1BE3G

Cytochrome bc1 complex from bovine
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 19
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1be3G00
2A06G 1L0LG 1L0NG 3BCCG 1BE3G 1BCCG 3CXHH 3TGUG 2BCCG 3H1HG 1SQPG 3L73G 1P84H 1NTKG 3L75G 4PD4H 1KYOH 3L74G 3H1LG 2IBZG 1BGYG 2FYUG 1NU1G 1SQBG 3H1IG 1SQXG 5KLVG 1NTMG 3CWBG 4U3FG 1NTZG 1PP9G 1SQVG 3L71G 4D6TG 1PPJG 1EZVG 3H1KG 3L70G 1SQQG 1KB9H 3CX5H 3L72G 3H1JG
chains in the Genus database with same CATH superfamily
2JR8A 1IJDB 1PL5A 2NZ2A 1QL2A 2QJKC 3BRTB 4I6MC 3FGAD 3CCVP 2HR3A 2W83C 3KDPB 1R5LA 3VMXA 5B66E 4D6TD 4ASVA 5AW9B 4KJMA 3W68A 3CD6P 1OW7A 1SQPJ 2IYOA 3HTKB 2B89A 4PD4I 4RKUJ 2GA1A 3L75J 3R4YA 1L0ND 2WMMA 4BWNA 2E42A 3IF4A 3VMZA 1Y8AA 4HH2A 3H1HE 2KS1B 1IFIA 2WSSH 5AW1B 1JEKA 2R3CA 4DJGA 1RE3C 2XNDH 1FDMA 1OMIA 3CXHE 1OW8A 3L71G 4PJ0H 1RF0A 2FYZA 2HODB 2NPSB 1URQD 3ABVC 3KZIH 2WQYC 2AEJA 2Y0DA 2ZFCA 1YQ3C 2PGDA 1LWUC 1SQBD 2QSIA 1NAYA 2P10A 3BASA 3Q5PA 2K88A 1LNQA 1VF5B 2IDBA 1DX7A 5GTHE 1N7SA 2PRRA 3M9BA 2LXCB 4HKZH 1YTZT 5KJ7A 3L37A 1R5SA 4N3YB 1KFNA 1PGOA 4UB8H 4EI2A 1P84H 1NTKG 2D2CD 2WSEH 3MZWB 1GTWA 1AV1A 3BATA 1DH3A 3L72J 3CC2P 1KYOE 1GMJA 1SQXJ 1XTCC 4OVNF 3T97B 3A0BH 2Q7CA 1FZGA 4C7NA 1SQVE 1Y47A 1LP1B 3MHVA 2M5AA 4L73A 1VQNP 4I1LA 3CCRP 2P1JA 3HUSB 3QH9A 4W7YA 4AQRD 1VQMP 2JEEA 2YO2A 2C9LY 5CCGC 5B5EH 3ZDMA 4XE5B 1ZR2A 2KLUA 3JC22 1BE3D 2FFDB 1VQ4P 1G1JA 1AJYA 2HLOA 1RE4C 4MN4C 4WBAA 2A06G 1NU1K 2JP3A 3PH0A 3B5ND 3CX5D 3GF7A 1RE3A 3D71A 3D70A 4H13C 4AUWA 1S5LX 2QIWA 3CXHH 3TGUG 4IFMA 3CCEP 1ZW0A 2V4HA 1OXZA 4NPDA 2YIUC 2E75D 1L4AA 2Y0CA 2YIUB 3EQ2A 3HE5A 3CI9A 3L73J 5AVVB 3KHUA 4UB8E 2BCCJ 3CMEP 1QL1A 2I8DA 2YXQB 3HE4B 4WWIA 4C46A 1J1EC 1EDJA 3E1IA 4BRYA 2KXPB 3RGUA 5BU5A 3TF5A 4GKGA 2W6AA 3PRJA 5AVQB 1LTJB 1Q82Q 1NVOA 1PP9J 2WVRA 4RO0A 1SFCB 1GDTA 1IK7A 1NTZG 1VPCA 1GZLA 2P2UA 1D7MA 1EDIA 1SQVG 1NOHA 2FKWB 1JY2O 1G2CB 1M8OB 2OARA 2FYUK 2N9BA 3HD7C 1EC5A 3M0AA 5AW7B 1NJIQ 1KB9H 3FWLA 3MIWA 3TK1A 1AA0A 3HD7D 1BGYJ 1S3JA 3H1LE 4KHXA 5KAIE 1H89A 1JCCA 1RF0C 1YJWP 1N73A 1JNMA 4RJTA 1U57A 3LIDA 4RESB 1JM0A 2QG4A 1GU5A 5KKZB 1FDOA 1VQ9P 1FAVA 1L4AD 1YJ9P 1N8RQ 4GOFA 3F5HA 3L71D 4KT0J 2G8YA 1X22A 3RL0C 5CCGA 2IYPA 3U1CA 5AVUB 2OYIB 1SQPE 2XDJA 3CWBE 2OYIA 1SQBE 1URQC 3L74G 4OGQB 1FJPA 2O1KA 4OH8B 4H44B 2OGUA 1BDDA 2E5TA 1NU1G 2E75B 3H32A 2KB7P 4JPZB 1XTGB 2W6BA 3BCCJ 1SQXG 3CC4P 3H1JD 1LWUB 2XV5A 4ZKPA 2N1TC 3VTPC 1BCCJ 1M56D 2LR2A 1J1DC 5KLIC 4A7PA 5KJ7D 2Y9ZA 3G4SP 2RKLA 1EZVG 3WU2E 1Q81Q 2IZ1A 1AQTA 2OYHB 1LTSC 1NTMD 1RHZB 1T2KC 1N73B 4L75A 5AVSB 3PLNA 3CC7P 1YITP 1WMKA 1HJBA 2QRXA 3NFQA 1K73Q 5E79H 3GG2A 1QEXA 3OA7A 3BCCG 3WMM0 4D6TE 3SWFA 1LT9A 5AW0B 3Q1MA 3KYQA 3H1KJ 4K3AA 2OYHC 3EFGA 5KLVE 2Q9IA 1JUNA 4OGQD 1NHLA 3CXHD 1GK4A 1EDKA 2K37A 3D6ZA 4AYCA 1L4AB 2QJKB 1VQOP 5AW3B 1LTIC 1KORA 1VL2A 4YXDC 2OTLP 3TYYA 3A0BE 2E5YA 1KQSO 2E43A 5E79E 3AE8C 3AE5C 1NTKD 2Q3IA 3U59A 4PJ0E 3Q2YA 3FX0A 2BEQD 2I1JA 2B88A 1URQA 3WU2H 1SQBK 1KILB 4PV1C 4W7ZA 1NU1D 3U1AA 5CBNA 1KC8Q 1HWTC 5KKZC 2JDIH 3L74D 2OYOA 3V2PA 3CCSP 1FZEA 3HD7A 1FS0E 2KOGA 2N1TA 3M9HA 1RY3A 2Y9YA 3L70D 4L76A 1KV4A 1LTTC 1H0TB 2Y0EA 2KNCA 2IFNA 2KNCB 4N6JA 3AE9C 1IFDA 1NTZD 3NXSA 3V5BA 1N7LA 1SLQA 3FXDA 5TISH 1RF1A 1QVGO 3B5NC 2KP8A 2YO3A 1FZCB 3LW5J 2NRGA 5AVWB 4XA4A 2ZYGA 3AE2C 1K04A 3H1LG 3GW6A 3UIAA 2E76C 1L0LD 1PZQA 3K5BA 3MGNA 1NU1J 3PJSK 5KLVG 3B5NB 3AEBC 3L35A 1ZRTE 1L0NJ 3M9QA 2B9BA 2CPSA 2H8PD 2O01N 3H32B 1KFMA 4PD4D 2MJZA 5AW6B 4GT1A 5M1BA 2ZT9D 2O1JA 2OQQA 1Q2NA 3M0DA 5AW4B 2H88C 1ZV8A 3C9IA 5CCHD 1SQQG 3G71P 3L74E 1RF1B 3MUDC 3II6A 5AVRB 2N1TD 3H1JG 3A0HH 1JY3P 1OWAA 1L0LG 1PGQA 1SFCD 1AVYA 4U7JA 3CCMP 4N78D 1USDA 2JWAA 2WPSA 4IL6H 1VQLP 4DZOA 4IOIH 3A5TA 1NTKE 4L74A 1YI2P 2AXTH 1G1IA 1S4XA 3P8CE 4NPEA 5B66H 2KYVA 3ITKA 5KLVD 3CWBJ 1IZNB 1T8ZA 2WPQA 3RL0D 5AW8B 3H1IG 3M06A 3AECC 3L36A 3H6PA 1FU1A 3FXEA 3IR9A 5KAFE 2POHA 3AEDC 4U3FJ 1IC2A 2ZXXA 1ZMEC 1ZRTD 2C0XA 3B4SA 3L73E 2WSFJ 2YKPA 3C1LA 1MZ9A 3H1IJ 2D2CC 3VMYA 1S9KE 1QX8A 1FZBA 2K9YA 2H89C 2WZ7A 2IBZD 3CX5E 2L5GB 4QMAA 1VF5C 1SQQE 2IZ0A 1FZCA 1NTMJ 1NTZJ 2VRSA 2KIKA 2E75C 3PHLA 2YKOA 3I55P 3L70J 3CWBD 5KLVJ 1S5LE 1DIPA 1SS1A 4UB6E 4WB4A 1BE3J 3RL0B 3N7NA 2FYUJ 3H1JE 1PPJE 4H0LD 4H44D 5B5EE 2KZIA 4U3FD 2WSEJ 1KQFB 4EOTA 1KB9I 4WY4B 5H2FE 3Q5RA 1H88A 1RF1C 3BCCD 1OIPA 4IFDK 1JB0J 4YTPC 1JY3O 1ZLLA 1DD3A 3S1KA 1FZAA 1R8EA 1CZQA 1SFCA 5TJHA 3T97A 1FOSE 3CL3D 1NO4A 1S2EA 2O01H 1YTZI 3HD7B 3PP5A 1GW4A 1DD4A 3V2NA 2HODA 2NPSA 2E76D 2WWWA 1EXIA 3HE5B 4K35A 5H2FH 3CX5H 1KQGB 1LTJC 3G6EP 1M1JC 2W90A 3C8VA 4O9BA 3JCUE 4LC1A 1BGYD 3H1KD 2E74C 1PFIA 1YIJP 2QJPB 1LT9B 3CLQA 3GHGC 5K5GB 3OJAB 4EYYQ 1SVFA 2QM8A 3MD0A 1JCDA 1SQPG 4I7ZC 2ZT9C 1PP9D 1G2CA 4R4LA 2H43A 2KI7B 2QJYC 3VMAA 3FWNA 1LTGC 3WUVA 5CCHC 1HGVA 1GK6A 1KTMA 1P84D 2LKMA 5DJTB 3SFEC 3P8MC 2AXCA 2FBWC 1CI6B 3TDKA 1AFOA 1S1CX 3AE6C 4BRYB 1LP1A 1QGKB 4UB6H 4C7NB 1KB9D 1EZVE 2KUBA 2KZJA 3GLMA 1S5LH 1VQPP 1EQ7A 3G9RA 2GUVA 4CPGA 1YBKA 3L70G 1L4AC 4NPFX 4Y28J 1RQVA 2WITA 1KQLA 1L2PA 2FFDC 2W8ZA 2KK7A 3A7OA 3H1ID 1K9MQ 2ITAA 2IPPA 1HH0A 1NTMK 3AE3C 1NTZK 1KYOD 1U7JA 1YYCA 2RN0A 2IBZI 1BCCG 3VOPA 4IL6E 2SPZA 2YMYA 4M3LA 1J2JB 1SQVD 2V7QJ 3H1HG 1LGHB 2K9JA 2YMKA 3L73G 2RMZA 3TNUB 2ZXEB 2CPBA 2P67A 1OX3A 3VP8A 1CSBA 4H13D 2A06E 2KSJA 3L72D 1PGJA 3LIEA 2RH0A 1HBWA 5DJUB 4BXLA 4Z1MH 1HJ0A 5AVXB 2M8RA 2N1TB 4WY4A 2JJLA 2J59M 3W67A 4JQ0D 1KILA 1JY2N 1PPJG 2WSCJ 5CCHA 4YPCA 1KB9E 1Q90D 3EWKA 4H44C 2PAJA 4OGQC 2P7JA 3A0HE 3MP7B 1LT9C 3AE7C 4YXWH 1NKNA 2NPSC 3RK3C 2UWJE 4TT3H 1PIXA 2R3SA 1GL2B 1L0NE 3A3YB 5CHXA 1BE3G 1JMBA 1LTJA 1M1JA 1OW6A 1M1JB 1EZVD 1QLED 1TU3F 2QE7H 3M91A 3CMAP 3CPWO 1AQ5A 2AEMA 3B71A 1BCCE 4ZNCA 2FY8A 1OVUA 5KTBA 2KLVA 1P84E 1L0LJ 3L74J 2HPCA 3GHGA 1K05A 2HPCB 2FFDA 1SQQK 3PTZA 4EIJA 2IBZG 2FYUG 1GL2C 3V6IA 1Q86Q 1ZXGA 1VQKP 3P7KA 4HYTB 1A02J 1M57D 1MV8A 2W27A 2M5AB 5KJ7C 3CWBG 1N2DC 2Q3EA 1NKZB 2L91A 1PP9G 2R5BA 2JWDA 1AVOA 3L4FA 5APXA 3H25A 1NTKK 2WSFH 3H1KE 3VP9A 3L72E 4IFFA 1J1EB 3RK3E 3TGUD 1ZOYC 2YKQA 2QJYB 4ZKUA 3CCUP 2C0WA 2K9JB 3IAOA 3WUTA 1OVVA 2ZT9B 1KD1Q 1EDLA 2DW3A 3GMAA 2M3BA 4R4MA 3B5NA 1E79H 1USEA 1SQVK 2QM7A 1ZP0C 4IL6X 4H13B 5APTA 2QJPC 2FYNB 3WUUA 4U3FE 1T3JA 4GIFA 3TGUJ 5AVYB 1PPJD 5KAFH 1E5WA 4WY4D 5CJ0A 2E74D 2R44A 3G3ZA 4DT0A 2ZAEB 2MKVA 1X8YA 3H1IE 4PD4E 3LW5H 3BCCE 2QVAA 1KZUB 3OAKA 2WT7B 1OFCX 2H7HA 1SQQD 2A45I 4ZMDA 2Q6QA 1L0NK 1N7SB 2IBZE 3HUSC 4HB1A 2XNXA 1RH5B 2ZJSE 2WPVB 2YXRB 3L73D 5BU8B 3H1HD 2BCCE 4I2LC 1VQ8P 1BSNA 1T3UA 1SP4A 2NPSD 4LLHA 3KZIE 2WSCH 5APWA 1KILD 5AVZB 2N9YB 5AW2B 4WY4C 4ASWA 1HUCA 3L72G 3CXHI 1S9KD 1KILC 1GW3A 5EFWB 3S9OA 1W2EA 3JSVC 1PP9E 2HG5D 2O01J 1HGZA 3A2AA 3H1HJ 3AEGC 1NU1E 1RE4A 1JOCA 4LGDE 4H0LC 3SWYA 1FBMA 1KYOI 1OVRA 5CCGD 1A02F 2XZRA 4I7ZB 1MFTA 3D6YA 1BGYE 3E7KA 3L75G 3AEFC 5GTIH 3HTKA 3HRNA 1FZFA 1L0LK 2WTYA 2D2CB 1MUUA 1H8AA 2J58A 1KN7A 2W6JH 3MUDA 2E74B 1HF9A 1ZR4A 2PP6A 1LTBC 3V4QA 1VF5D 1JTHA 2HYNA 2A45H 3NMDA 3L71J 1GL2A 2C9NY 3SSUA 1NGMB 3V2QA 1KMIZ 3KQGA 1HTLC 1LTAC 1JY3N 4JBZA 1NH4A 4HJGH 3V2RA 4D6TG 1JMMA 1FZCC 2B87A 2JO1A 1LJ2A 1NAFA 1P84I 1SQPK 1Y9BA 2Z5IA 2ZVOB 3IN6A 1EXJA 1IFPA 3VN0A 3AE4C 3BRVB 2FYUD 4GDOA 4PV1D 1SQXK 4W80A 3GF3A 2M3EA 3HUSA 2Q5UA 3L75D 1FJKA 1IK9A 1IO4A 3SWKA 1VQ6P 1IFMA 5C39A 1KILE 1X79B 2WPRA 2XKMA 5KLVK 3CCLP 3CX5I 3O8ZA 4Y99B 2V7QH 4Y99C 3AEAC 3NTNA 5APYA 1L0LE 2ZYDA 1FE6A 2Q1KA 1KYOH 3N4XA 2ZYAA 4TLFA 1WRGA 2LXBA 1BGYG 1LT1A 2BEZF 1T6AA 2ZVNB 3JCUH 1PV3A 3L75E 4WVZA 3CCQP 3IFMA 1N86A 3Q3DA 2OYIC 1GL2D 4DCKA 2J5UA 3AE1C 1NTMG 1S72P 3P32A 2HFED 1NTZE 1QVFO 2XU6A 4U3FG 1DEBA 1SQPD 5GTHH 3KXDA 5TISE 2QA4P 3F89A 3L70E 1GD2E 2E76B 2GUSA 4B86A 1Z56A 3I5CA 2OTKE 1SQXD 5APVA 1IFNA 1EZVI 1VQ7P 3RL0g 3AEEC 3I56P 2KS1A 1H0TA 3R2PA 3RK3B 1JY2P 2M0BA 1CI6A 1PGPA 3H1LD 3P8CD 3TSIA 2K3RA 1N73C 2BASA 1SFCC 1VQ5P 2AEFA 2FXMA 2BCCG 3E1RA 4N78E 3RK2D 5CJ4A 3CCJP 1NTKJ 2B87B 2PFXA 4H0LB 1T2KD 2GM4A 4PD4H 3VYIA 2OYHA 1RQUA 3RK2B 5L8RJ 1WT6A 2I1KA 4JYCA 1M1KQ 1SQXE 1SQBG 5APSA 1FC2C 3BVHA 3USSA 4JF7A 1W2BO 1UIIA 1SQVJ 2CK3H 1W5CE 2JKVA 2O3JA 5AW5B 1GU4A 1UIXA 1HVVA 2P58A 2Z5HA 1CW5A 2BCCD 1BCCD 3S4RA 5CMZA 2FXPA 2YNYA 1X9VA 1SQBJ 1SQQJ 5KAIH 3RK2C 1BSHA 1NTME 1OZHA 3O6QB 1N7SC 4DOJA 1YHQP 2A45G 5BVZA 3OW2O 1L0NG 3RBZA 1YJNP 1N7SD 2QEXP 1IFJA 2G3AA 2KSEA 1YQ4C 1BE3E 1BDCA 4C7RA 1DEEG 2AXTE 2R5DA 1Q7YQ 1NWQA 3M0DC 1JO5A 1VDFA 1M7LA 4OWFA 4XFJA 3MTUE 1MKMA 5GTIE 3Q5SA 2FYUE 3H1JJ 4GOEA 2K1AA 1FDIA 2A06D 3KPEA 3B8EB 1LWUA 1M90Q 3QWOC 4GODA 2WT7A 1J1DB 3L71E 4D6TJ 2IFMA 5KLIB 3V4WA 1NYHA 1MFZA 2FYNC 4PV1B 5AVTB 3RK3D 3TGUE 4JYBA 1JTHB 1U7MA 2IX7C 5APQA 1FOSF 3TNUA 2R32A 3O6QA 5APUA 4EDFA 5CBOA 3RBXA 2Z4EA 3H1KG 3HE4A 1K8AQ 1ZN5A 2OTJP 3GHGB 1URQB 3SFDC 3H1LJ 1X0TA 3EFFK 2FXOA
chains in the Genus database with same CATH topology
2A06G 1L0LG 1L0NG 3BCCG 1BE3G 1BCCG 3CXHH 3TGUG 2BCCG 3H1HG 1SQPG 3L73G 1P84H 1NTKG 3L75G 4PD4H 1KYOH 3L74G 3H1LG 2IBZG 1BGYG 2FYUG 1NU1G 1SQBG 3H1IG 1SQXG 5KLVG 1NTMG 3CWBG 4U3FG 1NTZG 1PP9G 1SQVG 3L71G 4D6TG 1PPJG 1EZVG 3H1KG 3L70G 1SQQG 1KB9H 3CX5H 3L72G 3H1JG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 G;  1L0L G;  1L0N G;  3BCC G;  1BE3 G;  1BCC G;  3CXH H;  3TGU G;  2BCC G;  3H1H G;  1SQP G;  3L73 G;  1P84 H;  1NTK G;  3L75 G;  4PD4 H;  1KYO H;  3L74 G;  3H1L G;  2IBZ G;  1BGY G;  2FYU G;  1NU1 G;  1SQB G;  3H1I G;  1SQX G;  5KLV G;  1NTM G;  3CWB G;  4U3F G;  1NTZ G;  1PP9 G;  1SQV G;  3L71 G;  4D6T G;  1PPJ G;  1EZV G;  3H1K G;  3L70 G;  1SQQ G;  1KB9 H;  3CX5 H;  3L72 G;  3H1J G; 
#chains in the Genus database with same CATH topology
 2JR8 A;  1IJD B;  1PL5 A;  2NZ2 A;  1QL2 A;  2QJK C;  3BRT B;  4I6M C;  3FGA D;  3CCV P;  2HR3 A;  2W83 C;  3KDP B;  1R5L A;  3VMX A;  5B66 E;  4D6T D;  4ASV A;  5AW9 B;  4KJM A;  3W68 A;  3CD6 P;  1OW7 A;  1SQP J;  2IYO A;  3HTK B;  2B89 A;  4PD4 I;  4RKU J;  2GA1 A;  3L75 J;  3R4Y A;  1L0N D;  2WMM A;  4BWN A;  2E42 A;  3IF4 A;  3VMZ A;  1Y8A A;  4HH2 A;  3H1H E;  2KS1 B;  1IFI A;  2WSS H;  5AW1 B;  1JEK A;  2R3C A;  4DJG A;  1RE3 C;  2XND H;  1FDM A;  1OMI A;  3CXH E;  1OW8 A;  3L71 G;  4PJ0 H;  1RF0 A;  2FYZ A;  2HOD B;  2NPS B;  1URQ D;  3ABV C;  3KZI H;  2WQY C;  2AEJ A;  2Y0D A;  2ZFC A;  1YQ3 C;  2PGD A;  1LWU C;  1SQB D;  2QSI A;  1NAY A;  2P10 A;  3BAS A;  3Q5P A;  2K88 A;  1LNQ A;  1VF5 B;  2IDB A;  1DX7 A;  5GTH E;  1N7S A;  2PRR A;  3M9B A;  2LXC B;  4HKZ H;  1YTZ T;  5KJ7 A;  3L37 A;  1R5S A;  4N3Y B;  1KFN A;  1PGO A;  4UB8 H;  4EI2 A;  1P84 H;  1NTK G;  2D2C D;  2WSE H;  3MZW B;  1GTW A;  1AV1 A;  3BAT A;  1DH3 A;  3L72 J;  3CC2 P;  1KYO E;  1GMJ A;  1SQX J;  1XTC C;  4OVN F;  3T97 B;  3A0B H;  2Q7C A;  1FZG A;  4C7N A;  1SQV E;  1Y47 A;  1LP1 B;  3MHV A;  2M5A A;  4L73 A;  1VQN P;  4I1L A;  3CCR P;  2P1J A;  3HUS B;  3QH9 A;  4W7Y A;  4AQR D;  1VQM P;  2JEE A;  2YO2 A;  2C9L Y;  5CCG C;  5B5E H;  3ZDM A;  4XE5 B;  1ZR2 A;  2KLU A;  3JC2 2;  1BE3 D;  2FFD B;  1VQ4 P;  1G1J A;  1AJY A;  2HLO A;  1RE4 C;  4MN4 C;  4WBA A;  2A06 G;  1NU1 K;  2JP3 A;  3PH0 A;  3B5N D;  3CX5 D;  3GF7 A;  1RE3 A;  3D71 A;  3D70 A;  4H13 C;  4AUW A;  1S5L X;  2QIW A;  3CXH H;  3TGU G;  4IFM A;  3CCE P;  1ZW0 A;  2V4H A;  1OXZ A;  4NPD A;  2YIU C;  2E75 D;  1L4A A;  2Y0C A;  2YIU B;  3EQ2 A;  3HE5 A;  3CI9 A;  3L73 J;  5AVV B;  3KHU A;  4UB8 E;  2BCC J;  3CME P;  1QL1 A;  2I8D A;  2YXQ B;  3HE4 B;  4WWI A;  4C46 A;  1J1E C;  1EDJ A;  3E1I A;  4BRY A;  2KXP B;  3RGU A;  5BU5 A;  3TF5 A;  4GKG A;  2W6A A;  3PRJ A;  5AVQ B;  1LTJ B;  1Q82 Q;  1NVO A;  1PP9 J;  2WVR A;  4RO0 A;  1SFC B;  1GDT A;  1IK7 A;  1NTZ G;  1VPC A;  1GZL A;  2P2U A;  1D7M A;  1EDI A;  1SQV G;  1NOH A;  2FKW B;  1JY2 O;  1G2C B;  1M8O B;  2OAR A;  2FYU K;  2N9B A;  3HD7 C;  1EC5 A;  3M0A A;  5AW7 B;  1NJI Q;  1KB9 H;  3FWL A;  3MIW A;  3TK1 A;  1AA0 A;  3HD7 D;  1BGY J;  1S3J A;  3H1L E;  4KHX A;  5KAI E;  1H89 A;  1JCC A;  1RF0 C;  1YJW P;  1N73 A;  1JNM A;  4RJT A;  1U57 A;  3LID A;  4RES B;  1JM0 A;  2QG4 A;  1GU5 A;  5KKZ B;  1FDO A;  1VQ9 P;  1FAV A;  1L4A D;  1YJ9 P;  1N8R Q;  4GOF A;  3F5H A;  3L71 D;  4KT0 J;  2G8Y A;  1X22 A;  3RL0 C;  5CCG A;  2IYP A;  3U1C A;  5AVU B;  2OYI B;  1SQP E;  2XDJ A;  3CWB E;  2OYI A;  1SQB E;  1URQ C;  3L74 G;  4OGQ B;  1FJP A;  2O1K A;  4OH8 B;  4H44 B;  2OGU A;  1BDD A;  2E5T A;  1NU1 G;  2E75 B;  3H32 A;  2KB7 P;  4JPZ B;  1XTG B;  2W6B A;  3BCC J;  1SQX G;  3CC4 P;  3H1J D;  1LWU B;  2XV5 A;  4ZKP A;  2N1T C;  3VTP C;  1BCC J;  1M56 D;  2LR2 A;  1J1D C;  5KLI C;  4A7P A;  5KJ7 D;  2Y9Z A;  3G4S P;  2RKL A;  1EZV G;  3WU2 E;  1Q81 Q;  2IZ1 A;  1AQT A;  2OYH B;  1LTS C;  1NTM D;  1RHZ B;  1T2K C;  1N73 B;  4L75 A;  5AVS B;  3PLN A;  3CC7 P;  1YIT P;  1WMK A;  1HJB A;  2QRX A;  3NFQ A;  1K73 Q;  5E79 H;  3GG2 A;  1QEX A;  3OA7 A;  3BCC G;  3WMM 0;  4D6T E;  3SWF A;  1LT9 A;  5AW0 B;  3Q1M A;  3KYQ A;  3H1K J;  4K3A A;  2OYH C;  3EFG A;  5KLV E;  2Q9I A;  1JUN A;  4OGQ D;  1NHL A;  3CXH D;  1GK4 A;  1EDK A;  2K37 A;  3D6Z A;  4AYC A;  1L4A B;  2QJK B;  1VQO P;  5AW3 B;  1LTI C;  1KOR A;  1VL2 A;  4YXD C;  2OTL P;  3TYY A;  3A0B E;  2E5Y A;  1KQS O;  2E43 A;  5E79 E;  3AE8 C;  3AE5 C;  1NTK D;  2Q3I A;  3U59 A;  4PJ0 E;  3Q2Y A;  3FX0 A;  2BEQ D;  2I1J A;  2B88 A;  1URQ A;  3WU2 H;  1SQB K;  1KIL B;  4PV1 C;  4W7Z A;  1NU1 D;  3U1A A;  5CBN A;  1KC8 Q;  1HWT C;  5KKZ C;  2JDI H;  3L74 D;  2OYO A;  3V2P A;  3CCS P;  1FZE A;  3HD7 A;  1FS0 E;  2KOG A;  2N1T A;  3M9H A;  1RY3 A;  2Y9Y A;  3L70 D;  4L76 A;  1KV4 A;  1LTT C;  1H0T B;  2Y0E A;  2KNC A;  2IFN A;  2KNC B;  4N6J A;  3AE9 C;  1IFD A;  1NTZ D;  3NXS A;  3V5B A;  1N7L A;  1SLQ A;  3FXD A;  5TIS H;  1RF1 A;  1QVG O;  3B5N C;  2KP8 A;  2YO3 A;  1FZC B;  3LW5 J;  2NRG A;  5AVW B;  4XA4 A;  2ZYG A;  3AE2 C;  1K04 A;  3H1L G;  3GW6 A;  3UIA A;  2E76 C;  1L0L D;  1PZQ A;  3K5B A;  3MGN A;  1NU1 J;  3PJS K;  5KLV G;  3B5N B;  3AEB C;  3L35 A;  1ZRT E;  1L0N J;  3M9Q A;  2B9B A;  2CPS A;  2H8P D;  2O01 N;  3H32 B;  1KFM A;  4PD4 D;  2MJZ A;  5AW6 B;  4GT1 A;  5M1B A;  2ZT9 D;  2O1J A;  2OQQ A;  1Q2N A;  3M0D A;  5AW4 B;  2H88 C;  1ZV8 A;  3C9I A;  5CCH D;  1SQQ G;  3G71 P;  3L74 E;  1RF1 B;  3MUD C;  3II6 A;  5AVR B;  2N1T D;  3H1J G;  3A0H H;  1JY3 P;  1OWA A;  1L0L G;  1PGQ A;  1SFC D;  1AVY A;  4U7J A;  3CCM P;  4N78 D;  1USD A;  2JWA A;  2WPS A;  4IL6 H;  1VQL P;  4DZO A;  4IOI H;  3A5T A;  1NTK E;  4L74 A;  1YI2 P;  2AXT H;  1G1I A;  1S4X A;  3P8C E;  4NPE A;  5B66 H;  2KYV A;  3ITK A;  5KLV D;  3CWB J;  1IZN B;  1T8Z A;  2WPQ A;  3RL0 D;  5AW8 B;  3H1I G;  3M06 A;  3AEC C;  3L36 A;  3H6P A;  1FU1 A;  3FXE A;  3IR9 A;  5KAF E;  2POH A;  3AED C;  4U3F J;  1IC2 A;  2ZXX A;  1ZME C;  1ZRT D;  2C0X A;  3B4S A;  3L73 E;  2WSF J;  2YKP A;  3C1L A;  1MZ9 A;  3H1I J;  2D2C C;  3VMY A;  1S9K E;  1QX8 A;  1FZB A;  2K9Y A;  2H89 C;  2WZ7 A;  2IBZ D;  3CX5 E;  2L5G B;  4QMA A;  1VF5 C;  1SQQ E;  2IZ0 A;  1FZC A;  1NTM J;  1NTZ J;  2VRS A;  2KIK A;  2E75 C;  3PHL A;  2YKO A;  3I55 P;  3L70 J;  3CWB D;  5KLV J;  1S5L E;  1DIP A;  1SS1 A;  4UB6 E;  4WB4 A;  1BE3 J;  3RL0 B;  3N7N A;  2FYU J;  3H1J E;  1PPJ E;  4H0L D;  4H44 D;  5B5E E;  2KZI A;  4U3F D;  2WSE J;  1KQF B;  4EOT A;  1KB9 I;  4WY4 B;  5H2F E;  3Q5R A;  1H88 A;  1RF1 C;  3BCC D;  1OIP A;  4IFD K;  1JB0 J;  4YTP C;  1JY3 O;  1ZLL A;  1DD3 A;  3S1K A;  1FZA A;  1R8E A;  1CZQ A;  1SFC A;  5TJH A;  3T97 A;  1FOS E;  3CL3 D;  1NO4 A;  1S2E A;  2O01 H;  1YTZ I;  3HD7 B;  3PP5 A;  1GW4 A;  1DD4 A;  3V2N A;  2HOD A;  2NPS A;  2E76 D;  2WWW A;  1EXI A;  3HE5 B;  4K35 A;  5H2F H;  3CX5 H;  1KQG B;  1LTJ C;  3G6E P;  1M1J C;  2W90 A;  3C8V A;  4O9B A;  3JCU E;  4LC1 A;  1BGY D;  3H1K D;  2E74 C;  1PFI A;  1YIJ P;  2QJP B;  1LT9 B;  3CLQ A;  3GHG C;  5K5G B;  3OJA B;  4EYY Q;  1SVF A;  2QM8 A;  3MD0 A;  1JCD A;  1SQP G;  4I7Z C;  2ZT9 C;  1PP9 D;  1G2C A;  4R4L A;  2H43 A;  2KI7 B;  2QJY C;  3VMA A;  3FWN A;  1LTG C;  3WUV A;  5CCH C;  1HGV A;  1GK6 A;  1KTM A;  1P84 D;  2LKM A;  5DJT B;  3SFE C;  3P8M C;  2AXC A;  2FBW C;  1CI6 B;  3TDK A;  1AFO A;  1S1C X;  3AE6 C;  4BRY B;  1LP1 A;  1QGK B;  4UB6 H;  4C7N B;  1KB9 D;  1EZV E;  2KUB A;  2KZJ A;  3GLM A;  1S5L H;  1VQP P;  1EQ7 A;  3G9R A;  2GUV A;  4CPG A;  1YBK A;  3L70 G;  1L4A C;  4NPF X;  4Y28 J;  1RQV A;  2WIT A;  1KQL A;  1L2P A;  2FFD C;  2W8Z A;  2KK7 A;  3A7O A;  3H1I D;  1K9M Q;  2ITA A;  2IPP A;  1HH0 A;  1NTM K;  3AE3 C;  1NTZ K;  1KYO D;  1U7J A;  1YYC A;  2RN0 A;  2IBZ I;  1BCC G;  3VOP A;  4IL6 E;  2SPZ A;  2YMY A;  4M3L A;  1J2J B;  1SQV D;  2V7Q J;  3H1H G;  1LGH B;  2K9J A;  2YMK A;  3L73 G;  2RMZ A;  3TNU B;  2ZXE B;  2CPB A;  2P67 A;  1OX3 A;  3VP8 A;  1CSB A;  4H13 D;  2A06 E;  2KSJ A;  3L72 D;  1PGJ A;  3LIE A;  2RH0 A;  1HBW A;  5DJU B;  4BXL A;  4Z1M H;  1HJ0 A;  5AVX B;  2M8R A;  2N1T B;  4WY4 A;  2JJL A;  2J59 M;  3W67 A;  4JQ0 D;  1KIL A;  1JY2 N;  1PPJ G;  2WSC J;  5CCH A;  4YPC A;  1KB9 E;  1Q90 D;  3EWK A;  4H44 C;  2PAJ A;  4OGQ C;  2P7J A;  3A0H E;  3MP7 B;  1LT9 C;  3AE7 C;  4YXW H;  1NKN A;  2NPS C;  3RK3 C;  2UWJ E;  4TT3 H;  1PIX A;  2R3S A;  1GL2 B;  1L0N E;  3A3Y B;  5CHX A;  1BE3 G;  1JMB A;  1LTJ A;  1M1J A;  1OW6 A;  1M1J B;  1EZV D;  1QLE D;  1TU3 F;  2QE7 H;  3M91 A;  3CMA P;  3CPW O;  1AQ5 A;  2AEM A;  3B71 A;  1BCC E;  4ZNC A;  2FY8 A;  1OVU A;  5KTB A;  2KLV A;  1P84 E;  1L0L J;  3L74 J;  2HPC A;  3GHG A;  1K05 A;  2HPC B;  2FFD A;  1SQQ K;  3PTZ A;  4EIJ A;  2IBZ G;  2FYU G;  1GL2 C;  3V6I A;  1Q86 Q;  1ZXG A;  1VQK P;  3P7K A;  4HYT B;  1A02 J;  1M57 D;  1MV8 A;  2W27 A;  2M5A B;  5KJ7 C;  3CWB G;  1N2D C;  2Q3E A;  1NKZ B;  2L91 A;  1PP9 G;  2R5B A;  2JWD A;  1AVO A;  3L4F A;  5APX A;  3H25 A;  1NTK K;  2WSF H;  3H1K E;  3VP9 A;  3L72 E;  4IFF A;  1J1E B;  3RK3 E;  3TGU D;  1ZOY C;  2YKQ A;  2QJY B;  4ZKU A;  3CCU P;  2C0W A;  2K9J B;  3IAO A;  3WUT A;  1OVV A;  2ZT9 B;  1KD1 Q;  1EDL A;  2DW3 A;  3GMA A;  2M3B A;  4R4M A;  3B5N A;  1E79 H;  1USE A;  1SQV K;  2QM7 A;  1ZP0 C;  4IL6 X;  4H13 B;  5APT A;  2QJP C;  2FYN B;  3WUU A;  4U3F E;  1T3J A;  4GIF A;  3TGU J;  5AVY B;  1PPJ D;  5KAF H;  1E5W A;  4WY4 D;  5CJ0 A;  2E74 D;  2R44 A;  3G3Z A;  4DT0 A;  2ZAE B;  2MKV A;  1X8Y A;  3H1I E;  4PD4 E;  3LW5 H;  3BCC E;  2QVA A;  1KZU B;  3OAK A;  2WT7 B;  1OFC X;  2H7H A;  1SQQ D;  2A45 I;  4ZMD A;  2Q6Q A;  1L0N K;  1N7S B;  2IBZ E;  3HUS C;  4HB1 A;  2XNX A;  1RH5 B;  2ZJS E;  2WPV B;  2YXR B;  3L73 D;  5BU8 B;  3H1H D;  2BCC E;  4I2L C;  1VQ8 P;  1BSN A;  1T3U A;  1SP4 A;  2NPS D;  4LLH A;  3KZI E;  2WSC H;  5APW A;  1KIL D;  5AVZ B;  2N9Y B;  5AW2 B;  4WY4 C;  4ASW A;  1HUC A;  3L72 G;  3CXH I;  1S9K D;  1KIL C;  1GW3 A;  5EFW B;  3S9O A;  1W2E A;  3JSV C;  1PP9 E;  2HG5 D;  2O01 J;  1HGZ A;  3A2A A;  3H1H J;  3AEG C;  1NU1 E;  1RE4 A;  1JOC A;  4LGD E;  4H0L C;  3SWY A;  1FBM A;  1KYO I;  1OVR A;  5CCG D;  1A02 F;  2XZR A;  4I7Z B;  1MFT A;  3D6Y A;  1BGY E;  3E7K A;  3L75 G;  3AEF C;  5GTI H;  3HTK A;  3HRN A;  1FZF A;  1L0L K;  2WTY A;  2D2C B;  1MUU A;  1H8A A;  2J58 A;  1KN7 A;  2W6J H;  3MUD A;  2E74 B;  1HF9 A;  1ZR4 A;  2PP6 A;  1LTB C;  3V4Q A;  1VF5 D;  1JTH A;  2HYN A;  2A45 H;  3NMD A;  3L71 J;  1GL2 A;  2C9N Y;  3SSU A;  1NGM B;  3V2Q A;  1KMI Z;  3KQG A;  1HTL C;  1LTA C;  1JY3 N;  4JBZ A;  1NH4 A;  4HJG H;  3V2R A;  4D6T G;  1JMM A;  1FZC C;  2B87 A;  2JO1 A;  1LJ2 A;  1NAF A;  1P84 I;  1SQP K;  1Y9B A;  2Z5I A;  2ZVO B;  3IN6 A;  1EXJ A;  1IFP A;  3VN0 A;  3AE4 C;  3BRV B;  2FYU D;  4GDO A;  4PV1 D;  1SQX K;  4W80 A;  3GF3 A;  2M3E A;  3HUS A;  2Q5U A;  3L75 D;  1FJK A;  1IK9 A;  1IO4 A;  3SWK A;  1VQ6 P;  1IFM A;  5C39 A;  1KIL E;  1X79 B;  2WPR A;  2XKM A;  5KLV K;  3CCL P;  3CX5 I;  3O8Z A;  4Y99 B;  2V7Q H;  4Y99 C;  3AEA C;  3NTN A;  5APY A;  1L0L E;  2ZYD A;  1FE6 A;  2Q1K A;  1KYO H;  3N4X A;  2ZYA A;  4TLF A;  1WRG A;  2LXB A;  1BGY G;  1LT1 A;  2BEZ F;  1T6A A;  2ZVN B;  3JCU H;  1PV3 A;  3L75 E;  4WVZ A;  3CCQ P;  3IFM A;  1N86 A;  3Q3D A;  2OYI C;  1GL2 D;  4DCK A;  2J5U A;  3AE1 C;  1NTM G;  1S72 P;  3P32 A;  2HFE D;  1NTZ E;  1QVF O;  2XU6 A;  4U3F G;  1DEB A;  1SQP D;  5GTH H;  3KXD A;  5TIS E;  2QA4 P;  3F89 A;  3L70 E;  1GD2 E;  2E76 B;  2GUS A;  4B86 A;  1Z56 A;  3I5C A;  2OTK E;  1SQX D;  5APV A;  1IFN A;  1EZV I;  1VQ7 P;  3RL0 g;  3AEE C;  3I56 P;  2KS1 A;  1H0T A;  3R2P A;  3RK3 B;  1JY2 P;  2M0B A;  1CI6 A;  1PGP A;  3H1L D;  3P8C D;  3TSI A;  2K3R A;  1N73 C;  2BAS A;  1SFC C;  1VQ5 P;  2AEF A;  2FXM A;  2BCC G;  3E1R A;  4N78 E;  3RK2 D;  5CJ4 A;  3CCJ P;  1NTK J;  2B87 B;  2PFX A;  4H0L B;  1T2K D;  2GM4 A;  4PD4 H;  3VYI A;  2OYH A;  1RQU A;  3RK2 B;  5L8R J;  1WT6 A;  2I1K A;  4JYC A;  1M1K Q;  1SQX E;  1SQB G;  5APS A;  1FC2 C;  3BVH A;  3USS A;  4JF7 A;  1W2B O;  1UII A;  1SQV J;  2CK3 H;  1W5C E;  2JKV A;  2O3J A;  5AW5 B;  1GU4 A;  1UIX A;  1HVV A;  2P58 A;  2Z5H A;  1CW5 A;  2BCC D;  1BCC D;  3S4R A;  5CMZ A;  2FXP A;  2YNY A;  1X9V A;  1SQB J;  1SQQ J;  5KAI H;  3RK2 C;  1BSH A;  1NTM E;  1OZH A;  3O6Q B;  1N7S C;  4DOJ A;  1YHQ P;  2A45 G;  5BVZ A;  3OW2 O;  1L0N G;  3RBZ A;  1YJN P;  1N7S D;  2QEX P;  1IFJ A;  2G3A A;  2KSE A;  1YQ4 C;  1BE3 E;  1BDC A;  4C7R A;  1DEE G;  2AXT E;  2R5D A;  1Q7Y Q;  1NWQ A;  3M0D C;  1JO5 A;  1VDF A;  1M7L A;  4OWF A;  4XFJ A;  3MTU E;  1MKM A;  5GTI E;  3Q5S A;  2FYU E;  3H1J J;  4GOE A;  2K1A A;  1FDI A;  2A06 D;  3KPE A;  3B8E B;  1LWU A;  1M90 Q;  3QWO C;  4GOD A;  2WT7 A;  1J1D B;  3L71 E;  4D6T J;  2IFM A;  5KLI B;  3V4W A;  1NYH A;  1MFZ A;  2FYN C;  4PV1 B;  5AVT B;  3RK3 D;  3TGU E;  4JYB A;  1JTH B;  1U7M A;  2IX7 C;  5APQ A;  1FOS F;  3TNU A;  2R32 A;  3O6Q A;  5APU A;  4EDF A;  5CBO A;  3RBX A;  2Z4E A;  3H1K G;  3HE4 A;  1K8A Q;  1ZN5 A;  2OTJ P;  3GHG B;  1URQ B;  3SFD C;  3H1L J;  1X0T A;  3EFF K;  2FXO A; 
#chains in the Genus database with same CATH homology
 2A06 G;  1L0L G;  1L0N G;  3BCC G;  1BE3 G;  1BCC G;  3CXH H;  3TGU G;  2BCC G;  3H1H G;  1SQP G;  3L73 G;  1P84 H;  1NTK G;  3L75 G;  4PD4 H;  1KYO H;  3L74 G;  3H1L G;  2IBZ G;  1BGY G;  2FYU G;  1NU1 G;  1SQB G;  3H1I G;  1SQX G;  5KLV G;  1NTM G;  3CWB G;  4U3F G;  1NTZ G;  1PP9 G;  1SQV G;  3L71 G;  4D6T G;  1PPJ G;  1EZV G;  3H1K G;  3L70 G;  1SQQ G;  1KB9 H;  3CX5 H;  3L72 G;  3H1J G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...