D6TJ 4NPDA 2N1TC 2V7QH 3L71G 1SQPD 2QJKB 5APQA 5AVSB 5B5EH 1X0TA 1H88A 2XV5A 2K1AA 2IPPA 1GK4A 1IJDB 1SFCA 1PGOA 1RE3C 2RMZA 3RBZA 1ZOYC 2NPSC 3AE2C 3CL3D 2QJPC 3L73J 2OYHA 3II6A 1RY3A 1GW3A 1QVGO 2Z5IA 3AEGC 1J1EC 1MZ9A 3CX5I 1JY2O 2Z4EA 4D6TD 3KDPB 2CPBA 2YXQB 5APSA 4Y99B 3MZWB 3BRVB 5AVTB 3CCMP 2P10A 2GUVA 2Z5HA 3VN0A 1HWTC 4IL6X 2GA1A 3IR9A 3RL0B 3VMZA 1A02F 1GL2D 2FFDB 3A7OA 1JNMA 4AUWA 1VDFA 1CZQA 5GTIH 3GF7A 3MIWA 2PGDA 2ZXXA 2WPQA 2AEJA 4AQRD 2WT7B 3L73D 2E76C 1NTKJ 1PP9G 2WQYC 3H1HJ 1LP1B 4L74A 3G4SP 2PAJA 4LLHA 3H1IJ 1UIXA 1GTWA 3CMAP 1PPJD 2QM8A 1KILD 1YBKA 1AJYA 5H2FH 1FDIA 2O01J 3L4FA 2A06G 4BWNA 4HB1A 1EZVI 4OGQC 1FDOA 3N7NA 2FYNC 3KYQA 1KQFB 4PD4I 3JCUH 3AEEC 1FZFA 1KN7A 1AA0A 3USSA 5B5EE 1GL2C 2Y9YA 1OW8A 3HTKA 3BCCG 1M8OB 2I8DA 2JJLA 1SQBK 2B87A 3V4WA 1Y8AA 3CC2P 2BCCD 2XU6A 2G3AA 1M56D 1MUUA 1N7SD 1SQBE 3H1HD 5APUA 4N6JA 3L35A 1SP4A 1PL5A 3M9QA 1KYOI 3H25A 1VQLP 2HR3A 1RF0C 3NTNA 2RN0A 3S1KA 3CX5H 2E5YA 1S9KE 1URQD 2MKVA 3JSVC 3L70J 4H44D 2E75B 4ASWA 1M1JA 1LTJC 1BCCE 1RF1C 1ZLLA 4I2LC 1ZV8A 2ZVNB 1L0NK 1JMBA 1N7SC 2P1JA 5GTIE 2M5AB 3MHVA 2ZYAA 2KOGA 1OVUA 4GT1A 1L0NE 1FZBA 3CXHD 4W7ZA 2L5GB 5CCGD 3VMAA 3P8CD 2FBWC 1Y47A 3BRTB 1NVOA 3AEBC 2RKLA 1YYCA 3GMAA 1X22A 4U3FD 2IBZD 4EIJA 3OW2O 5H2FE 3V2PA 2Y9ZA 4O9BA 1S4XA 3HTKB 1IZNB 1ZRTD 1EDJA 3AEFC 2R5DA 1RHZB 4C7NA 2BEQD 4IFDK 1EQ7A 1KZUB 5AW6B 1KFNA 3AE1C 4PV1D 3JCUE 1LTIC 3I55P 2WPSA 1IFDA 1NTME 4PD4H 1SQPG 1N73B 3EFGA 1NAYA 1DH3A 4H13B 3E1RA 3RK2B 1IFNA 2ZVOB 1SS1A 1ZXGA 3CD6P 3G71P 1G2CA 3HRNA 2FYUG 5K5GB 2ITAA 1GZLA 3U59A 1KYOH 2XNXA 3Q3DA 3CX5E 3TDKA 2WVRA 1EC5A 3D70A 4PV1C 1JO5A 4D6TG 2W8ZA 1BE3E 2KXPB 3E7KA 4YTPC 4DOJA 3TNUB 3LW5H 3HUSC 3MUDC 3PJSK 5KLVK 1IO4A 4DCKA 1JUNA 4IOIH 2KB7P 1LWUB 4CPGA 1OZHA 5KLVE 4WY4D 1IC2A 2WSEJ 1G1JA 3L73G 1HJ0A 4LC1A 1S3JA 1FJKA 1QLED 3CCJP 3P8MC 4EYYQ 2YIUB 3CCLP 1R8EA 3A5TA 1OMIA 1PPJG 1MFTA 5AW2B 2AXTH 2LXBA 2NRGA 5B66H 3FWNA 2WSFH 2ZYGA 1J1DB 1S5LX 1S1CX 1KC8Q 1EZVE 1NJIQ 4L76A 2OTKE 1VPCA 1DIPA 4PD4E 2KS1A 2ZYDA 2R44A 2G8YA 1NKZB 2QA4P 5AW3B 1NU1E 1LNQA 3G3ZA 1N86A 3V5BA 1YHQP 4GODA 2A45G 1NTKG 2OYIA 4W80A 3H1KE 4ZKPA 3H1HG 3RBXA 3ABVC 5TJHA 2W83C 3CCVP 1BDCA 3H1IG 1QX8A 4YXWH 2HPCB 2ZT9C 2OTLP 3HD7C 3MUDA 5APVA 4H44B 1RE4A 1M7LA 1KYOE 3RL0D 1R5LA 2K37A 1HUCA 4GOEA 3M06A 3Q5SA 1PFIA 3CCSP 1ZR2A 3BVHA 4WB4A 2JKVA 1BCCJ 1A02J 1H8AA 1SQQK 3FWLA 1J2JB 1SQBD 3G9RA 3AE9C 4HH2A 1FDMA 3OJAB 4JYCA 1L0NJ 5AW8B 1JEKA 3BATA 1ZW0A 2Q1KA 4RKUJ 1XTGB 3IN6A 5EFWB 2KP8A 1NHLA 3F5HA 3RK3B 2J59M 4Y99C 5BU8B 1S9KD 3PHLA 3H32A 1JMMA 4TT3H 1SFCD 1JY2P 3B4SA 2FFDC 3CWBE 2KZJA 2DW3A 3C9IA 1BCCD 2HFED 2IBZG 1VQ7P 1CI6A 5B66E 1AVOA 1NTMJ 2J58A 4JBZA 2JP3A 3L70G 1L0ND 3HD7A 1NO4A 3EFFK 2HLOA 3H1LJ 4ASVA 3TGUJ 3CI9A 3RK3E 2H8PD 1SQXK 1ZN5A 2WTYA 1LTGC 4HYTB 2CPSA 3NFQA 2IYPA 2E75D 2HODA 2JR8A 1Q86Q 1K04A 4N78E 1L2PA 3MP7B 1NTMD 4L73A 1VQMP 2B9BA 1BE3J 2W6JH 5CCHA 2QG4A 1VF5C 2Y0EA 2KSEA 1PZQA 1OFCX 1X9VA 3AECC 3KZIH 3PRJA 5CMZA 1VQ8P 5KLVJ 1JTHA 2YNYA 1EDIA 1FBMA 3G6EP 1L4AB 3CX5D 2SPZA 1CI6B 3TYYA 3GHGB 3TK1A 2QEXP 2E75C 1K73Q 2KLUA 1YITP 1ZP0C 1KFMA 1KQGB 1BE3D 3LIDA 2PFXA 3L36A 3W68A 3WUVA 5KKZC 4EI2A 4H13D 1LT9A 2Q3IA 3B71A 2QSIA 3RK2D 2JO1A 5KLVD 1NU1J 4NPEA 3V2QA 2XKMA 4K3AA 3D6YA 2D2CB 3WUTA 3B5NB 2E74B 3TSIA 2B89A 1KB9I 1T2KD 3MGNA 3O6QA 3A0BH 1BSHA 3I5CA 4WWIA 4B86A 4I7ZC 3V6IA 2O01N 1N73C 1FZCC 2BCCJ 1EZVD 2BEZF 2N1TA 1VQ4P 4H13C 4OWFA 4PD4D 1UIIA 5KAFH 3AEDC 1Q90D 2O3JA 2O1KA 1NU1D 1MFZA 2WPRA 3LW5J 2QIWA 5CJ4A 5CBNA 2IFNA 1GU4A 3H1KD 2QM7A 3KZIE 3M0AA 1AQTA 4YXDC 1H89A 1RE3A 1KQSO 2NPSA 2Q6QA 1LTTC 2YKQA 1M57D 1SFCB 3C8VA 3AE6C 1KYOD 2K9YA 3HE5A 3K5BA 4NPFX 1M90Q 2OYHB 1LT9B 1HF9A 4U7JA 1PP9E 1QEXA 3NXSA 3CC4P 1GDTA 2WSFJ 4A7PA 1YTZI 2MJZA 3T97A 1D7MA 1LWUC 1KILC 1BCCG 1GU5A 2YMYA 1LTSC 4IL6H 4EDFA 3EWKA 3A3YB 1VQNP 3S4RA 4QMAA 1FZCA 4U3FJ 1CW5A 1L0NG 2YIUC 1LT1A 3LIEA 2WPVB 3CWBD 5KLIB 2BASA 3Q2YA 3A0BE 1KB9H 1IK7A 3M0DC 2ZJSE 3OA7A 3B8EB 1WRGA 3M91A 1E5WA 1GL2A 5KAFE 3CCQP 1NTMG 2KNCA 1KORA 3IFMA 3RK3D 1URQC 2QJYC 1J1EB 1SQVK 4KHXA 1QGKB 2B87B 1AVYA 4H44C 3H1LG 1T6AA 3L75E 3TGUG 2P67A 1SQVE 3U1CA 5APTA 1NOHA 4DZOA 3GF3A 4N78D 1RF0A 3SSUA 4GIFA 1L0LK 1OW6A 1NTZK 3T97B 4I6MC 5CCGC 1YJNP 1L0LE 2K9JA 2R3SA 1AFOA 1NTZE
chains in the Genus database with same CATH topology
1KB9H 3CX5H 1SQBG 4PD4H 1SQPG 1BE3G 2A06G 1BGYG 1SQXG 3CWBG 2FYUG 1NTKG 3L73G 2BCCG 3L74G 1EZVG 3CXHH 3H1KG 1L0NG 3H1HG 2IBZG 1P84H 1KYOH 4U3FG 3H1JG 3BCCG 3L72G 3L75G 3H1IG 3H1LG 1BCCG 1L0LG 3L71G 3TGUG 3L70G 1NTZG 1SQVG 1SQQG 5KLVG 1PPJG 1NU1G 4D6TG 1NTMG 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 H;  3CX5 H;  1SQB G;  4PD4 H;  1SQP G;  1BE3 G;  2A06 G;  1BGY G;  1SQX G;  3CWB G;  2FYU G;  1NTK G;  3L73 G;  2BCC G;  3L74 G;  1EZV G;  3CXH H;  3H1K G;  1L0N G;  3H1H G;  2IBZ G;  1P84 H;  1KYO H;  4U3F G;  3H1J G;  3BCC G;  3L72 G;  3L75 G;  3H1I G;  3H1L G;  1BCC G;  1L0L G;  3L71 G;  3TGU G;  3L70 G;  1NTZ G;  1SQV G;  1SQQ G;  5KLV G;  1PPJ G;  1NU1 G;  4D6T G;  1NTM G;  1PP9 G; 
#chains in the Genus database with same CATH topology
 1YQ4 C;  1LTJ A;  2E76 B;  1BE3 G;  1JY3 P;  4KT0 J;  1RF1 A;  1OWA A;  1N7S A;  1OIP A;  4IL6 E;  1M1J B;  2HYN A;  2E42 A;  3VMY A;  1Q2N A;  1SQP K;  1DD4 A;  5KLV G;  1YI2 P;  3U1A A;  2J5U A;  1GK6 A;  4Y28 J;  1YJW P;  4TLF A;  4OGQ B;  3IAO A;  4XE5 B;  4M3L A;  1KB9 E;  1URQ A;  3GG2 A;  3CCE P;  2FYU K;  1QL2 A;  1PGJ A;  3I56 P;  3CC7 P;  2RH0 A;  2FYZ A;  2FYU E;  1EZV G;  2W27 A;  5CJ0 A;  1W2B O;  2QE7 H;  5KJ7 D;  4C7N B;  1PGP A;  1VQP P;  1L4A D;  3MD0 A;  2M8R A;  4H0L D;  1NU1 G;  2ZXE B;  2V7Q J;  1VQO P;  1IFM A;  2C9L Y;  1H0T A;  2I1J A;  3F89 A;  2QRX A;  1OW7 A;  4EOT A;  1NH4 A;  4MN4 C;  2N9Y B;  2KZI A;  1FE6 A;  3PTZ A;  1SQB J;  2FXM A;  3FX0 A;  1G2C B;  3WMM 0;  4WY4 C;  1RF1 B;  4JYB A;  1Y9B A;  2BCC G;  2Y0C A;  1VQ6 P;  1YTZ T;  2FKW B;  3Q5P A;  3WU2 H;  1GD2 E;  5KJ7 C;  2H88 C;  2QJK C;  4DT0 A;  2D2C D;  1L4A C;  3B5N D;  2E74 D;  3IF4 A;  3HUS A;  1FAV A;  4GOF A;  5AVZ B;  3SWK A;  1JY3 O;  4BXL A;  1PP9 D;  5BU5 A;  3BAS A;  5AVY B;  1NTK K;  1SQQ E;  5TIS E;  4HJG H;  4JPZ B;  1HGZ A;  1NTK E;  3L74 E;  2AEF A;  3QWO C;  2Y0D A;  3H1I E;  1P84 I;  2Q3E A;  2KLV A;  1HGV A;  1S5L H;  3NMD A;  3PP5 A;  2JEE A;  3RL0 C;  2LKM A;  3VYI A;  3L75 J;  3HE4 A;  4U3F G;  1SQV J;  2KS1 B;  5AW4 B;  4JQ0 D;  1HTL C;  2KIK A;  1BSN A;  3P32 A;  2PRR A;  2OYI B;  2H7H A;  2WIT A;  2YO3 A;  1G1I A;  1E79 H;  3D71 A;  2YMK A;  1L0L J;  1NTZ J;  2P7J A;  1IFP A;  1NKN A;  2H89 C;  1NYH A;  3TF5 A;  4LGD E;  1FOS E;  3WU2 E;  1FC2 C;  4RO0 A;  1IFJ A;  1SFC C;  4R4M A;  1BGY E;  1SQX E;  4OVN F;  1T3J A;  3L75 D;  1SQV D;  3AE5 C;  1AQ5 A;  4UB8 H;  3R2P A;  3L70 E;  3C1L A;  3FXE A;  3E1I A;  3ZDM A;  1LGH B;  3V4Q A;  3ITK A;  1L0L D;  2E5T A;  1NTZ D;  2FFD A;  3VMX A;  2YKO A;  1RQV A;  2P58 A;  3L72 E;  2NPS D;  3H32 B;  1LJ2 A;  4IFF A;  1QVF O;  2I1K A;  4H0L B;  1LP1 A;  1OVV A;  4N3Y B;  2M3E A;  3M9B A;  1P84 H;  1S5L E;  1KQL A;  5KLI C;  2M0B A;  2XZR A;  5M1B A;  2WWW A;  4WVZ A;  2Q7C A;  2ZT9 B;  3HD7 B;  1K05 A;  1EXJ A;  1KB9 D;  3AE3 C;  3Q5R A;  2Q9I A;  2YKP A;  1LTA C;  2GM4 A;  3GW6 A;  2GUS A;  3H1J E;  1HBW A;  1NGM B;  2E76 D;  2FYU D;  3L71 E;  5DJU B;  3H1K J;  4BRY A;  2WZ7 A;  2YXR B;  1BDD A;  2IDB A;  2HOD B;  1PGQ A;  1W2E A;  3SWF A;  4XA4 A;  4XFJ A;  1ZR4 A;  4ZNC A;  2IYO A;  3AE8 C;  2KYV A;  2KI7 B;  1NWQ A;  5APW A;  4OGQ D;  4I1L A;  1OVR A;  4IFM A;  3L37 A;  4UB8 E;  4K35 A;  1X79 B;  1ZME C;  1GMJ A;  1JTH B;  3RK2 C;  1SQQ J;  5KTB A;  1KMI Z;  3SFD C;  4JF7 A;  3L74 J;  2V4H A;  1SQB G;  5AW5 B;  3CLQ A;  1EXI A;  1FZG A;  1N8R Q;  5AW7 B;  3O8Z A;  2M5A A;  1M1J C;  4R4L A;  1T2K C;  2XDJ A;  3W67 A;  4GDO A;  1KV4 A;  4KJM A;  4RES B;  4YPC A;  2IZ1 A;  1WMK A;  3CWB J;  5GTH H;  1P84 E;  2ZAE B;  2P2U A;  1KD1 Q;  2R32 A;  3KXD A;  3KPE A;  2UWJ E;  1FS0 E;  1SQQ D;  1HJB A;  1TU3 F;  1MKM A;  1EDK A;  4WBA A;  3R4Y A;  1NTK D;  2QVA A;  3L74 D;  2R3C A;  4BRY B;  1JCD A;  2A06 E;  1VF5 B;  1N73 A;  3H1I D;  3O6Q B;  1VQK P;  1JY2 N;  5AVV B;  2Q5U A;  1JOC A;  3EQ2 A;  1HVV A;  3BCC E;  3OAK A;  3N4X A;  1Q82 Q;  5BVZ A;  1BGY J;  1SQX J;  2WSC H;  2N1T B;  2A45 I;  3A0H H;  1J1D C;  3Q1M A;  1FZE A;  1JM0 A;  3AEA C;  4L75 A;  3L75 G;  5L8R J;  1HH0 A;  1SQV G;  2WSS H;  1YQ3 C;  2OGU A;  3V2N A;  2L91 A;  2KSJ A;  1YJ9 P;  2NPS B;  2C9N Y;  4UB6 H;  2OYO A;  2QJP B;  5KKZ B;  1Q81 Q;  3L72 J;  1EDL A;  5AW1 B;  1FJP A;  3TNU A;  3HE5 B;  1Z56 A;  4OH8 B;  1L0L G;  3CCR P;  1NTZ G;  1RQU A;  1BGY D;  1SQX D;  3FXD A;  3AE4 C;  1LWU A;  1FU1 A;  1KIL A;  2IFM A;  1SVF A;  3A2A A;  1VL2 A;  1K8A Q;  2JDI H;  3L70 D;  5GTH E;  3CXH I;  1NTM K;  5AW0 B;  2OTJ P;  4I7Z B;  1Q7Y Q;  5DJT B;  1FZC B;  2NZ2 A;  5APY A;  3VP9 A;  3RGU A;  2IBZ I;  2POH A;  3L72 D;  5AVR B;  3H1J J;  2FXP A;  3P7K A;  2KUB A;  3RK3 C;  3L71 J;  3GLM A;  3M0D A;  4GKG A;  3H1L E;  3PLN A;  3TGU E;  3SFE C;  1USE A;  1PV3 A;  1VQ5 P;  2C0W A;  1SQP E;  1RH5 B;  1FZA A;  1IFI A;  1X8Y A;  3VOP A;  5TIS H;  3A0H E;  4C46 A;  2FYN B;  1GL2 B;  2A45 H;  2WMM A;  2HPC A;  2OYI C;  5APX A;  2LXC B;  3QH9 A;  1IK9 A;  2KNC B;  1JB0 J;  1W5C E;  1OX3 A;  1U57 A;  3H1J D;  1T8Z A;  2R5B A;  3L71 D;  2O01 H;  1RE4 C;  4UB6 E;  1MV8 A;  1LTB C;  3WUU A;  1KIL B;  3VP8 A;  5CBO A;  4D6T E;  5CCG A;  2XND H;  3H1K G;  4RJT A;  5CHX A;  2JWA A;  2ZT9 D;  3HD7 D;  1PP9 J;  2K9J B;  3D6Z A;  2IX7 C;  1LTJ B;  5KAI H;  3L73 E;  5C39 A;  1N7S B;  3CXH H;  3CCU P;  1FOS F;  1NU1 K;  2W6B A;  5E79 H;  2C0X A;  1WT6 A;  1SQQ G;  2E43 A;  1PPJ E;  2PP6 A;  4H0L C;  1KIL E;  2OAR A;  2ZFC A;  1VQ9 P;  3JC2 2;  1DEB A;  3GHG C;  2CK3 H;  3L74 G;  2W90 A;  1XTC C;  3BCC J;  2OQQ A;  1N7L A;  4PJ0 H;  1URQ B;  1P84 D;  2QJY B;  5CCH D;  2FXO A;  2HG5 D;  3MTU E;  1JCC A;  1N2D C;  2O1J A;  3UIA A;  2M3B A;  3CWB G;  2BCC E;  2KK7 A;  3H1H E;  3KHU A;  2JWD A;  3AE7 C;  2A06 D;  2K88 A;  3PH0 A;  1USD A;  3CPW O;  3KQG A;  5AVQ B;  2D2C C;  3B5N C;  2YO2 A;  2E74 C;  4ZMD A;  1H0T B;  1R5S A;  1SLQ A;  1DX7 A;  3BCC D;  1AV1 A;  1CSB A;  3FGA D;  4WY4 A;  4Z1M H;  5CCH C;  2W6A A;  4C7R A;  4HKZ H;  5KJ7 A;  3CME P;  3SWY A;  1L4A A;  4PV1 B;  1NAF A;  1DEE G;  1BGY G;  1SQX G;  1PIX A;  3V2R A;  2N9B A;  2AEM A;  2AXT E;  3M9H A;  3GHG A;  5KAI E;  3HUS B;  3CXH E;  2VRS A;  1VF5 D;  3RL0 g;  3P8C E;  1OXZ A;  2B88 A;  5E79 E;  1M1K Q;  3VTP C;  4AYC A;  4ZKU A;  4U3F E;  2IBZ E;  5AVX B;  1GW4 A;  3L72 G;  2FY8 A;  2N1T D;  1U7J A;  5AW9 B;  2OYH C;  1LT9 C;  1SQP J;  1ZRT E;  2LR2 A;  1K9M Q;  1QL1 A;  4PJ0 E;  3H6P A;  2WSC J;  5AVW B;  3B5N A;  1KTM A;  4DJG A;  1JY3 N;  2AXC A;  5AVU B;  1U7M A;  1YIJ P;  2FYU J;  2WSE H;  2H43 A;  2WT7 A;  1S72 P;  2K3R A;  1DD3 A;  4WY4 B;  3HE4 B;  3H1L D;  1T3U A;  3TGU D;  2IZ0 A;  1S2E A;  4W7Y A;  3H1J G;  3S9O A;  4D6T J;  4NPD A;  2N1T C;  2V7Q H;  3L71 G;  1SQP D;  2QJK B;  5APQ A;  5AVS B;  5B5E H;  1X0T A;  1H88 A;  2XV5 A;  2K1A A;  2IPP A;  1GK4 A;  1IJD B;  1SFC A;  1PGO A;  1RE3 C;  2RMZ A;  3RBZ A;  1ZOY C;  2NPS C;  3AE2 C;  3CL3 D;  2QJP C;  3L73 J;  2OYH A;  3II6 A;  1RY3 A;  1GW3 A;  1QVG O;  2Z5I A;  3AEG C;  1J1E C;  1MZ9 A;  3CX5 I;  1JY2 O;  2Z4E A;  4D6T D;  3KDP B;  2CPB A;  2YXQ B;  5APS A;  4Y99 B;  3MZW B;  3BRV B;  5AVT B;  3CCM P;  2P10 A;  2GUV A;  2Z5H A;  3VN0 A;  1HWT C;  4IL6 X;  2GA1 A;  3IR9 A;  3RL0 B;  3VMZ A;  1A02 F;  1GL2 D;  2FFD B;  3A7O A;  1JNM A;  4AUW A;  1VDF A;  1CZQ A;  5GTI H;  3GF7 A;  3MIW A;  2PGD A;  2ZXX A;  2WPQ A;  2AEJ A;  4AQR D;  2WT7 B;  3L73 D;  2E76 C;  1NTK J;  1PP9 G;  2WQY C;  3H1H J;  1LP1 B;  4L74 A;  3G4S P;  2PAJ A;  4LLH A;  3H1I J;  1UIX A;  1GTW A;  3CMA P;  1PPJ D;  2QM8 A;  1KIL D;  1YBK A;  1AJY A;  5H2F H;  1FDI A;  2O01 J;  3L4F A;  2A06 G;  4BWN A;  4HB1 A;  1EZV I;  4OGQ C;  1FDO A;  3N7N A;  2FYN C;  3KYQ A;  1KQF B;  4PD4 I;  3JCU H;  3AEE C;  1FZF A;  1KN7 A;  1AA0 A;  3USS A;  5B5E E;  1GL2 C;  2Y9Y A;  1OW8 A;  3HTK A;  3BCC G;  1M8O B;  2I8D A;  2JJL A;  1SQB K;  2B87 A;  3V4W A;  1Y8A A;  3CC2 P;  2BCC D;  2XU6 A;  2G3A A;  1M56 D;  1MUU A;  1N7S D;  1SQB E;  3H1H D;  5APU A;  4N6J A;  3L35 A;  1SP4 A;  1PL5 A;  3M9Q A;  1KYO I;  3H25 A;  1VQL P;  2HR3 A;  1RF0 C;  3NTN A;  2RN0 A;  3S1K A;  3CX5 H;  2E5Y A;  1S9K E;  1URQ D;  2MKV A;  3JSV C;  3L70 J;  4H44 D;  2E75 B;  4ASW A;  1M1J A;  1LTJ C;  1BCC E;  1RF1 C;  1ZLL A;  4I2L C;  1ZV8 A;  2ZVN B;  1L0N K;  1JMB A;  1N7S C;  2P1J A;  5GTI E;  2M5A B;  3MHV A;  2ZYA A;  2KOG A;  1OVU A;  4GT1 A;  1L0N E;  1FZB A;  3CXH D;  4W7Z A;  2L5G B;  5CCG D;  3VMA A;  3P8C D;  2FBW C;  1Y47 A;  3BRT B;  1NVO A;  3AEB C;  2RKL A;  1YYC A;  3GMA A;  1X22 A;  4U3F D;  2IBZ D;  4EIJ A;  3OW2 O;  5H2F E;  3V2P A;  2Y9Z A;  4O9B A;  1S4X A;  3HTK B;  1IZN B;  1ZRT D;  1EDJ A;  3AEF C;  2R5D A;  1RHZ B;  4C7N A;  2BEQ D;  4IFD K;  1EQ7 A;  1KZU B;  5AW6 B;  1KFN A;  3AE1 C;  4PV1 D;  3JCU E;  1LTI C;  3I55 P;  2WPS A;  1IFD A;  1NTM E;  4PD4 H;  1SQP G;  1N73 B;  3EFG A;  1NAY A;  1DH3 A;  4H13 B;  3E1R A;  3RK2 B;  1IFN A;  2ZVO B;  1SS1 A;  1ZXG A;  3CD6 P;  3G71 P;  1G2C A;  3HRN A;  2FYU G;  5K5G B;  2ITA A;  1GZL A;  3U59 A;  1KYO H;  2XNX A;  3Q3D A;  3CX5 E;  3TDK A;  2WVR A;  1EC5 A;  3D70 A;  4PV1 C;  1JO5 A;  4D6T G;  2W8Z A;  1BE3 E;  2KXP B;  3E7K A;  4YTP C;  4DOJ A;  3TNU B;  3LW5 H;  3HUS C;  3MUD C;  3PJS K;  5KLV K;  1IO4 A;  4DCK A;  1JUN A;  4IOI H;  2KB7 P;  1LWU B;  4CPG A;  1OZH A;  5KLV E;  4WY4 D;  1IC2 A;  2WSE J;  1G1J A;  3L73 G;  1HJ0 A;  4LC1 A;  1S3J A;  1FJK A;  1QLE D;  3CCJ P;  3P8M C;  4EYY Q;  2YIU B;  3CCL P;  1R8E A;  3A5T A;  1OMI A;  1PPJ G;  1MFT A;  5AW2 B;  2AXT H;  2LXB A;  2NRG A;  5B66 H;  3FWN A;  2WSF H;  2ZYG A;  1J1D B;  1S5L X;  1S1C X;  1KC8 Q;  1EZV E;  1NJI Q;  4L76 A;  2OTK E;  1VPC A;  1DIP A;  4PD4 E;  2KS1 A;  2ZYD A;  2R44 A;  2G8Y A;  1NKZ B;  2QA4 P;  5AW3 B;  1NU1 E;  1LNQ A;  3G3Z A;  1N86 A;  3V5B A;  1YHQ P;  4GOD A;  2A45 G;  1NTK G;  2OYI A;  4W80 A;  3H1K E;  4ZKP A;  3H1H G;  3RBX A;  3ABV C;  5TJH A;  2W83 C;  3CCV P;  1BDC A;  3H1I G;  1QX8 A;  4YXW H;  2HPC B;  2ZT9 C;  2OTL P;  3HD7 C;  3MUD A;  5APV A;  4H44 B;  1RE4 A;  1M7L A;  1KYO E;  3RL0 D;  1R5L A;  2K37 A;  1HUC A;  4GOE A;  3M06 A;  3Q5S A;  1PFI A;  3CCS P;  1ZR2 A;  3BVH A;  4WB4 A;  2JKV A;  1BCC J;  1A02 J;  1H8A A;  1SQQ K;  3FWL A;  1J2J B;  1SQB D;  3G9R A;  3AE9 C;  4HH2 A;  1FDM A;  3OJA B;  4JYC A;  1L0N J;  5AW8 B;  1JEK A;  3BAT A;  1ZW0 A;  2Q1K A;  4RKU J;  1XTG B;  3IN6 A;  5EFW B;  2KP8 A;  1NHL A;  3F5H A;  3RK3 B;  2J59 M;  4Y99 C;  5BU8 B;  1S9K D;  3PHL A;  3H32 A;  1JMM A;  4TT3 H;  1SFC D;  1JY2 P;  3B4S A;  2FFD C;  3CWB E;  2KZJ A;  2DW3 A;  3C9I A;  1BCC D;  2HFE D;  2IBZ G;  1VQ7 P;  1CI6 A;  5B66 E;  1AVO A;  1NTM J;  2J58 A;  4JBZ A;  2JP3 A;  3L70 G;  1L0N D;  3HD7 A;  1NO4 A;  3EFF K;  2HLO A;  3H1L J;  4ASV A;  3TGU J;  3CI9 A;  3RK3 E;  2H8P D;  1SQX K;  1ZN5 A;  2WTY A;  1LTG C;  4HYT B;  2CPS A;  3NFQ A;  2IYP A;  2E75 D;  2HOD A;  2JR8 A;  1Q86 Q;  1K04 A;  4N78 E;  1L2P A;  3MP7 B;  1NTM D;  4L73 A;  1VQM P;  2B9B A;  1BE3 J;  2W6J H;  5CCH A;  2QG4 A;  1VF5 C;  2Y0E A;  2KSE A;  1PZQ A;  1OFC X;  1X9V A;  3AEC C;  3KZI H;  3PRJ A;  5CMZ A;  1VQ8 P;  5KLV J;  1JTH A;  2YNY A;  1EDI A;  1FBM A;  3G6E P;  1L4A B;  3CX5 D;  2SPZ A;  1CI6 B;  3TYY A;  3GHG B;  3TK1 A;  2QEX P;  2E75 C;  1K73 Q;  2KLU A;  1YIT P;  1ZP0 C;  1KFM A;  1KQG B;  1BE3 D;  3LID A;  2PFX A;  3L36 A;  3W68 A;  3WUV A;  5KKZ C;  4EI2 A;  4H13 D;  1LT9 A;  2Q3I A;  3B71 A;  2QSI A;  3RK2 D;  2JO1 A;  5KLV D;  1NU1 J;  4NPE A;  3V2Q A;  2XKM A;  4K3A A;  3D6Y A;  2D2C B;  3WUT A;  3B5N B;  2E74 B;  3TSI A;  2B89 A;  1KB9 I;  1T2K D;  3MGN A;  3O6Q A;  3A0B H;  1BSH A;  3I5C A;  4WWI A;  4B86 A;  4I7Z C;  3V6I A;  2O01 N;  1N73 C;  1FZC C;  2BCC J;  1EZV D;  2BEZ F;  2N1T A;  1VQ4 P;  4H13 C;  4OWF A;  4PD4 D;  1UII A;  5KAF H;  3AED C;  1Q90 D;  2O3J A;  2O1K A;  1NU1 D;  1MFZ A;  2WPR A;  3LW5 J;  2QIW A;  5CJ4 A;  5CBN A;  2IFN A;  1GU4 A;  3H1K D;  2QM7 A;  3KZI E;  3M0A A;  1AQT A;  4YXD C;  1H89 A;  1RE3 A;  1KQS O;  2NPS A;  2Q6Q A;  1LTT C;  2YKQ A;  1M57 D;  1SFC B;  3C8V A;  3AE6 C;  1KYO D;  2K9Y A;  3HE5 A;  3K5B A;  4NPF X;  1M90 Q;  2OYH B;  1LT9 B;  1HF9 A;  4U7J A;  1PP9 E;  1QEX A;  3NXS A;  3CC4 P;  1GDT A;  2WSF J;  4A7P A;  1YTZ I;  2MJZ A;  3T97 A;  1D7M A;  1LWU C;  1KIL C;  1BCC G;  1GU5 A;  2YMY A;  1LTS C;  4IL6 H;  4EDF A;  3EWK A;  3A3Y B;  1VQN P;  3S4R A;  4QMA A;  1FZC A;  4U3F J;  1CW5 A;  1L0N G;  2YIU C;  1LT1 A;  3LIE A;  2WPV B;  3CWB D;  5KLI B;  2BAS A;  3Q2Y A;  3A0B E;  1KB9 H;  1IK7 A;  3M0D C;  2ZJS E;  3OA7 A;  3B8E B;  1WRG A;  3M91 A;  1E5W A;  1GL2 A;  5KAF E;  3CCQ P;  1NTM G;  2KNC A;  1KOR A;  3IFM A;  3RK3 D;  1URQ C;  2QJY C;  1J1E B;  1SQV K;  4KHX A;  1QGK B;  2B87 B;  1AVY A;  4H44 C;  3H1L G;  1T6A A;  3L75 E;  3TGU G;  2P67 A;  1SQV E;  3U1C A;  5APT A;  1NOH A;  4DZO A;  3GF3 A;  4N78 D;  1RF0 A;  3SSU A;  4GIF A;  1L0L K;  1OW6 A;  1NTZ K;  3T97 B;  4I6M C;  5CCG C;  1YJN P;  1L0L E;  2K9J A;  2R3S A;  1AFO A;  1NTZ E; 
#chains in the Genus database with same CATH homology
 1KB9 H;  3CX5 H;  1SQB G;  4PD4 H;  1SQP G;  1BE3 G;  2A06 G;  1BGY G;  1SQX G;  3CWB G;  2FYU G;  1NTK G;  3L73 G;  2BCC G;  3L74 G;  1EZV G;  3CXH H;  3H1K G;  1L0N G;  3H1H G;  2IBZ G;  1P84 H;  1KYO H;  4U3F G;  3H1J G;  3BCC G;  3L72 G;  3L75 G;  3H1I G;  3H1L G;  1BCC G;  1L0L G;  3L71 G;  3TGU G;  3L70 G;  1NTZ G;  1SQV G;  1SQQ G;  5KLV G;  1PPJ G;  1NU1 G;  4D6T G;  1NTM G;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...