1BEV4

Bovine enterovirus vg-5-27
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
40
structure length
40
Chain Sequence
STINYNNINYYSHAASAAQNKQDFTQDPSKFTQPIADVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BOVINE ENTEROVIRUS COAT PROTEINS VP1 TO VP4
publication title Implications for viral uncoating from the structure of bovine enterovirus.
pubmed doi rcsb
source organism Bovine enterovirus (strain vg-5-27)
molecule tags Virus
total genus 3
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1bev400
1Z7S4 2RR14 2RS54 1MQTD 2X5ID 1AR64 1RUJ4 1NCQD 1PIV4 1OOPD 1RUD4 2HWC4 1AL24 1BEV4 1HXS4 1RUC4 1RUH4 1RVF4 1AR74 1RUI4 1H8TD 1RHI4 1HRI4 1EAH4 1PO24 1RMU4 1HRV4 2RMU4 4RHV4 3JBG4 1VBB4 1R094 2RS14 4Q4V4 2R064 1AR84 1D4M4 1EV14 1VBD4 1AR94 1VRH4 1POV0 3J8F4 3JD74 2R074 1K5MD 1PVC4 2PLV4 4GB34 2HWB4 1RUE4 4PDWD 1RUG4 1NA1D 1VBA4 1COV4 2R044 1PO14 4Q4X4 1VBC4 2RM24 4Q4W4 1ASJ4 1VBE4 2RS34 4Q4Y4 1RUF4 1R084
chains in the Genus database with same CATH superfamily
3AE8A 2WDVA 1Z7S4 2WP9A 2X5ID 1RUJ4 1PIV4 1OOPD 2HWC4 1XI1A 3SFEA 1RHI4 1HRV4 2PZSA 3JBG4 4Q4V4 1EV14 3P4PA 3SFDA 1PVC4 2PLV4 4GB34 3FI7A 1L0VA 2R044 5C2TA 2B76A 4YSXA 1NENA 2WS3A 3SUCA 3AEAA 2RS54 1AL24 1BEV4 1HXS4 1RVF4 1AR74 1HRI4 3AE6A 3GQHA 4RHV4 1YQ3A 4YSYA 3AEGA 2RS14 1VBD4 1AR94 2FBWA 4YSZA 1K5MD 2HWB4 2H88A 1RUG4 2WQYA 1PO14 1ZOYA 4Q4X4 3AE1A 2WU5A 2PYJA 1VBC4 2RM24 1ASJ4 1VBE4 2RS34 2WDQA 3P4SA 2ACZA 4Q4Y4 2EX3A 2RR14 3AEEA 1MQTD 1ZP0A 2WDRA 2WU2A 3AE5A 2PY5A 3P4RA 4YTNA 5C3JA 3AECA 1RUI4 3AE9A 4YT0A 1RMU4 3AEBA 3AE3A 3P4QA 3VRBA 1KFYA 1VBB4 1R094 3ABVA 3CIRA 3VR8A 2R064 4YTPA 1D4M4 2PYLA 3J8F4 1POV0 2R074 3AEDA 2H89A 4YTMA 1RUE4 4PDWD 2PW9A 1NA1D 1COV4 1KF6A 4Q4W4 4KX6A 1R084 1NEKA 3GQKA 1AR64 1NCQD 1RUD4 1RUC4 1RUH4 3VR9A 1YQ4A 1H8TD 3AE7A 4YXDA 1EAH4 1PO24 2RMU4 2R7FA 1AR84 3JD74 1VRH4 3AE4A 1XHZA 3AE2A 1VBA4 1XHXA 3VRAA 1RUF4 3AEFA
chains in the Genus database with same CATH topology
1Z7S4 2RR14 2RS54 1MQTD 2X5ID 1AR64 1RUJ4 1NCQD 1PIV4 1OOPD 1RUD4 2HWC4 1AL24 1BEV4 1HXS4 1RUC4 1RUH4 1RVF4 1AR74 1RUI4 1H8TD 1RHI4 1HRI4 1EAH4 1PO24 1RMU4 1HRV4 2RMU4 4RHV4 3JBG4 1VBB4 1R094 2RS14 4Q4V4 2R064 1AR84 1D4M4 1EV14 1VBD4 1AR94 1VRH4 1POV0 3J8F4 3JD74 2R074 1K5MD 1PVC4 2PLV4 4GB34 2HWB4 1RUE4 4PDWD 1RUG4 1NA1D 1VBA4 1COV4 2R044 1PO14 4Q4X4 1VBC4 2RM24 4Q4W4 1ASJ4 1VBE4 2RS34 4Q4Y4 1RUF4 1R084
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7S 4;  2RR1 4;  2RS5 4;  1MQT D;  2X5I D;  1AR6 4;  1RUJ 4;  1NCQ D;  1PIV 4;  1OOP D;  1RUD 4;  2HWC 4;  1AL2 4;  1BEV 4;  1HXS 4;  1RUC 4;  1RUH 4;  1RVF 4;  1AR7 4;  1RUI 4;  1H8T D;  1RHI 4;  1HRI 4;  1EAH 4;  1PO2 4;  1RMU 4;  1HRV 4;  2RMU 4;  4RHV 4;  3JBG 4;  1VBB 4;  1R09 4;  2RS1 4;  4Q4V 4;  2R06 4;  1AR8 4;  1D4M 4;  1EV1 4;  1VBD 4;  1AR9 4;  1VRH 4;  1POV 0;  3J8F 4;  3JD7 4;  2R07 4;  1K5M D;  1PVC 4;  2PLV 4;  4GB3 4;  2HWB 4;  1RUE 4;  4PDW D;  1RUG 4;  1NA1 D;  1VBA 4;  1COV 4;  2R04 4;  1PO1 4;  4Q4X 4;  1VBC 4;  2RM2 4;  4Q4W 4;  1ASJ 4;  1VBE 4;  2RS3 4;  4Q4Y 4;  1RUF 4;  1R08 4; 
#chains in the Genus database with same CATH topology
 3AE8 A;  2WDV A;  1Z7S 4;  2WP9 A;  2X5I D;  1RUJ 4;  1PIV 4;  1OOP D;  2HWC 4;  1XI1 A;  3SFE A;  1RHI 4;  1HRV 4;  2PZS A;  3JBG 4;  4Q4V 4;  1EV1 4;  3P4P A;  3SFD A;  1PVC 4;  2PLV 4;  4GB3 4;  3FI7 A;  1L0V A;  2R04 4;  5C2T A;  2B76 A;  4YSX A;  1NEN A;  2WS3 A;  3SUC A;  3AEA A;  2RS5 4;  1AL2 4;  1BEV 4;  1HXS 4;  1RVF 4;  1AR7 4;  1HRI 4;  3AE6 A;  3GQH A;  4RHV 4;  1YQ3 A;  4YSY A;  3AEG A;  2RS1 4;  1VBD 4;  1AR9 4;  2FBW A;  4YSZ A;  1K5M D;  2HWB 4;  2H88 A;  1RUG 4;  2WQY A;  1PO1 4;  1ZOY A;  4Q4X 4;  3AE1 A;  2WU5 A;  2PYJ A;  1VBC 4;  2RM2 4;  1ASJ 4;  1VBE 4;  2RS3 4;  2WDQ A;  3P4S A;  2ACZ A;  4Q4Y 4;  2EX3 A;  2RR1 4;  3AEE A;  1MQT D;  1ZP0 A;  2WDR A;  2WU2 A;  3AE5 A;  2PY5 A;  3P4R A;  4YTN A;  5C3J A;  3AEC A;  1RUI 4;  3AE9 A;  4YT0 A;  1RMU 4;  3AEB A;  3AE3 A;  3P4Q A;  3VRB A;  1KFY A;  1VBB 4;  1R09 4;  3ABV A;  3CIR A;  3VR8 A;  2R06 4;  4YTP A;  1D4M 4;  2PYL A;  3J8F 4;  1POV 0;  2R07 4;  3AED A;  2H89 A;  4YTM A;  1RUE 4;  4PDW D;  2PW9 A;  1NA1 D;  1COV 4;  1KF6 A;  4Q4W 4;  4KX6 A;  1R08 4;  1NEK A;  3GQK A;  1AR6 4;  1NCQ D;  1RUD 4;  1RUC 4;  1RUH 4;  3VR9 A;  1YQ4 A;  1H8T D;  3AE7 A;  4YXD A;  1EAH 4;  1PO2 4;  2RMU 4;  2R7F A;  1AR8 4;  3JD7 4;  1VRH 4;  3AE4 A;  1XHZ A;  3AE2 A;  1VBA 4;  1XHX A;  3VRA A;  1RUF 4;  3AEF A; 
#chains in the Genus database with same CATH homology
 1Z7S 4;  2RR1 4;  2RS5 4;  1MQT D;  2X5I D;  1AR6 4;  1RUJ 4;  1NCQ D;  1PIV 4;  1OOP D;  1RUD 4;  2HWC 4;  1AL2 4;  1BEV 4;  1HXS 4;  1RUC 4;  1RUH 4;  1RVF 4;  1AR7 4;  1RUI 4;  1H8T D;  1RHI 4;  1HRI 4;  1EAH 4;  1PO2 4;  1RMU 4;  1HRV 4;  2RMU 4;  4RHV 4;  3JBG 4;  1VBB 4;  1R09 4;  2RS1 4;  4Q4V 4;  2R06 4;  1AR8 4;  1D4M 4;  1EV1 4;  1VBD 4;  1AR9 4;  1VRH 4;  1POV 0;  3J8F 4;  3JD7 4;  2R07 4;  1K5M D;  1PVC 4;  2PLV 4;  4GB3 4;  2HWB 4;  1RUE 4;  4PDW D;  1RUG 4;  1NA1 D;  1VBA 4;  1COV 4;  2R04 4;  1PO1 4;  4Q4X 4;  1VBC 4;  2RM2 4;  4Q4W 4;  1ASJ 4;  1VBE 4;  2RS3 4;  4Q4Y 4;  1RUF 4;  1R08 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...