1BF6A

Phosphotriesterase homology protein from escherichia coli
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
291
structure length
291
Chain Sequence
SFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical characterization and crystallographic structure of an Escherichia coli protein from the phosphotriesterase gene family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotriesterase
molecule keywords PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
total genus 125
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1bf6A00
3D6NA 3F4DA 4IQJA 4GOAA 3EGJA 3OVGA 4LANA 1YBQA 3S2NA 4C6CA 4DNMA 1A5KC 1R9XA 3RHGA 1ADDA 4KEUA 2Z2AA 2FVKA 2OQLA 2Q09A 3RN6A 4DYKA 4PBFA 4C5YA 1I0DA 3PANA 4DLFA 1V4YA 4H9TA 3UF9A 4PBEA 4IFOA 1UMLA 3F2DA 2VUNA 3OOQA 4GZ7A 4F0RA 1YNYA 3LU2A 2HPIA 3S2MA 4PE8A 4HJWA 3URNA 4CQBA 4B91A 1HZYA 3T1GA 1FWBC 1NFGA 2Z00A 4C6MA 4C65A 4LFYA 1A4LA 2D2JA 4CQCA 1P1MA 3AU2A 4LAOA 3MKVA 1O5RA 1WXZA 3E2VA 2O4QA 4HK7A 4MUPA 2QPXA 1XWYA 1KCXA 3ID7A 3LA4A 2GSEA 4KETA 1FWHC 1PSCA 2VHLA 5FSEC 4G7EA 1A5OC 1NDZA 2R1NA 4H9YA 4ERGA 5AKQA 2PUZA 4C6EA 1R9YA 1FWIC 2AQVA 4KERA 1ONXA 4ERIA 3ISIX 5LXXA 4H00A 1IE7C 3OU8A 4BJHA 1FWCC 4C6FA 1YRRA 3GTIA 3N2CA 3MVTA 2XIOA 1V7AA 4G2DA 2WM1A 3T8LA 2Z4GA 1M65A 1UIPA 4GY0A 3QY6A 4UBPC 1A5NC 2D2GA 2R1KA 3NQBA 3GU9A 4L9XA 4KQNA 1UBPC 3ICJA 2YXOA 2HNHA 3GTXA 1XRTA 2ICSA 3QY7A 4CNUA 2D2HA 1EJXC 4XD3A 2AMXA 2PGRA 2QT3A 4QTGA 4DZIA 4C5ZA 5HMEA 4IGMA 3CJPA 2I5GA 4IFKA 3T81A 4P5UA 1RAKA 2EG7A 1FKWA 3TN3A 4LCQA 2PGFA 4OFCA 4CNSA 4R7WA 3WMLA 4Z42C 3C86A 4EPBC 4GK8A 3PNZA 1FWEC 1EJUC 3EWDA 3E38A 1NDYA 3K2GA 3F2BA 1R9ZA 4LCRA 1POJA 4QS6A 4NG3A 4BY3A 3LNPA 3K4WA 1O12A 2YB1A 2QS8A 3LS9A 2R1LA 4EP8C 3GTHA 3SFWA 2G3FA 3LGGA 3A4JA 4KEVA 4XD5A 4I6KA 4HK6A 3CS2A 1M68A 4TQTA 1W1IE 2GOKA 4GC3A 3HPAA 3TN5A 1EJVC 3UR5A 4IG2A 3OODA 1PO9A 4KIRA 3IARA 4KEZA 2OB3A 4QS5A 2GWNA 1J79A 3UBPC 4GX9A 4CEUC 4GYFA 3LY0A 1EYWA 2Z2BA 2ZC1A 4DLMA 4B3ZA 4C6QA 3O7UA 4RDWA 4G7EB 2DVXA 1NDVA 2WJFA 3TN6A 4IF2A 3PNUA 3PBMA 3CAKA 3URQA 3E3HA 4H9ZA 4AC7C 3GU1A 1KRAC 3TN4A 2UZ9A 4F0LA 4XAGA 4YIWA 3OJGA 3URBA 2P53A 1E9ZB 2HQAA 3UPMA 2YZ5A 1RA5A 2Z26A 3DC8A 4RE0A 3F2CA 4C6IA 2O4MA 3B0YA 1RJRA 2BGNE 4QRNA 4H01A 1BF6A 4WVXA 4J35A 2Z7GA 4DIAA 3MDWA 4WGXA 4C6JA 2HBXA 4DI9A 1GKPA 1FKXA 4AQLA 2Z25A 2VC5A 3DCPA 2Z24A 4J5NA 3NEHA 5E5CA 4JOMA 1FWGC 1EJTC 3AU6A 4IFRA 1DPMA 4IG2B 3PAOA 3LSBA 4EPDC 1ITUA 3UR2A 4E3TA 4GBDA 1S3TC 4RDVA 4IH3A 4DO7A 2EG8A 4C6NA 2OODA 1GKQA 4RDYA 1P6BA 4DI8A 3A3XA 4ZSUA 4ERAA 1FWAC 3GU2A 4LAMA 2CZVA 2EG6A 4RZBA 3E0FA 4QSFA 1EJRC 3ORWA 3FEQA 2VR2A 5HMDA 5FSDC 1YBQB 1JGMA 4DZHA 1KRMA 2ADAA 3MTWA 2FTWA 2Q01A 2Z29A 4QROA 1RK6A 3GIPA 1XGEA 2HBVA 1RK5A 4GY7A 4PCPA 3DUGA 4M51A 4C6BA 4BKNA 5HMFA 1P6CA 1VFLA 4HK5A 4KF1A 1V79A 3IPWA 4XAFA 4D8LA 3GIQA 4LEFA 1E9YB 2WJEA 1J6PA 4LCSA 3FDGA 4V1XA 3RCMA 1GKRA 4R88A 1EJWC 1I0BA 2Z27A 1PB0A 2GZXA 2P50A 2ANUA 2DVTA 3E74A 4XD6A 3WZ0E 4EPKA 2OGJA 2I9UA 3KM8A 3IACA 2KAUC 3MSRA 4LAKA 2FTYA 3AUOA 1J5SA 2A3LA 4HA0A 4H9VA 2VC7A 3EWCA 4CNTA 2Y1HA 3MJMA 4UB9A 4GXWA 3MVIA 3A3WA 2WJDA 3MPGA 3E0LA 4KESA 2PLMA 2E1WA 2QVNA 3B0XA 4CQDA 3SO7A 2HPMA 2VM8A 1YIXA 4V1YA 4C6DA 1PTAA 2Z28A 2YB4A 4NP7A 2IMRA 1QW7A 4RDZA 1KRBC 1EJSC 4B92A 4C60A 3B40A 4LH8A 3MDUA 4NI8A 3S4TA 4R85A 1KRCC 1EF2A 1POKA 4B90A 3BE7A 3IJ6A 4L6DA 3IV8A 3IRSA 3JZEA 1RJPA 4CEXC 4PCNA 1EZ2A 4IGNA 1FWDC 3ITCA 1FWJC 3OQEA 2DVUA 1K6WA 2R1MA 5CH9A 4INFA 3NURA 2PAJA 4ZSTA 2RAGA 1A5MC 4XAZA 4H9UA 1V51A 1FWFC 2BB0A 3G77A 1ONWA 4XD4A 4GX8A 1XRFA 4C6OA 3O0FA 3HTWA 3RYSA 3QY8A 2R1PA 3TNBA 2FFIA 4GY1A 1YMYA 3S2LA 4EPEC 4IFKB 2E25A 3GUWA 1V77A 1A5LC 3QGAC 3R0DA 3K5XA 1QXLA 4C6PA 3WYZA 3HM7A 4J2MA 2GWGA 1NDWA 4I6VA 4LALA 1RJQA 4ICMA 4F0SA 4C6KA 3FDKA 4H9XA 3GG7A 5G4HC 3GRIA 1A4MA 2FVMA 1ITQA 3URAA 1K1DA 2AQOA 2OOFA 1UIOA 1K70A 1ZZMA 3QGKC 3F4CA 5A6TC 4WHBA 3S2JA 3LGDA 3LSCA 1M7JA 1J6OA 2UBPC 3IGHX 3V7PA 1WXYA 4C6LA 4XAYA 4H9MA 1RA0A 2F6KA 2W9MA 3GTFA
chains in the Genus database with same CATH superfamily
4IQJA 3NQCA 3CH9A 3DG6A 3VIHA 3R43A 3GXMA 1XIMA 3MP5A 3NO3A 3S1WA 2ZZ5A 1EHAA 4W87A 5CJMA 5DO8A 1XLKA 4HHMA 4EXQA 1J8VA 2Q09A 1TWDA 4PBFA 1EIXA 3HJEA 4URIA 1M7XA 1V4YA 1TZ9A 1Z44A 1VYPX 1LBFA 3VVGA 4FA3A 1LOSA 4B5VA 1LYXA 5CC7A 3CQ0A 3BJSA 1VF8A 3QTPA 5REQA 4UTIA 1I4NA 2IUZA 3P67A 1NFGA 5CXPA 3SGZA 5BXPA 3WH7A 5AHLA 4E3VA 3OZPA 3NZQA 3V75A 4S3DA 1OIFA 1LRTA 4B4FA 7CGTA 4Q8WA 3ITYA 1CI1A 3L2IA 4KETA 3WD4A 1XCWA 4ZEPA 1QUMA 2XH7A 1DTUA 4N02A 4AD2A 3THDA 1ONXA 1T6MA 3EDFA 4CVWA 3BLFA 3TOPA 5C2CA 1QK2A 3N2CA 3M41A 3MVTA 3MP3A 5HXMA 4BF5A 2X1TA 4GFIA 2XISA 2V8ZA 4ALDA 3VNKA 2DZTA 4PMDA 1A5NC 3NG3A 3S1UA 1LQ0A 3NQBA 2ZWZA 4W7WA 3RO8A 1EEXA 1IHIA 1FWRA 2PDUA 2BHYA 3CYJA 1PKLA 1T7LA 2CZDA 3K1DA 4F9DA 5LA2A 1KTCA 4IIHA 4NNAA 1RPXA 1SZRA 1ZP3A 3T81A 2IPJA 1MNSA 3VDAA 4X3ZA 1S5VA 4F40A 2V6AA 4C1KA 4B3LA 1D7KA 1XLMA 1YE4A 4O1FA 4OWGA 1XCFA 2F2HA 4ZTYA 2DSUA 1MQQA 2PRHA 4GHRA 2AL1A 2JGQA 2GDVA 1TPB1 3WK3A 3LGGA 5HJLA 5DY2A 5HQLA 3U3HA 3VD9A 4YTSA 3EPNA 4B5TA 5A1AA 2RKXA 5K4XA 1RY0A 1JXKA 2XN2A 3FK4A 5CC3A 3IARA 1X6NA 4NI3A 1XLJA 4AF0A 3LZ3A 4C6QA 3OG3A 2PTXA 2DVXA 3TC6A 5CGQA 1IZCA 1GYMA 4PMXA 4J27A 1GK8A 2J75A 2XDFA 3ITLA 2GDUA 2P53A 2Q71A 3PTMA 2F6XA 1BF2A 2O4MA 4LRSA 3WG6A 5M03A 1TJRA 2E8ZA 4IWWA 4WCJA 2FYMA 2YDQA 3OQ8A 3GXIA 2OU4A 2E7FA 4WGXA 1KW1A 2PURA 2PODA 1GJWA 4RUBA 1T99A 4IHCA 1IEXA 1VZWA 4QCFA 4HNCA 1GT8A 2B0MA 3NGJA 1ZHAA 4TR9A 1D7FA 1KCKA 1OX6A 1TCMA 4YXGA 1BVNP 4DPPA 2OODA 4LVAA 4M56A 4GJIA 4AZCA 1XR2A 3LK6A 1EC7A 1S2UA 4RNJA 3VNZA 1EJRC 1OC7A 3FEQA 5HNRA 5IDZA 1H7WA 4QG6A 5G2HA 4ACZB 3PJXA 3EWBX 1YPXA 3QXBA 4US5A 4WKFA 4JTDA 3BAJA 1XGEA 1DJWA 1RK5A 4NY2A 4LSBA 4C6BA 5BRBA 2NXGA 3MHUA 4L4MA 3GIQA 3VDBA 1SW7A 4HD5A 3FV9A 3HPFA 4GYKA 3FAXA 4MTVA 4H2CA 1W5NA 3UXAA 1PB0A 1XLAA 2R94A 1SUXA 3E0WA 2ZXQA 2X30A 3QW4B 5CBBA 2DH3A 3KM8A 2ATMA 4EWJA 3F4VA 1JNEA 2VX4A 1NF0A 4HA0A 1QU4A 2VC7A 1J2BA 2ZXAA 1V6UA 1GUVA 5CPQA 3W7OA 3LGEA 2J7GA 3MJMA 4DJFA 2F7FA 3H24A 3N04A 4GCXA 3WY1A 3A3WA 4N2YA 4WKHA 2BBFA 3E0LA 4KESA 4O53A 3TW9A 1JD9A 1F5ZA 1WKFA 2IMRA 4X9SA 4FLOA 4WDWA 5BU6A 4U3AA 2O55A 1XINA 1BHGA 1RJPA 4IGNA 5C54A 4Q32A 4IPIA 4JD4A 4F2TA 3W83A 2W63A 2ODOA 3C8NA 4GNJA 3F4NA 3NZ1A 4AEEA 4Q22A 3IEBA 5DANA 3TONA 3BGAA 3B8IA 1LM1A 2QF7A 5CLTA 1KGXA 3UERA 1C8XA 3I4EA 3P93A 2V2DA 3FJ4A 2E6FA 4IMFA 1OK4A 1DE5A 3N2TA 3N3MA 5DCEA 4AIEA 1FCQA 1UJPA 1MZHA 3MYOA 2ATSA 4XUGA 1C8QA 1XYZA 4IXHA 3NDOA 5JUVA 2BY0A 3SCQA 5A8NA 1BYDA 2G3IA 4F0SA 2W0UA 3VINA 3D5HA 4NJKA 5G4HC 1UC5A 1CLXA 1MQRA 4Y2WA 1V02A 3NQFA 2EPMX 4J9JA 4LC6A 3F4CA 3QEZA 3HA1A 1H1YA 4W85A 2P0OA 5FJTA 3NQEA 3MO7A 2TSYA 1EEPA 4PMUA 4U2ZA 2VGFA 2F6KA 4BF7A 3M5YA 3E6EA 3MV11 2V63A 4Q8OA 1PHWA 3AI0A 3CPRA 4L56A 1AMYA 5AOUA 4YN5A 4L6OA 3RN6A 5E9AA 1GW1A 3GQYA 1TO3A 1KB3A 5AHMA 2JEPA 3GNDA 1CXLA 3A21A 3NYZA 3T0CA 4JPGA 2J13A 4AVFA 2BY3A 5HR7A 1Q2SA 4FXJA 2NXHA 1KLZA 5GPRA 1J0IA 3JW7A 1O4UA 4AH7A 3GXTA 3QZ6A 1O5RA 1UG6A 1R7AA 5B7ZA 4KT2A 1C7TA 3AYTA 3MT1A 3PZTA 4U10A 1L6YA 3BW3A 1BKSA 1I2QA 2WCGA 1QPNA 4H4IA 3MP4A 3W1NA 3ZFHA 3ISIX 2ZYFA 2BWGA 4OGZA 4U5IA 5C55A 1JZ8A 4K2SA 4AZCB 1XLLA 1V0KA 2HS8A 2G96A 4OUEA 2WNWA 4J3VA 4KPLA 4GH1A 1J0YA 3W7IA 4NJJA 5JMUA 3G8EA 3GTXA 4RCXA 2PWDA 1Y65A 4IL0A 1V0NA 1E6SM 1EC8A 2PGRA 1DWJM 2E0PA 1K7FA 3CL8A 4KRZA 3WDPP 3GXDA 4OTKA 4WKAA 3C86A 3SGGA 1QBAA 2VRKA 3VOHA 1EJUC 1NDYA 3WLLA 1HN1A 4BA0A 2QCMA 4Z2JA 1LT8A 4AG0A 3A13A 3L9CA 4BY3A 5BZAA 1ZU8A 1Z8AA 5KZMA 3L65A 4Q4QA 1TTJA 3U7BA 3U0HA 3JVAA 2CWXA 2J79A 1UH2A 4I6KA 4HK6A 2Y5SA 3RIKA 7REQA 2P8BA 3LG3A 1OFQA 2WZIA 4GC3A 2J74A 4UFLA 1QRQA 3UR5A 3DHPA 2NQ9A 4UOZA 3GM8A 3GZAA 3P84A 4KCUA 3PZNA 4DQWA 4ZB2A 3ERPA 2XIMA 1VFSA 2WJFA 4D71A 3MUY1 1RSCA 2REQA 5DMMA 1Y8BA 2GSHA 4F0LA 1FH8A 3W37A 4C6IA 2QUTA 4WEVX 5FJIA 3L7RA 1E3ZA 4O57A 3ONCA 2W92A 2ZBTA 3I7RA 1OGSA 3GBEA 3QPZA 3REQB 3ZVHA 5F7UA 1UKQA 1GQLA 1ODZA 3DCPA 2Z24A 3CHEA 3CV7A 1ZJAA 1KFLA 4MG4A 4GKTA 2W4XA 1DYSA 2VWTA 4NT0A 5HWJA 3VIFA 5KTLA 3RMEA 3QKZA 4DBUA 3SJ3A 4N7QA 2KX9A 4EXBA 1K8XA 3GNOA 1IEVA 3EPOA 3A3XA 3DFPA 3VKAA 4ZE5A 3RX4A 3FLUA 4C1NB 4AMCA 4WY0F 1DOSA 3GU2A 4NZFA 7TAAA 4LY4A 1UP2A 3GBDA 4A3UA 2CXEA 1D9EA 2VR2A 2XVGA 2ZRUA 4IIFA 3N6QA 3OG2A 4X0VA 1L2UA 4FXSA 4A8LA 1W3KA 2Q01A 1DWAM 3H2FA 2DT2A 3W7JA 3LERA 3M4HA 1KQYA 4K37A 1AG1O 4HA4A 1Q6FA 3BL3A 2ZZ2A 3IPWA 2WSKA 2VVSA 4IL2A 3NCOA 3VE7A 4UFJA 1DWIM 4GRSA 1E9YB 2J6VA 3E9AA 2ZZ3A 4NJGA 3S1XA 5LXEA 1M1BA 3NPWA 5BOEA 2G41A 3SBFA 3S5NA 1BYBA 4EPKA 4OBSA 4EOUA 2I9UA 4JQAA 3C52A 3VGDA 1JG9A 1OFDA 3TU9A 4LGXA 2NQHA 3L5LA 1LORA 3CL7A 1GTEA 3MUAA 2ZXBA 1AUSL 1JCLA 2VFGA 3VGHA 3MO4A 3PN8A 4XUYA 3CIWA 1X7FA 2CZFA 4NP7A 5GQBA 3BLOA 4LUIA 3W73A 1YX1A 2C8NA 2I14A 4AY1A 5CJNA 4EANA 3BG5A 2A2IA 2PD5A 3PBYA 4N4PA 3RXZA 3L4VA 3TYUA 2TMDA 3IJ6A 4FLRA 3RR1A 1ZBVA 3W7PA 1R87A 2ZX6A 1XC6A 1J9YA 2JF6A 2YLLA 2H8ZA 4ROPA 2YXXA 1IZJA 2BTMA 4UIOA 4KRUA 3IS4A 2XGZA 3G1XA 4S39A 2WNQA 8CGTA 5CPMA 3KX6A 3V5CA 1V51A 4O15A 1TV7A 2PE4A 3G77A 1R3WA 2QGYA 2J27A 2HWGA 1WUEA 4LVFA 3P74A 3S2LA 2PDXA 4LB4A 4M6PA 3ARUA 3TTSA 2YX0A 1YXDA 3BURA 3IGSA 1VCGA 1RJQA 3TYDA 1VEMA 1IEIA 4B16A 1CB7B 1A4MA 3PJTA 3UWZA 3C8FA 2ZUSA 4HCLA 1THFD 1VCFA 3QGKC 2D0HA 4Q8MA 4WHBA 2QXWA 2VMFA 3VM7A 4PSRA 3DECA 3H7VA 4YTTA 2ZZ4A 2VZTA 3FNDA 4E2VA 4QM1A 3EGJA 1YLVA 4C6CA 4IP5A 3ZWTA 3W1AA 2J62A 1A80A 1OFPA 4EF9A 2OQLA 1HVQA 4B5SA 3IJIA 1BXNA 1OYAA 1SQ7A 4MADA 4AWSA 2BG5A 4FX7A 4DLFA 5A2BA 1OC6A 3TR9A 1EKOA 3GXFA 1D8WA 2OMAA 4LS2A 5LSMA 3WQOA 4AZ6A 2ALRA 1RV8A 2OXNA 3EDJA 3AHVA 1C7SA 1ZB5A 3UU0A 3M6DA 5AY7A 4RPPA 1KM6A 3S6DA 3D46A 1VLWA 2D0GA 1X1OA 1TVNA 5GJPA 1G7VA 1EYEA 1E6PA 3IJ9A 4OU1A 2QDEA 1GVFA 4IIEA 5C71A 1PBGA 3OA5A 4LC8A 3W02A 3GG0A 3K8KA 5DFAA 3RPDA 4I7WA 4PUJA 1ZL1A 3BMXA 4OVXA 1DORA 4A8NA 3AIWA 2B7NA 3W7DA 3EPMA 4R7OA 3C2FA 3GTIA 4LYRA 3DZ1A 3LN3A 4EKJA 3VGGA 2XFFA 1M65A 2ZICA 2EPOA 3Q94A 3WQDA 3P80A 1UR3M 4ATLA 3C0JA 2YXOA 3SSJA 3OVRA 1C90A 1T41A 4JEQA 1WUFA 4RL3A 2QT3A 4DZIA 3WF1A 3T2QA 1QI4A 1QDSA 1SSDA 3XINA 5HATA 4OFCA 1W9DM 4GGHA 1TG7A 1E6QM 3BO9A 1EP3A 4Y9PA 5AZ0A 3E38A 3BLLA 1PEZA 3F2BA 1QATA 3EYPA 1U1UA 5LHEA 3PFRA 4ACYA 1UWUA 3ZOAA 2QS8A 2WBGA 1FQ0A 2DZWA 2OZ3A 5T26A 2R1LA 2IPWA 4YPJA 1ZS2A 1W3IA 2XH0A 4HHHA 1KM1A 1VP5A 3AIEA 4XD5A 3GDKA 4BI7A 1I9CB 3PP7A 4F0KA 5EY5A 3SCWA 3TN5A 1EJVC 5DY3A 3UPWA 1JQXA 3W2NA 2LLEA 4X0NA 1GPWA 3JUGA 4O8AA 1W1B1 4HTBA 4BZYA 2J7EA 1IF2A 2IQDA 3SAZA 1CCWB 3DGBA 1EH9A 2ZKMX 1GHRA 1ISVA 5J04A 1YNQA 4POCA 4J4KA 6REQA 2ONEA 1UKSA 1W8GA 3O1NA 2BGNE 2OPJA 2WWCA 4BF9A 3CAQA 3G1HA 3MV01 3LHYA 2F6UA 3IJQA 2PDPA 1K8CA 2XZ7A 5F1UA 1XLBA 2J6XA 2VFIA 2Z7GA 2FZ9A 5D32A 3H22A 2TRSA 4C1NA 1KFCA 2BASA 1EUNA 3MMTA 3WQFA 3ABXA 1GEQA 3W6LA 2J9ZA 4N6FA 2V67A 1RBAA 4KH2A 3CIVA 4P7QA 4MKVA 2WHLA 3OW1A 1K77A 1B3WA 3W7CA 1GONA 3LI0A 4EAMA 1P6BA 3S5SA 1FWAC 1QW9A 3QR3A 1O5KA 1XUZA 5KMYA 1A3XA 1W5PA 2A6LA 3QMSA 4FR1A 4GO8A 2ALDA 1LLOA 1LLWA 2QAFA 1WDRA 3WK0A 1LRNA 2HBVA 2JALA 4DZAA 5HAOA 1LWHA 5H8PA 4KF1A 1R3YA 3CWOX 1HO1A 1ZJBA 4V1XA 2IKGA 3H70A 1JFHA 1JEZA 4DN1A 3P60A 4RV8A 3N11A 3UVAA 3DXIA 4KFPA 2J66A 4XVDA 3WQEA 1HJXA 5AYIA 1PDZA 4HMEA 2ZOXA 4A3YA 2KAUC 3PSWA 1H2JA 1CYGA 3ELFA 3R12A 4JTJA 1WPCA 2XIBA 3NZPA 2QPSA 2VEPA 1TUXA 4GXWA 2VEKA 3GY1A 1AD1A 1XDLA 2PLMA 2ZE0A 4YTRA 1NP2A 4GNVA 2WHMA 2Y6ZA 1GOOA 1DBTA 5CZ0A 5AC4A 3G1FA 4WR3A 2PGWA 3CBWA 4L6DA 4C1LA 1E1EA 4AZ5A 2DW7A 3VFCA 3GC4A 4K1WA 1YDOA 1JYXA 3W9ZA 3PUDA 3OZMA 1I1WA 4WJ8A 2QCCA 5I5RA 1CLKA 5XIMA 4QEHA 5G1TA 5ENLA 3PWIA 3M46A 4CN4A 2PAJA 4PUNA 4XK2A 5A5WA 4MF4A 3DERA 4RZ6A 4CU7A 1F76A 1HG3A 1V08A 1HKVA 2FTPA 3QY8A 4O18A 1OK6A 3VM5A 1K6AA 5EBUA 1LQAA 3VX0A 3DKLA 4M81A 1ITXA 4RXGA 4LVGA 3IIXA 4HU4A 2WXDM 3NDYA 3POHA 1IIHA 5EMJA 2O7QA 1VC4A 2GPTA 3A12A 5HDRA 1I45A 3WQCA 3R6IA 2XM2A 5BMXA 4RJEA 3WBAA 3ARRA 3W2LA 3WQ4A 4LNYA 5M1TA 4PB5A 1DWFM 3AIQA 2V82A 1V6YA 5A6AA 2DGAA 3IGHX 4XBSA 4GG9A 4KKXA 2W62A 3SDOA 3HMJG 1XG4A 2C0HA 5K3VA 2E09A 4D6JA 1PZ0A 1Q63A 3L12A 3HFYA 1EOKA 2Z0IA 4Q4RA 4KEUA 3N9KA 3WL0A 3BC9A 3SRDA 3ARPA 2QMKA 4NHVA 3BMVA 4DYJA 4FNPA 1CPUA 1HX0A 3KZSA 2AL2A 1ME7A 5A6BA 1KGUA 1F2JA 2PTYA 4HJWA 2NWRA 2EPLX 3MI3A 3R7MA 3KBSA 1H0GA 3VD7A 1SU5A 3FCPA 1M03A 4R27A 2B81A 3C0QA 2QDHA 2DEPA 2FGZA 3PULA 1QJWA 1CX9A 5BU9A 2QPXA 1K7EA 1HJUA 1KCXA 1QOQA 3GHTA 4QG9A 3NR0A 4NZ5A 5H8UA 4K39A 2RGMA 5FF7A 2BS9A 4FNRA 3TX9A 2GQ8A 1J18A 1OC5A 4M1BA 1KFJA 1Q6GA 1KFEA 3QTGA 4AB4A 1J10A 2Q8ZA 4E8DA 3II1A 3WNMA 3GU9A 4L9XA 1MEHA 4MLJA 3CMGA 4JIQA 4AYSA 1ZGDA 4YYFA 1FY6A 3XIMA 8XIAA 4HTYA 1Z89A 3KLLA 1V6VA 1YQ2A 4IGMA 3I68A 1YDNA 1FKWA 1EQCA 4B9ZA 3GW3A 3R25A 3KWSA 2RHGA 3FY1A 4HNLA 3BGGA 4GK8A 4BQ4A 2OELA 4QFUA 4MNJA 4IPJA 2RFGA 1U5VA 5M2FX 1WZLA 1UOKA 3FGCA 1CXHA 1RVKA 3G6LA 4X2RA 4O14A 1PV8A 4EF8A 4O12A 3E0VA 3A4JA 2F84A 2NT0A 4O19A 4UTJA 5AYBA 2NQLA 2DP3A 1OM0A 4TQTA 3WD3A 1OGBA 4FOKA 2WANA 4QS5A 1ZLPA 1XH2A 1WAWA 1JUKA 2VP8A 2BP1A 4XZWA 3EMQA 1CW2A 3O7UA 1IT8A 4MVAA 3PZUA 4S1FA 3GE7A 3PNUA 2VZOA 3ZMRA 1K4HA 3RUBL 3ZVIA 2WC7A 2OLAA 2QKFA 1JDEA 3H4XA 1UR2A 4AHQA 3PZIA 3MZ2A 2YZ5A 1HP4A 1OVDA 1ECQA 1Y5XA 4JICA 4ONVA 2YA0A 2VI0A 4J35A 1JRCA 3O06A 3XISA 2QMJA 4DI9A 2OYKA 4QJ4B 2WNNA 4HN4A 1O7AA 1UHVA 3EWXA 3UGVA 1U1JA 3UWWA 5KINA 1CENA 2F38A 2WQPA 1NFPA 3EEZA 4TV6A 4CD4A 1XD0A 3EA2A 4RDVA 3V0SA 2J7CA 3ZSSA 5D02A 4R53A 1LDCA 4MFDA 2JIWA 3AHZA 3SN0A 1ICPA 3W01A 3WQ6A 1YBQB 1XLHA 3HG5A 3VGFA 4JR5A 4LVDA 4QROA 1E4NA 3N15A 1DVJA 3ABSA 4JKLA 1ISWA 2VR4A 4HZ7A 4UCFA 1H7NA 4MZYA 3KVJA 4WOZA 2DSZA 3IJ8A 3I3BA 3IJ7A 2CC0A 3W1LA 4LEFA 3RF9A 1JZ4A 3AS3A 1ISZA 5FAGA 1J11A 1I75A 3W29A 2ACUA 1R3TA 2YA1A 2VZUA 3ABQA 3NWRA 1Z7AA 5D9PA 2J78A 1EUAA 3LPGA 4FALA 5HOSA 3SZ8A 4LAKA 1XBYA 3AJXA 3LV5A 1PAMA 5FIPA 3DFQA 4YS1A 2Y1HA 3GR8A 1BXBA 3PBWA 1XM3A 4S3JA 4OV4A 3USZA 2W79A 5ECUA 4I8DA 2QVNA 1YIXA 2PF8A 3HN3A 1JZ6A 1QNRA 4BQ3A 4QQ3A 3PFMA 3WD0A 2VDGA 4DB7A 2HS6A 2BVWA 3NOYA 2SFPA 4XZHA 5HUPA 3PZMA 2CLOA 4NILA 1BSIA 4DJFD 5DRIA 1NEYA 4PN2A 5J5DA 3UYCA 4A35A 4AVOA 1OJXA 2Z1BA 3GWQA 3W53A 4CLMA 4DF2A 2GFTA 2QCEA 6PTDA 2PDGA 1PX4A 2C6QA 1SGJA 3EDEA 4G7FA 5F1VA 3DKJA 1XP3A 3VDGA 3MI6A 1N82A 4Q4MA 4RZ4A 2GK1A 1W9PA 3ANUA 3BSHA 2CLFA 3EX3A 1CZ1A 1KBBA 5CAHA 5HWNA 1GOWA 1TJ0A 4O4VA 2I17A 4HZ8A 4AFYA 4C6PA 4NU7A 3SCRA 2PDKA 4HZ6A 2D3LA 3LRMA 4HNOA 3LCIA 3GRIA 1XGZA 2D23A 1K1DA 2TODA 4H6EA 3DHFA 2WZMA 4D6HA 4IM4A 3OA3A 3I7SA 3N2OA 5M3WA 5T91A 2HDJA 4AYGA 5FEPA 4B4HA 2UBPC 5TBOA 3QM3A 3UW6A 1VPXA 1XHGA 2QPUA 4ZO8A 3OYZA 4GOAA 1XGDA 3H7UA 5DF0A 4LANA 3TTOA 3L4TA 2FJKA 3ITOA 3PWGA 1RCQA 1VBJA 3KL5A 3TVAA 3PTQA 4PL1A 4GQRA 2OWCA 2WPGA 1VPYA 3PANA 1X6LA 3CNYA 4MSSA 4XBKA 2NUYA 1KNWA 3U48A 4UQBA 2A3BA 1DHPA 2CLEA 2PDNA 2VJXA 4KWWA 4YVVA 3F2DA 4NNCA 3NQ6A 1QI3A 2HPIA 3M9YA 3WQPA 4CU6A 4HA1A 3E2SA 1ICQA 1QPOA 5DXXA 4B91A 4LW7A 1JF6A 3HIJA 2NW0A 1NM9A 4MJ4A 1EGMA 1JF5A 3P2VA 5AHFA 3IIPA 5U4NA 3HOJA 2YCLA 2P5NA 3GD6A 4IIDA 5TIMA 3SCTA 2O4QA 1CEOA 3W82A 1G4EA 2PFHA 4AX6A 2J88A 1OHLA 1TVLA 2YCKX 2ZZ6A 2GSEA 4DJFC 1KGWA 2R1NA 3T42A 1QCWA 4C6EA 1HO4A 1XIJA 3W27A 1MXGA 4BJHA 5TAOA 3WJXA 3UA4A 2WMGA 3OO2A 1T96A 3LHTA 1XLCA 2VELA 3OZOA 3UJFA 5LKYA 1XSJA 1LT7A 1SFJA 3EWYA 3OYXA 2C18A 5EGRA 4CCDA 1B4EA 4O52A 3AOFA 2DZPA 4UZSA 4XKYB 3WJSA 1JI2A 2A3AA 1HP5A 2J25A 3EWUA 3LBCA 5EB8A 2X1IA 3QQWA 2QLYA 4ZVJA 3HGSA 3GXNA 3WF3A 2CITA 1J01A 3HJZA 2FZBA 2PDIA 1R9ZA 4RLIA 5A6SA 2QUMA 4LCRA 4DXXA 5IM51 3W6MA 4GKLA 2FB2A 8A3HA 3O8AA 2CEQA 3L21A 5CG7A 4FXFA 1VHCA 1DXEA 1G69A 1QO2A 3AYVA 3R2GA 2QYGA 3W22A 4I8YA 3VK5A 1UZDA 2A3HA 1PIGA 4DEFA 1SO5A 4DRSA 3AFBA 2OLHA 1E4LA 1R0MA 3D3AA 3CUGA 1AW2A 3VO0A 4NSBA 1A0EA 4CEUC 2Z2BA 4B3ZA 2GJRA 1MSSA 4O16A 1Z32X 5E93A 3RMJA 1O95A 3PBMA 1TRIA 3CAKA 1XH1A 3REQA 1FOBA 2HK0A 1OFRA 1UH4A 3VNIA 4WJXA 4JBRA 4YCOA 2CLLA 1G67A 3TNOA 3TN4A 3GFZA 2X1RA 3A5VA 1G0CA 3IANA 1QPRA 3ZM8A 1AQHA 3WUFA 5C2GA 5EMYA 1JFXA 4Q4SA 5A6KA 3A23A 1XFCA 1W0MA 4OBTA 4F4RA 3VCCA 4GBDA 1W56A 3GZ3A 3GVWA 2PWUA 3SUTA 4DI8A 1VD6A 5HK4A 4YJ5A 2QR6A 1CTNA 2NX9A 3IRDA 1I60A 2INEA 3MTWA 3LPPA 1M3UA 5ABHA 2PBOA 3V0UA 4Z0JA 2FZNA 3AMCA 3S47A 5C6MA 1GG0A 5D9OA 3EXRA 5BRPA 3V18A 3UA3A 1O66A 1AA1B 1OD8A 2CNCA 3VOFA 2WLZA 2QW5A 5EFFA 3VC6A 2BFGA 3VKCA 2VURA 3VOJA 1VRDA 3WLJA 3B9DA 4A2SA 1X1ZA 1DTNA 3L68A 1GNXA 4GVFA 3QYQA 4FHAA 1OCNA 1U33A 3WDHA 3M1ZA 1MO0A 3VI2A 2ZX9A 5FJOA 3BV4A 4XD6A 3BJTA 2ABBA 1PDYA 1A5AA 5HBFA 1M41A 2UY4A 4GQBA 1N8WA 4G56A 1P0EA 1DJZA 1R86A 1XICA 2PLJA 3N4FA 3W2MA 4J7RA 3RFAA 1TR9A 1GOXA 1FP8A 3KBMA 5CC5A 4NZCA 2HPMA 2XN0A 3M7SA 4CQDA 3P82A 4RX0A 4F48A 1BG4A 4DO6A 2Y85A 2VFEA 1I2PA 3G1DA 2POZA 1U5JA 4JN7A 4LUJA 4GH3A 4OIFA 4LF1A 1POKA 1R3QA 3MUZ1 4ATDA 4BWLC 4G1NA 2Y0FA 1F9CA 1GQIA 4R3UA 2YCEA 1YPIA 1BWVA 3BAYA 1LZOA 4PTWA 1KBJA 2BVDA 2ISVA 3VMOA 3V5FA 3BUVA 2JFEX 3HFTA 4FP1A 5CZSA 1Q7MA 3WBYA 4K3ZA 1KWGA 3HQOA 1P5BA 2RAGA 4DM2A 3PJUA 3QV9A 2BB0A 1C8YA 3WL1A 2G3JA 4A3HA 2GJLA 2FFIA 4GY1A 4JHOA 4LBRA 4IFKB 4AUBA 3LHVA 3WH6A 3WH8A 3N73A 1YTEA 3FKKA 3WYZA 4HBKA 4ZQNA 3P6LA 1H3GA 4ML9A 3UY8A 8RUCA 3IVSA 5LHFA 2XVNA 3TWBA 3TZNA 1F7BA 3GG7A 1CXKA 1B5TA 2JKPA 3RITA 1XJBA 4MYXA 1VQTA 1DJNA 3T6CA 5FF4A 1H50A 1E5JA 1G6CA 1OFBA 1IXOA 3EB4A 3LSCA 2XVKA 4I9AA 4P7LA 1EQPA 4GZIA 1BAGA 1VYRA 1YBQA 1UW9A 4BI5A 5FEXA 2XN1A 3SQLA 2ZUVA 3UPBA 3CZLA 3GVVA 4AISA 5FI8A 1SYTA 4TMBA 1DXFA 1UA3A 2IKJA 2E40A 3PZOA 4YMZA 4H9TA 1LLZA 5FD0A 3BW4A 4WY0A 4OBRA 2DW6A 1GJUA 5KITA 2IQ0A 4L1GA 3URNA 1GOQA 3O6AA 4CQBA 4EIVA 4UTMA 3USBA 4Q8PA 3APTA 1JYVA 4QNEA 3MI2A 3KS6A 1A4LA 1ML1A 3TA6A 4K38A 4MUPA 2C0AA 4JL1A 5ABTA 2VGIA 1S5WA 1JJKA 1W31A 3IGXA 2OR2A 1UUOA 1HKWA 1PSCA 4AWTA 4CCEA 3MKCA 1GQNA 3TLLA 3CV1A 3G0XA 2NQ5A 4DELA 2J7HA 2E3ZA 4N0RA 1RCOB 3MZNA 3W1QA 5LIUX 1IE7C 1JL8A 1LUCA 3OU8A 5JBDA 1NY1A 1V3MA 1ONEA 1VBUA 1FWCC 1UWQA 3EMZA 4S2BA 1XLDA 2C7FA 1S3HA 2X2YA 2WM1A 3O3RA 3APYA 1OBAA 2Z6JA 1GOKA 5FEWA 2C79A 4O11A 5E9XA 4W8BA 1V8EA 4MLRA 3W1MA 1Y5WA 2CBIA 4UFHA 3VMNA 2CLMA 1RCXB 1GVEA 1AH0A 1P7TB 3H54A 3RU8X 2XUCA 4EPBC 4Y8EA 4GXPA 4M7TA 3AYRA 4Z17A 1QT1A 3OP2A 1V03A 4G1KA 3M6YA 3NL6A 4GJ1A 5F4WA 4ZB0A 2DU2A 4JQ1A 4MYAA 3FJLA 4Z2HA 1U30A 4H19A 1UQYA 4ZCWA 3BCJA 2ZDSA 1HJVA 1KTNA 2J8TA 2WM0A 1VHNA 4O0QA 2X0SA 3LXAA 2DUAA 1KM4A 2ZRYA 4JCLA 3QW3A 3QFWA 4D1IA 4I9MA 2W61A 1OCBA 3MSGA 5DRCA 1RPKA 5HINA 3U9IA 3MCMA 3P5YA 1BYAA 2R91A 5F2IA 1WB0A 5D9MA 4YVXA 3PF3A 3FA3A 3UCCA 3NQMA 1BTCA 5CZTA 1ESWA 3N14A 4DF1A 4J3WA 1RA5A 3AIBA 1XDJA 4Q8UA 3U57A 4ZXLA 3W00A 4HJFA 3KRZA 1BF6A 4H01A 2QJMA 5CC6A 3MDWA 4IX0A 2HBXA 2CZ5A 1UMYA 4XSMA 1GKPA 3VIKA 1O94A 1REQB 3NEHA 1FA2A 4QDWA 5M5DA 1JD7A 1ZENA 4O0ZA 2DZVA 1JAEA 1S3TC 1E0TA 2MANA 1SZEA 3LTSA 4ZFCA 2Q6ZA 4XVEA 3S2CA 3QQ1A 4JXCA 3WEOA 3KVMA 3RO6A 3V5OA 4W4QA 3ZLGA 5I0DA 2CZVA 3EOUA 1DWGM 1EHNA 3B9OA 1BRLA 1H5VA 3K30A 1KR0A 4JY8A 3GIPA 3R79A 1XISA 4MUZA 4DJDD 4GUIA 4GINA 4OT7A 1QNSA 2AOSA 3STFA 5F4XA 1F8IA 2VRJA 3T0DA 3CPUA 3CZGA 4M80A 2YL8A 3LXBA 1OF6A 1E70M 3VZYA 3N6HA 2NV9A 4WDUA 2WJEA 1H49A 3EBVA 4JEJA 3AZRA 5FKYA 5H91A 2BHUA 2I16A 2NZLA 3OLIA 4V15A 4E2OA 1LWJA 1I0BA 2Z27A 5GJNA 3OBAA 3ES8A 2OGJA 6TAAA 3M0MA 1GORA 2JKAA 4PEKA 1CXIA 3W86A 4YCPA 1FVPA 4HYRA 4CGTA 3VXGA 2V5KA 3BWWA 1TELA 3W7RA 1H7PA 2ZA1A 4ZTXA 2PLCA 3L2MA 3LI1A 1ADOA 1B3OA 3M0HA 1M6JA 4Y9MA 3SO7A 1KFKA 2OQYA 4QLLA 4I7VA 2FDSA 3BGJA 1WBJA 4JTUA 1TZ7A 4PTMA 5G2IA 3VNYA 4PULA 3QOKA 3VIPA 1A5BA 1KBLA 1EB3A 2ZTJA 5D9NA 1E0UA 3B4UA 2YCJA 3PWAA 3MUXA 4A22A 3AO0A 2UV8G 1ALDA 5EMKA 4XZ9A 4NAEB 4WIWA 5E09A 4XG1A 3R8RA 3GHUA 3NQVA 4EK7A 4YHGA 3GUGA 2DVUA 3BSGA 1R8LA 3QJAA 1HT6A 3VCRA 2R1MA 4INFA 4GLEA 1FXQA 1F61A 3H26A 1IGSA 2IPFA 3HB9A 2FLIA 4XAZA 4HCDA 2CETA 1TSIA 1A47A 4ORIA 1X7IA 5HJYA 2X05A 1O60A 5IRPA 2G4JA 3VOCA 4JS3A 4C7GA 3CK5A 4ROQA 1ZJHA 4FOUA 1QXLA 4QIUA 3MCOA 1GYLA 1TV2A 2ISWA 4Z08A 5RUBA 1W17A 1EO5A 4GUJA 4WY0B 1MEIA 3L0GA 1UUMA 4ZQCA 4KGLA 5AC7A 1CWYA 1LBMA 4U5KA 4NF7A 1MRQA 4DPQA 5DCDA 1UD4A 3S42A 1TB3A 3W76A 3RNDA 3V7PA 4W9TA 5CGTA 4C90A 1QWKA 3GTFA 5HMSA 1Q13A 1IXPA 4W86A 3MMDA 4HKPA 1CB2A 3KP0A 3B0PA 4F2UA 3TYBA 1R9XA 4RPQA 3RLHA 4FXRA 1US3A 2Z2AA 5IHSA 3LCWA 3KTSA 2O9TA 3MBFA 1KQZA 2VC9A 2HZGA 2Y88A 4IFOA 3W71A 3IAPA 3L66A 1E73M 4F0RA 4TX8A 3BARA 1TCDA 3DOPA 3UZWA 4HT3A 1XYAA 2CESA 5AFDA 2EQDA 1FWBC 3PPCA 2X0HA 3B9NA 3R8GA 4C65A 4PCTA 5AYXA 4FIRA 3VU2A 4H2HA 1UWTA 1IQ8A 3MKVA 1WDSA 1GZJA 1HGWA 4WSHA 2F8QA 2VO5A 5CSSA 2HMCA 1JPHA 3CT2A 2ISSA 1M5WA 1S5TA 1A5OC 1F8MA 1WKYA 3LRKA 4HGXA 1LCOA 1RH9A 4LUTB 5HQEA 4BFAA 4K6AA 3O2LA 4H00A 5FESA 4H6KA 4JGDA 5HULA 4AZIA 5EBAA 3W0KA 4XISA 4XZNX 2Z4GA 3C2RA 3AXHA 3C2EA 1EDGA 3EX6A 1AH4A 1UBPC 3TDFA 3ICJA 4BQ2A 2YBUA 3YPIA 1XRTA 4H04A 1T40A 4WJEA 4LYPA 3W7KA 3QHMA 1UZHA 5FL0A 3TYCA 3KAOA 1S2CA 4WDTA 3S9YA 4CNOA 3PZGA 2X7VA 3O16A 1J0ZA 2OSYA 2YZRA 1DL3A 1N55A 4Z42C 2VEMA 3THCA 1FWEC 4JTEA 4OOZA 1A50A 1W9UA 4HOWA 3ZQ9A 1BKHA 1UD8A 4QS6A 2FPTA 3Q37A 1CBGA 5CSYA 5J8LA 1O12A 3FA4A 4WZHA 3KE0A 3LPOA 3OZYA 5KZDA 1ISYA 1UUQA 3O05A 4JTAA 3U4FA 3VIIA 2NLIA 3L5AA 1RD5A 1TWZA 1W37A 1BVZA 1NH6A 1EF3A 2PP0A 5EKYA 5AYYA 3Q58A 4IJRA 3PAJA 3OODA 5T9BG 4EE9A 3WLOA 3PBVA 2ON3A 5AN7A 1EYWA 3WDQA 3M43A 4HNVA 3OLEA 3P8IA 1M53A 4PB4A 4QAWA 1A5SA 6ENLA 1YEYA 4V28A 4IF2A 5BMWA 1VYSX 2DZXA 3SADA 2OZ0A 3M0XA 4YVPA 1UKTA 3TQKA 1HQTA 1MRAA 3VILA 2HQAA 3OGVA 3W24A 1YTDA 2J4GA 1UOZA 3B0YA 4J40A 1AODA 2QDGA 3E49A 3EDKA 1E3XA 3MMUA 2XJ7A 3PHAA 4L61A 1FKXA 4AQLA 2YDSA 3GVQA 2A0NA 3W2UA 3OTRA 4J5NA 3H55A 3U6WA 2FGLA 4E6MA 3AU6A 3DG7A 4MJZA 3LB0A 4QITA 4MPKA 1G4TA 3TJ4A 5HNUA 1VFHA 3G5EA 3MU7A 3WQ8A 2VXNA 2BVYA 3FS2A 3L23A 5EMUA 2VWSA 5EFDA 2VEIA 3WUGA 5T8GA 3DI0A 3T44A 2FMNA 3SFKA 4WSKA 1CECA 1XD1A 5D8ZA 1UJQA 4X63A 2GGEA 4HSNA 2EO7A 3BICA 4ZBCA 1U1HA 1FFRA 1XYLA 2Z29A 2Z1XA 4GQ0A 4F3HA 3TW6A 4ILSA 3S6OA 1GVSA 2EAWA 2E5DA 3P62A 3KBWA 3OB8A 4D9PA 3OIHA 2INZA 3FDGA 5GJMA 4WLCA 3AMGA 1Q6LA 1PJ9A 2DSVA 5HPCA 2Y4SA 1F3XA 2C14A 1EWDA 1QO5A 4EXAA 2A3LA 2EHHA 4H9VA 4UFKA 4UR8A 3ITGA 4CNTA 2MUCA 4UB9A 3WMCA 2GJPA 3GFYA 4JFUA 4U28A 5EMLA 2WSRA 3WX7A 4NZJA 2C71A 4JKKA 4C6DA 1G7UA 3TQVA 3DAQA 2B7QA 2P3EA 2O92A 1FCBA 1J0KA 1KRBC 4LPCA 4REQB 3B40A 3MDUA 3U2EA 7ENLA 5BOFA 1X98A 3IUIA 2CCRA 1HL8A 3F1QA 4N42A 4M82A 5JH2A 2ZZ7A 4BK9A 1Q6RA 2Y70A 1EFZA 2AL2B 4UQEA 3H2OA 4QE1A 4V27A 4UCGA 1ZCOA 3UG5A 2BMBA 1R2TA 4QQUA 2Z1WA 2YPIA 5FL1A 2H8XA 4QHRA 3SCUA 3CYVA 4BWLA 5A2CA 4IIGA 3ABZA 3H7RA 1E71M 3AYSA 1KCLA 4D6DA 1BWLA 1ONWA 5JU6A 1GHSA 3S8HA 3B9AA 2A7NA 1XH0A 2EKCA 1PZ1A 1NJJA 2QF8A 3MQTA 3TEVA 4QR6A 3GNNA 4XZLX 1NDWA 4JTTA 5F2LA 1GVIA 4IMCA 2YYTA 3FDKA 1H62A 3Q4DA 3TW7A 3WFZA 3GNPA 1K70A 2V5DA 1VR6A 3KOYA 5A6TC 3CHCA 3TLQA 3P7YA 4LAUA 4LWWA 5CBJA 5I3GA 1WAUA 4XAYA 2JBMA 3AIRA 2C1HA 3C2VA 4ZB5A 3NM3A 1O5XA 1W1YA 3F4DA 5KZ6A 2OEMA 4HNNA 4R33A 3TQ0A 4Q33A 3GIYA 4TX9A 3UR8A 4DNMA 4DVOA 4BCEA 4D6GA 3GDTA 3CHVA 3UXLA 3DEQA 5EMMA 4JDYA 2OGYA 4O1BA 1YADA 1JYWA 3P14A 2X7WA 1UPMB 1TVPA 1VS1A 4JNMA 3B8TA 4OJYA 2VEFA 3TZFA 1K8ZA 2HSAA 3LCGA 2BLEA 3I10A 3WDJA 1LWIA 3NO1A 4A8IA 2A21A 2I5IA 1TTPA 4Z1DA 2VVNA 1P6WA 2Z7KA 3ITXA 5A8QA 4AHPA 2C19A 4AAJA 3DFYA 3F5JA 3BSMA 4HK7A 4AD0A 3FJNA 1H41A 5JIPA 2WMFA 3GFXA 2ZRXA 3W4RA 2NV2A 2E4TA 1DIOA 4P8XA 1K9FA 1K4GA 3OPSA 1KXVA 2PUZA 3RK8A 1FWIC 3PPHA 3V0TA 2YLAA 5CZJA 1EGVA 2Y8UA 4GFSA 4Z0SA 2GVGA 4RXFA 2PTZA 4H6QA 2BGQA 2HV5A 1KKRA 2XIOA 2BNJA 3BTNA 3AXKA 2VZSA 2WC3A 1W32A 1UIPA 1MWOA 2CHNA 5CKSA 4W5ZA 2FVLA 2HE8A 4QXIA 5TD4A 3B04A 4Z2IA 2BSLA 1C9DA 1KBKA 1UH3A 2AMXA 3U2ZA 2O7SA 4NAFA 2Y7GA 1E1CA 1OFAA 4LCQA 1KO0A 4R7WA 3WMLA 1VIWA 3SB0A 4R34A 2Y5EA 3PNZA 7ODCA 3E1F1 4Q8QA 3UWYA 3VNJA 4F2BA 1HVXA 2WKJA 2BHZA 1S1PA 4NYUA 2OZTA 3K4WA 1OINA 1DV7A 3DFOA 5LIXX 3WELA 2WQDA 4E0CA 1J5TA 4GISA 4Z2LA 4K1GA 1B9BA 3M64A 2FHFA 4UNKA 3VIJA 2DH2A 2GGIA 2PA6A 3TTYA 1E72M 3NL2A 2GOKA 3ZT5A 1RBLA 2EEXA 4GUHA 3RPMA 1P0BA 2E68A 3ONBA 1P1XA 3UCDA 1H0IA 5TNVA 2PDWA 2Y7FA 1H1NA 2QCDB 3QFEA 1AZ1A 2PDCA 3T0BA 5CZKA 1JDFA 3A47A 4AZHA 4HPJA 1KD0A 1R85A 1AH3A 3GXPA 3QV7A 4XZIA 1ICSA 1G4PA 2Z26A 3CM4A 4M3PA 3W2JA 5HPOA 3WUBA 1TZZA 3SY5A 4I5UA 3UZYA 2DY3A 3T09A 1Q2RA 1FWSA 2VEGA 1FH7A 4HA3A 4GACA 4FK9A 4AD1A 2J7DA 3LLXA 1CGTA 4A4AA 2Q8LA 3N9SA 5I7GA 2WWDA 3C0LA 3VFLA 4YHEA 4ZSUA 1JI1A 3KDOA 2XFRA 1VJSA 2QVHA 4PUUA 2XGIA 2D22A 1NSJA 4MNKA 1B3VA 3CL6A 1DWHM 4TIMA 3CHDA 1TPVA 3ARZA 1RK6A 3WQWA 1GGOA 4HOXA 1TWWA 4M29A 2RJGA 3QV8A 4GY7A 4PCPA 4KCVA 3GDBA 3ZWSA 1XRSA 1NF7A 2ZA2A 3AJ7A 3I6RA 1EX5A 3QR0A 2NSXA 1DJGA 3IIVA 4HQVA 2V69A 5I03A 3SRHA 1EP2A 3V36A 1XFBA 5F2GA 3BLPX 4CD7A 1GKRA 4UUIA 1LL7A 3KTCA 3GK0A 5D2WA 4F66A 4S3KA 3M0KA 4MFEA 4PRWA 3LD5A 2FTYA 2XFYA 4JTLA 1XI3A 1KR1A 4PL2A 3PZ9A 4BI6A 4PMQA 2NX1A 1DKWA 3WF2A 1W3HA 3T0AA 3ALGA 3NQDA 1M01A 1VFFA 2QV5A 4KGJA 1E1FA 1F07A 1FUYA 3LENA 4D6EA 1XX1A 1EJSC 3CB8A 4B92A 1XKYA 2O9OA 2QCGA 1US2A 3VTRA 3G1VA 1C92A 1B57A 3SCPA 3NQGA 1V02E 3B9EA 3LBMA 3G1AA 3NM1A 2BDQA 3BOXA 2ASHA 4AEFA 4TXEA 3W2KA 4KEMA 3SCVA 4MJ2A 5LIWX 4LJ3A 4JYEA 4FS9A 2WCAA 2OX1A 3WNLA 3BPWA 4X2PA 4Y96A 7TIMA 1BYCA 4O17A 1A5MC 4XZBA 2ACQA 4NNBA 3GDRA 1R2SA 3N29A 3GH5A 1K8YA 1FTXA 2ZXDA 3QV6A 3TR2A 5LGXA 1C93A 2I9EA 1XRFA 1JCYA 3HTWA 3N2MA 4IMDA 2JGYA 4DAIA 1Z48A 4WUIA 1SJCA 3RILA 4RW3A 1YMYA 1YW1A 3CB3A 1E0XA 1E9LA 8XIMA 1UR1A 1JZ3A 3VKBA 3NO5A 4L9YA 3UGRA 4FI4A 1Q4NX 2Q02A 2D1ZA 4UTWA 3SEPA 1ZZMA 3POCA 4P61A 1NELA 1BWKA 1WXYA 3SSZA 1RY8A 1M04A 5E70A 2OWXA 3SUVA 4J3UA 3W26A 3DBNA 3HQPA 3RHGA 1WOAA 5I3KA 4GQQA 5SWUA 2V3GA 2G4FA 1UR8A 2AGKA 2OSWA 3I3DA 4WX2A 4WRHA 3T07A 3UF9A 5LZLA 1GQJA 5D09A 1AFSA 1OYCA 1LBLA 1DJQA 5E0CA 5F4SA 1FRBA 1SR9A 4MWAC 4PUDA 2NSOA 5AHNA 2WK2A 3FGCB 1AL8A 4QGCA 1UD2A 3S0CA 2Z00A 4JQ2A 5FJRA 4FPSA 1LROA 4LFYA 4RZ5A 1LTDA 1LF1A 2WSYA 4DBEA 1QHOA 4L1XA 1F6YA 2DZBA 3O07A 4AIUA 3W38A 3W87A 5AC5A 2H9AA 2PDYA 3FA5A 4ACZA 4UMCA 3L0KA 5ECVA 2OEKA 2YW4A 1BLIA 3LQGA 1E6RA 3TFXA 2P8CA 3Q67A 2ZUNA 2V3DA 3ME3A 3KOFA 4ERIA 3INPA 2ZX7A 3DX5A 4ORMA 4S3BA 3U4AA 3BOLA 2OEJA 5C5YA 5ABFB 3PK7A 4FZIA 2QUUA 1DIKA 4J3XA 1CGVA 4REQA 3HV9A 1QOPA 2MNRA 1MYRA 3W07A 1UZ4A 5FA5A 1DQUA 5CPOA 1QHZA 2CHRA 2ICSA 1AW1A 5I78A 3WUEA 1V6TA 1EJXC 1S38A 3L4XA 4GUFA 3S83A 3DBPA 1FHLA 4LT9A 1AQ0A 4PMYA 2ZX5A 1KXTA 5D05A 4O1EA 3LCFA 2PGFA 1OG6A 1OD0A 4MY8A 3CWHA 3C0SA 4JX6A 2F61A 1UWRA 3LPFA 4FIQA 1VH7A 1W3TA 3F5LA 1W1TA 2Y62A 3MCNA 1QNVA 1POJA 2AAMA 1W1A1 2E9BA 3S1VA 3SY1A 3NQAA 3R10A 2TAAA 4HU0A 3SFWA 2CHOA 3I6TA 4HMNA 4KEVA 1NP0A 4DBWA 3VNDA 1ZAIA 4XAPA 1IT7A 3MSYA 1TMHA 4FO4A 3W1PA 5LA1A 1W1IE 1GCYA 1MZRA 4JZ5A 3W7GA 4L6HA 1P48A 1KC7A 5JBEA 2BGSA 3S6TA 2B4GA 3HQ1A 4DWDA 3ANVA 2GYIA 4IXXA 4O1AA 4HSHA 1KXQA 5IFPA 5CQ1A 4TVDA 3PTDA 3VD5A 4H9ZA 1DHKA 1WZKA 4F9JA 5AZ1A 3W72A 3M5ZA 4XAGA 1L6GA 2WMKA 4JN8A 1QASA 3IV3A 4DO4A 3F4WA 1JCTA 4EVZA 3UG4A 4FNQA 2HISA 1Q8JA 4JIEA 2AKMA 1RR2A 2NT1A 2DDXA 1MUCA 3A22A 4UQAA 1CIUA 5E5CA 1CXFA 3ENLA 3ARWA 4WXYA 3W6YA 4XQ6A 4YU1A 3A64A 2X0YA 1XCXA 1NARA 1R30A 5H8MA 2INFA 4CU8A 2XFWA 4LAZA 4AZBA 2EG8A 4AVNA 1X8FA 2RGLA 1TUFA 5A8OA 2WSPA 3M47A 1DIDA 1JDDA 3GYEA 2D3NA 4PMJA 3EOEA 3VIOA 3OEXA 3BV7A 3PS7A 1OZMA 3WK1A 3GTNA 1XIEA 3HO8A 1QI0A 3DUGA 4H8HA 2QQ6A 3KCJA 4S3CA 4DM1A 2GK1B 4HB7A 3PZVA 2VTFA 3TCEA 3H2AA 2PBGA 4Z2KA 5I00A 2ZUUA 5FJUA 3APGA 2Z2UA 4K36A 1MXSA 3SIMA 2DVTA 2VQTA 3RX2A 1QBBA 1B54A 1DQXA 5DX7A 3IACA 2J8FA 1U83A 3BZJA 4GVHA 1J5SA 3CGTA 2GJNA 1OGGA 1C91A 2X09A 5DN1A 2HVOA 2WB5A 5F2MA 4UOJA 3AXMA 1XBVA 4E4FA 3STGA 4NAEA 4M5PA 4DWSC 3CMJA 5A69A 1Q6QA 1R3SA 3IWPA 1RLDA 4PUMA 4NX0A 3E5PA 3EX1A 4Q7BA 1UBSA 2NQZA 1JAKA 1XRVA 3QHOA 3ITTA 5MKGB 1FWDC 1NIUA 3CTTA 3H2EA 5MF5A 2J77A 3QKEA 2XSBA 4XV0A 3IIZA 3RPTA 4GYJA 1E6NA 1SJDA 2G3NA 4IQLA 3R0KA 2WBKA 3WLKX 4XIMA 1F6KA 1ZP4A 2XPKA 1FWFC 3W75A 1RXOB 4C7DA 4C6OA 3O0FA 3DFNA 3KRSA 1GPFA 2R1PA 3F7JA 3IK2A 3WLIA 4DZ5A 4QJ5B 1E6ZA 3ZR5A 1IGWA 1U22A 4O4WA 1EC9A 2YL6A 2WVVB 3ECQA 1S1RA 1A5LC 2OYMA 4IPLA 3WNNA 3PUEA 2A4AA 4E38A 2GWGA 2D2OA 3N19B 4ZOBA 1HIZA 2GUUA 1CDGA 4GIEA 4W89A 4PH6A 5HQMA 3EOLA 3ZR6A 3W1UA 2E6DA 2AQOA 3WSUA 1TYGA 2XVLA 4FLSA 4IGHA 4U31A 2WKGA 2PEVA 1OWQA 5E0KA 3TIMA 2HJPA 2YIHA 1F05A 4NXSA 1G1YA 3R13A 1HW6A 5JQ9A 3DH7A 1WYIA 3IIOA 4I90A 3TTQA 1T8QA 3FOKA 4IX2A 1NU5A 2TPSA 4FNTA 3OVGA 2NUWA 2HEJA 1WDQA 3W28A 1ECEA 4JHMA 4BEUA 3TYEA 5TF0A 1OSEA 4Y9OA 2GDQA 1K03A 3ZLFA 5CG0A 2OKTA 1Z41A 3L2LA 2FHBA 4ES4A 3NUKA 4DYKA 5DELA 1N8IA 4PSPA 3CLWA 1S46A 1MXDA 5LIKX 5C9UA 3UQNA 1G94A 1RQHA 2Z1SA 4JTCA 1QMLA 1GWJA 2QJHA 2Z1VA 1VLIA 3N25A 1GOIA 4W84A 2I5QA 3DYOA 1B9ZA 4D6CA 5LGZA 1F3EA 4OKDA 4MWAA 4DWSD 1Q65A 3E2VA 3MW7A 3NJ3A 4KFOA 1UQZA 3SCNA 3B97A 1W3NA 3NSMA 2X40A 3CAWA 3ID7A 5EYWA 2J47A 4J1OA 3QGVA 4MB1A 1NVMA 4Q8VA 4UR7A 4XKMA 1UYQA 5C9XA 5JBFA 2WMHA 1EGZA 1QK0A 3WDIA 1YDYA 3E0IA 5I07A 1UPPA 5C70A 4MNMA 1H09A 1GVRA 4Q6XA 2CPUA 5BWAA 4IQEA 4ZO9A 4GY0A 1A3HA 1JNDA 3AMLA 3G22A 2DORA 2DZSA 5CGMA 2XZ9A 4I9TA 2BZNA 3MUCA 4L4LA 3ANYA 2A3EA 3CZ8A 4L65A 4CVUA 3CU2A 5HMEA 3O6DA 1S2TA 1X6UA 1UR9A 2EG7A 3HPXA 4L80A 3KHJA 3E5BA 3HQNA 1EO7A 3GR7A 3NVTA 1A53A 1PIIA 1JCNA 3T9PA 6A3HA 1PS9A 2YB1A 3KHDA 4YL2A 4BS0A 3LHWA 4EP8C 4JFTA 1KM5A 4D72A 2BOFX 4H7VA 3L67A 3WLRA 5CBIA 2Q8XA 3BLKA 4MZ1A 3FN9A 3DFHA 4LQ1A 4G9PA 2OB3A 5DBUA 4IT1A 2ZC1A 3WFLA 3T4WA 4RR4A 1TFVA 3LV6A 3T55A 4TO8A 2FH8A 2FB3A 4ZO7A 4AC7C 3GU1A 1LG1A 3HF3A 1KRAC 4HN8A 1X39A 3NAVA 3URBA 4FX8A 3ZLHA 1XBXA 4AC1X 1QFEA 4B2DD 5BW6A 5PTDA 4QRNA 3OLDA 1JZ5A 4YYCA 4QLKA 1EL3A 1EXPA 2DQWA 1AJ0A 4ZENA 4HP5A 2ZUMA 3TKFA 4PMVA 1FWGC 4IFRA 1IXNA 1PWMA 1XW8A 1I8JA 3UR2A 2XSXA 4B9YA 4DBSA 3KBVA 1P0NA 4JIRA 4C6NA 1Q6DA 3JRKA 1VFTA 2CLHA 2PDMA 3RAOA 2QCLA 1B1YA 3VIMA 2BY2A 3PR2A 1EPVA 3TJXA 4QSFA 5HUOA 3WQ5A 1DJHA 4NZ3A 4US6A 1H63A 5BYWA 1JGMA 1ADSA 1OF8A 1KRMA 1CXEA 2A6NA 1B90A 4LUYA 4Z1AA 1A0DA 2XIIA 2Z1KA 4B5NA 2IW0A 4M51A 1V93A 1W2PA 4D8LA 4UFMA 4CD5A 4M6UA 3ARTA 3HV8A 4LCSA 4FB7A 4D6FA 2BY1A 4QJ3B 3QC3A 1EJWC 1LP6A 4PUEA 3QZEA 2GVJA 1BD0A 2QIIA 3AS1A 4PR4A 1J93A 2WVUA 1MUMA 4L1WA 5GVJA 2V5BA 1ZBWA 5A3HA 2ISFA 3K8MA 3NL3A 3M07A 4MY9A 3MVIA 1O5QA 3OBEA 4DJEC 3VUPA 3T4CA 4R7JA 4IIBA 4NZ1A 4V1YA 2ZCGA 4JIPA 3GX9A 3P81A 3KP1A 2GGHA 1GJPA 5A94A 4U33A 1PTAA 3AXIA 1W2VA 1V6WA 3CIXA 3RR4A 7A3HA 4XZMX 3TWAA 1PE1A 2BV9A 4M24A 3C2YA 2HTMA 3UXIA 1JUBA 3TSBA 3IV8A 3J7HA 4ZE4A 5FJPA 4KIEA 3DIPA 3LHZA 4W7UA 3IAQA 1MNZA 2I56A 2CKSA 3VPLA 3HU7A 1E4MM 3WQGA 4JDBA 3CC1A 3NURA 4PUKA 1UC4A 1WQ5A 1OY0A 3A4XA 3WD2A 2HK1A 3WLPA 1YDVA 2YBVA 1ME9A 1NQKA 2R8WA 3V3WA 3CPGA 5DMNA 3NA8A 3TFCA 2X1SA 2X8RA 4UMBA 4JHZA 2Q3OA 4EPEC 2E25A 2IXVA 3MJYA 4O1DA 3VZZA 2HCVA 3BLDA 3KEHA 5CPNA 5LNVA 1T0OA 3UY7A 1QNOA 1XIGA 4E5TA 4K7YA 2RDUA 4PMOA 3A24A 3UNTA 5B80A 4Y90A 3MANA 1AJZA 3S2JA 1XS2A 4Y8FA 1J0JA 1M7JA 4O50A 2V2HA 3G8RA 3LX9A 2EF9A 3W1TA 1PHQA 1MW1A 3KFTA 2A5HA 1L8NA 3N17A 4MB5A 3EKLA 4NJHA 3G3MA 3VKKA 2OG9A 2PDBA 1TWIA 3V1PA 3W7LA 2B7OA 4U4MA 1XIFA 2Y61A 3FXGA 1I0DA 3W88A 4HVXA 4M8UA 1W9BM 2VUNA 3OOQA 3DN5A 4OHQA 3EZ4A 1EIBA 1X1NA 4ZA0A 4DNHA 2FHCA 3M0LA 1S2WA 2V3FA 4A3RA 3NZRA 2O0TA 4JTRA 5I3FA 4DJED 1MEWA 5I79A 6ALDA 3GB6A 1W1ZA 3CTLA 3QF0A 5BXRA 1Q85A 3AU2A 4ZR8A 1ITCA 4P7NA 1WXZA 3DHDA 1XWYA 3GH7A 5MHBA 3O6CA 4JX5A 4JQ4A 3LOTA 2PDQA 4NRRA 3BG9A 4H9YA 3RU6A 4F0HA 6XIMA 2E8YA 2Y7EA 3C5QA 1GG1A 3CUJA 3QN3A 2FPYA 1SW3A 4C6FA 2CWNA 4GVIA 3CZKA 1W91A 5DMLA 3E12A 3QY6A 1J12A 1I2NA 1EDTA 3EEGA 4UR9A 3VOIA 4C91A 2HNHA 4EACA 1VCVA 1XLFA 2XH4A 2RH9A 4E8GA 3BDKA 1FHVA 4C5ZA 4GXMA 4PRTA 1Z3NA 1W5QA 5I77A 3PUGA 3TN3A 3TTEA 4PTDA 4LU0A 4CNSA 1P0KA 3VABA 4PCFA 1XF0A 1MDLA 3K2GA 1C9WA 2Y8VA 3V1HA 5C2XA 1BXCA 2EJ1A 2NVCA 3CAVA 3WF0A 1ZNNA 3M5XA 3STEA 1P7TA 3ZO9A 3TSDA 1HXJA 2YA2A 2IXUA 3ZVHB 4H41A 3C4UA 2R6OA 4QBXA 4M0XA 2CXGA 5LIYX 3QC0A 1IWPA 4Q8NA 4W93A 1KA9F 2A7RA 3O0KA 3IVUA 2ZWYA 4DJEA 5C9RA 4AD4A 3WMBA 4KMQA 1WKDA 3SECA 4DUWA 3O63A 2V68A 3H2CA 3TROA 1OFEA 1P0DA 4W8AA 1LRQA 4O1CA 4Q3MA 2CFFA 3LBOA 4A05A 1B31A 3Q65A 3AS0A 1TJPA 5DXYA 1L2QA 3BVJA 1E5NA 2ZE3A 5A6LA 1JUEA 9RUBA 3PB2A 4O0KA 5FF2A 2FGBA 2PF0A 2EPKX 4JTQA 3OGSA 3GW0A 4RNIA 4UQDA 4JOMA 3T40A 5GNXA 3EX4A 2YCIX 3W7EA 3RM8A 3AQUA 1TPDA 2GGGA 1BG9A 3S9ZA 1ITUA 3BLIA 5XINA 3U5YA 3PBGA 4IH3A 1RD6A 4FNUA 4RDYA 3V35A 3ARXA 4R5EA 7PTDA 5IOBA 2WHKA 3WEZA 4Y9NA 2EG6A 3NGFA 3E0FA 3GKFA 2YOCA 1WP6A 3DI1A 4R9XA 4MZ8A 1FFQA 2PWGA 2XIJA 5DEZA 5FSDC 1XYFA 2OWWA 4GZEA 5CAKA 2XHYA 1BFNA 4QEEA 3BJFA 2UY5A 2VCCA 3ZT6A 4W5UA 4M6VA 3BCFA 3TQPA 1E0WA 2V30A 3QMTA 4K8GA 3ZJ8A 3RM4A 1DE6A 4DF0A 4HYVA 1WDDA 1XKJA 4ADUA 3D0CA 2GUBA 4GGBA 2WMIA 1Q5MA 2FFCA 1RZMA 3E74A 3G6MA 3TC3A 3SURA 4US5D 1WNOA 4TU1A 3NPXA 3EB3A 3VGEA 3ZS4A 3H2NA 3PZQA 1FCVA 3QMRA 5K9CA 1HJSA 4Z1CA 4MB3A 2WZHA 1K9DA 5KEZA 3EWCA 4IJCA 2IKHA 3VNLA 4ZGYA 3HBLA 4YNGA 3PM6A 3ZSTA 3PVFA 3S46A 3KS5A 5C8BB 2FZ8A 1NOFA 1EDQA 1JPMA 4PRRA 1VB9A 3GSMA 2I1OA 4NL1A 2Z28A 1IV8A 2YB4A 2EPHA 4I5RA 4RDZA 2NVAA 5HANA 4DUVA 4C60A 4MHBA 4NI8A 2VDHA 3AICA 3LNMA 1LG2A 4B90A 2E77A 3O9NA 1NQ6A 4CUCA 1QPQA 9XIAA 1I6NA 1V3JA 2JE8A 1FWJC 1NWUA 3TYZA 1MVYA 2ZC8A 2QZRA 3UG8A 1VIZA 5CH9A 2VX6A 4S3EA 1V0MA 3M16A 1JZ2A 3GG8A 3G1YA 4GNKB 1FDJA 4I5XA 4H9UA 3ZR4A 3M0YA 3AHXA 2QIWA 3OGRA 1LL6A 2PTWA 2Y2WA 3OHMB 1J96A 2WCSA 1DEDA 1ZPTA 3ZT7A 5J5RA 1H11A 4Q4PA 3B06A 3TAKA 4B3KA 2WO5A 3CXOA 3LDVA 4N9BA 3HM7A 2VR5A 3ARYA 4AD5A 4ICMA 3AHYA 3SM0A 4H9XA 2R82A 4BQ5A 4UTWC 4NKCA 5H6HA 5H2ZA 2OOFA 1UIOA 3M0ZA 4C6LA 3TSMA 3K4AA 3TUUA 4IPPA 1JQVA 4PEEA 4Q4KA 3UVIA 9CGTA 1HUVA 1JIBA 5IBXA 3NFUA 2AMGA 4B2DA 4KCTA 3DC0A 4A29A 3WF4A 3DGRA 2WC4A 4C5YA 2DPEA 1YXYA 4L7ZA 5KSWA 3UZJA 4N9DA 2WYSA 2W3ZA 5TQLA 2BX7A 1YNYA 3CT7A 4CQ8A 4NVTA 5U7SA 4AY7A 5D8WA 2V5JA 5I3DA 1Q66A 1ZBCA 3GNXA 2E6YA 1XYBA 2D2JA 2NWSA 1VKFA 2PWEA 4IMGA 3K46A 4E4UA 1BEUA 1YHTA 1KM3A 2KZHA 2C91A 3A9IA 3EA1A 4MM1A 4XO6A 4CQAA 2YL5A 3EKGA 2DUXA 1TPWA 3IVTA 2OJPA 4ERGA 1R9YA 4XO7A 1EA0A 4GQGA 2X42A 2IS7A 3CH0A 5KETA 3LTYA 6XIAA 2GJXA 4UTLA 1A5CA 1AQMA 5JXQA 1TMLA 3KRBA 4XBJA 3W74A 4UBPC 3V4BA 3FXYA 3N6JA 4KQNA 3LCHA 2VYOA 4O28A 1DJYA 5MKGA 2PI6A 1S2AA 2ZADA 1TPUA 3WLSA 5EA9A 3ARQA 2RJHA 1T8XA 3R0UA 1Q7ZA 2I5GA 3HGJA 4J3SA 4P5UA 2POTA 4JIHA 4AY8A 5CJ5A 1TJ2A 3UWUA 5BRQA 1R38A 3R4IA 2CU0A 1OZQA 2OX4A 1ZQ5A 1TIWA 1FX6A 4GPNA 2XU2A 2WPBA 1KKOA 3WBXA 3AC0A 1MDRA 1UR4A 3LS9A 1OT1A 4WDXA 4XB3A 3T0TA 5L9FA 5HR6A 4RE2A 4H3DA 4IISA 4LBUA 2DSWA 3LHUA 4KWUA 4DWSA 4WQ6A 5I23A 4W8LA 1RP9A 3RRAA 1XG3A 4IOTA 3EKZA 2GWNA 3VZXA 2C1GA 5E6ZA 1W3LA 4GX9A 1ZJIA 1TV5A 4DLMA 1FXPA 4XX6A 1H4PA 2DT3A 1NDVA 1ME8A 3P3BA 1OADA 4LUTA 4JN6A 2QHAA 4QISA 4OV9A 2EBNA 3AIUA 4HYWA 4HU8A 4RNHA 1PKMA 3R94A 2WVTA 3H21A 1A3WA 3D3FA 3UPMA 3AISA 1EXBA 3RLGA 3B8VA 1ISXA 5G2WA 3GLCA 3C61A 4DIAA 4JFSA 5AVNA 3VC5A 1XIIA 3WLTA 2VC5A 3UT0A 2ABAA 2HXUA 1RLCL 4P8UA 4IG2B 2VFFA 2J9YA 3FHQA 5AVHA 2NXIA 3L4WA 1O68A 4Z1YA 6CGTA 1ZY9A 3L5MA 1W1PA 1EBHA 3F5KA 4DO7A 4AHOA 3MY9A 3KRUA 1IEWA 5LNWA 4KCWA 3MSDA 2CLIA 3TJLA 2OCZA 5I02A 3SCOA 2OZ8A 5DT7A 1Q4WA 3QVQA 2D0FA 4UTHA 3ZZ1A 4Z2GA 1EJ7L 1HJWA 3MKKA 5D2VA 2YFNA 3GC5A 3SI9A 3T2OA 3NNTA 3RGTA 4MDPA 4XIAA 1KFBA 1P6CA 1GOMA 4NXKA 3GC2A 5DBTA 4DUOA 2BXYA 3L4ZA 3UR7A 3EWZA 2V5LA 4ZOEA 4AF0B 4H7CA 1TX0A 5FACA 4JNZA 3CQHA 4ECLA 3UP8A 2YCLB 1Q3NA 1QOXA 2ZX8A 2YKKA 4CNNA 3LCXA 4UTTC 2EKGA 1K7XA 1F74A 2G3MA 4IUGA 3IK4A 2CLKA 4LX4A 2XGBA 3BAIA 4Q7NA 3TAOA 1J2WA 4WSJA 2VM8A 3LCLA 4AX7A 4D8ZA 4LB3A 3DESA 1XLGA 1Q6EA 3CO4A 2A3CA 1QI2A 1TE6A 1E0VA 3S4TA 3UD6A 4ZZ9A 3U2OA 2EJAA 2JK2A 4YTUA 2YFOA 3RDKA 1L9WA 1MW3A 1IYXA 1BPLB 1EZ2A 2QAPA 1T5AA 2FDMA 1S2VA 2PSNA 3I4KA 1XUUA 4PFMA 3OQEA 4HMCA 1E43A 3MC5A 4U3CA 4LOCA 1CNVA 1VGAA 3JS3A 2WMIB 3T2PA 2FH6A 2WVVA 2YL9A 2BVTA 1P4CA 3W23A 4JX4A 2RUSA 2YW3A 3EOSA 1UR0A 4NYYA 3KBNA 5E1QA 4GX8A 3LMYA 3O6YX 3GDMA 4WXZA 3PG9A 4HU3A 4MY1A 2HRWA 4RE3A 4UXDA 5K4ZA 2FZDA 4ZXOA 4GE8A 1HTIA 1WBHA 1BSLA 3QGAC 3LZ5A 3R0DA 1OYBA 2PMQA 4J2MA 1MFUA 4QSHA 1KCZA 3BK0A 5AHIA 3NXLA 5LNSA 1H61A 4QCEA 4OE7A 1V6XA 4TMCA 1RQEA 3NVDA 5CCZA 2HE5A 2QCDA 4N9CA 2WAGA 1PXGA 1KBIA 5C9ZA 3T7VA 4XWUA 3SR7A 5FEZA 4MMWA 3E02A 2A7PA 1A5KC 2HVMA 1DJIA 2V3EA 1TE1A 3A9BA 3GR4A 3RCYA 2VZVA 4DO5A 4UFIA 1SM9A 2ZUTA 2OT1A 4B5XA 4GIAA 1UKOA 3N18A 3GAYA 2ZZ1A 1JCXA 3P0XA 2YXGA 4PBEA 4PZVA 1IIGA 3ZXWA 3S9IA 4CD8A 3W7QA 1F73A 4LS0A 2AKZA 5DQPA 1J4EA 4HMDA 4R9OA 3UWVA 1HNYA 4QLJA 4NRSA 1UP3A 1DP0A 1UWSA 3NQ2A 4AU0A 5K7JA 4C6MA 3GHSA 3OVPA 3IUHA 3STCA 1L6FA 1WA3A 2CLPA 1LQ2A 3DFTA 4KRTA 5FF0A 4ASTA 1WOBA 2VKZG 3R8HA 4GABA 3WMSA 5DLCA 2E6AA 2PRLA 1UD3A 1TA3A 3UZ5A 4NIRA 3NSXA 3WBWA 1EX1A 1TV4A 3CWNA 3AWNA 2AQVA 3BG3A 4KERA 3FSTA 4LNCA 3G24A 1UA7A 4U2YA 1PX8A 3B3DA 1G01A 4IUOA 3EB2A 5L6UA 3PC0A 1RBOB 4WF7A 1GYNA 1WO2A 2Y8KA 3LTPA 2DT1A 2VNCA 2W27A 4IPNB 2ACSA 1OX5A 1A5UA 3NQ8A 4HCHA 4ZQRA 4H6RA 1IT0A 1J0HA 4FMVA 1XBZA 4CNUA 3ATYA 2L5HA 1B30A 1R47A 3LM3A 4IFKA 2G5WA 2WLYA 1N2VA 3WJWA 1GTHA 3TJIA 5K9XA 5A95A 1UASA 2VL4A 3A3HA 3VYLA 3VKDA 3G0UA 4M7SA 1IZKA 4MKNA 2WVSA 4JY9A 1W9VA 3WLHA 4CCZA 5IFTA 2VCAA 4G8TA 3C3UA 3VNMA 4AXKA 3PY2A 3UNDA 4JAWA 3GTHA 5AHEA 1ZTVA 2G3FA 1BGGA 1GVOA 3PUOA 4ZFMA 3BAKA 1Z6KA 2PDLA 1LJYA 5A8MA 3CEPA 5EU9A 1OT2A 1ZUAX 3GG1A 2GQAA 5DCBA 1O6IA 4JL2A 3WH9A 4IG2A 3B8DA 3TH6A 4DYEA 3SRFA 4KEZA 4LV4A 3H2MA 4N4QA 3QZAA 2FIQA 2VCBA 5D03A 4TV5A 3UBPC 4AZGA 4GYFA 3CV6A 3LY0A 3KL0A 4J3TA 3A4AA 3WENA 5I3IA 3VDHA 3URQA 3VGBA 4D6IA 3FJ6A 3M7WA 1PPIA 2PWVA 4DJDA 4CQ9A 5ABFA 1FH9A 3VUSA 4ZOAA 2Y7DA 2EGZA 2PGEA 3OIXA 2GGJA 2PCQA 4GYPC 4C6JA 4GMEA 4PTNA 2Z25A 5C0QA 4F8XA 2HROA 1PCKA 1D3CA 5LNRA 3TC7A 3AWOA 1E1CB 3DDMA 5AB3A 3N12A 3F03K 2B31A 4HIBA 4AWUA 1VJZA 4FX6M 2QEZA 4IZGA 1YNPA 1OB0A 3W25A 1GKQA 4O13A 4ERAA 2BOEX 1Z69A 5GNYA 2E9LA 3W81A 1TV8A 1ENUA 1DXIA 4GO9A 4XSLA 2OOGA 2YR1A 2PP1A 4EWND 4FR6A 3V16A 2E9MA 2ADAA 1MW0A 2PU0A 3PPGA 2O9PA 1E15A 1Y5VA 1JPIA 2Y5JA 1ZRQA 4Q8TA 4BKNA 5HMFA 3H53A 1SFSA 3SGUA 3OVQA 1TWSA 4XAFA 2CBJA 2OO6A 3A6OA 2QCNA 3TE9A 1EZWA 3WJZA 3QLDA 3NYDA 3O15A 5H1WA 2P50A 5HJXA 3WZ0E 4AZ7A 1FDYA 1VEPA 2FJUB 3B8WA 3AMDA 1ODUA 3UWQA 3AUOA 1Y0EA 2DV0A 2DIKA 1W8SA 3ABRA 3QHNA 5M17A 3TMQA 1ONRA 1JRBA 1XIBA 3DYMA 1OCQA 4BR1A 1AJ2A 2DFAA 1YYAA 3IJLA 2WJDA 4WGHA 3B0XA 1ZALA 3BOFA 1JGIA 1L6WA 4BEQA 1ZCCA 4UTTA 1F3TA 3HGRA 1QW7A 2IPGA 2VOMA 3C2OA 3S5ZA 1C3FA 4R85A 1KRCC 3SUWA 5CLWA 1AMKA 3G0SA 3UJRA 2AGTA 2TYSA 3EOOA 3WNKA 3BE7A 3CZEA 1PVNA 4DXKA 4CEXC 4GZJA 1PKNA 4PCNA 4G5DA 2F2KA 4K8EA 4GCAA 3KVKA 4LXFA 3QPYA 3R11A 5I24A 1L8PA 1JULA 1K6WA 3PBUA 5D30A 1RP8A 4WD0A 2IKIA 1UD6A 2DT0A 4ZSTA 1QR7A 1RUSA 2DIEA 4K68A 3VKJA 3GS6A 4J3ZA 4E2BA 1Q8AA 1JXJA 5G4EA 4IJBA 3RCNA 3VD3A 2VC6A 3SIZA 1I2OA 3UCQA 1AK5A 2G0WA 2XWDA 1WZAA 3VD4A 2OO0A 4QDMA 2A85A 2C1IA 2O56A 1P43A 4I6VA 4J28A 4C6KA 1VENA 4ZQOA 2GUYA 1M7PA 4S2CA 2J8GA 4RK8A 3URAA 3UEQA 4UWMA 4TVCA 4HPGA 3T08A 4WK9A 4G6CA 1HKMA 3UZZA 4E8CA 1HKIA 3NDZA 1Q6CA 4MDOA 4B5UA 4A3QA 3HPSA 4H9MA 1N7KA 1H51A 1OG0A 3WLNA 1NWRA 3NPUA 4ICNA 3K4DA 3WIJA 3N4EA 4PUWA 1OFOA 1SFTA 3G2GA 2PZNA 2GVLA 1JPKA 2YSWA 3M0IA 4LF2A 3WQVA 4EAYA 2J7FA 4ZO6A 5G5IA 3W85A 4JTFA 4QAIA 1TREA 4TUFA 3AZSA 1WCGA 2YYUA 4P8WA 4AMAA 5FCZA 2BXVA 3H6OA 5D37A 1M7OA 4ADTA 3OBKA 4GD0A 5G4WA 3DHUA 3EXSA 1F4HA 3S2MA 3QR1A 2XVPA 3LRLA 4E4PA 1HZYA 4L64A 2RDTA 2FZMA 2P1FA 1G9HA 3KDNA 2QJIA 4GC4A 1P1MA 2DIJA 3W7MA 3QOMA 4DAFA 3S1GA 1TPEA 4NASA 4GA8A 2C3ZA 3W1XA 5A8PA 4MKSA 4MGGA 2J7BA 1AQFA 4S3GA 2WJZA 2NLYA 2VENA 3WKZA 4G7EA 3GNRA 4RNFA 1W3JA 3MYPA 4MIMA 2VT0A 3FSUA 1EOMA 3M0VA 2DSKA 4JFVA 5LXXA 3AUJA 1TTQA 3P8JA 4HNTA 3H23A 1QWGA 1KXHA 3UJSA 1VBHA 3HG2A 1XQLA 3CUZA 4JTIA 1W9XA 4G2DA 2QJNA 2BOGX 4WOQA 5IXEA 2D2GA 3HURA 4DJDC 3WLQA 4CN1A 1HJQA 2CBVA 3ZIZA 4P8VA 3THQA 1TRDA 3QY7A 1SMDA 3VA8A 2ACRA 1LOQA 2D2HA 4XD3A 1PYMA 1IEQA 2Y63A 3MMWA 1S5MA 4PCSA 3KZPA 3K13A 4NJIA 2G97A 1VBRA 1H5YA 4DUXA 3L4UA 2CBUA 2PS2A 4LTSA 1RVGA 1TQJA 4I7UA 4LEQA 1VJIA 1PCWA 4NG3A 3TP4A 4UNLA 3B8SA 2X2GA 1S39A 3LLFA 5AC6A 1PKYA 3CV2A 4DXVA 4KS0A 4MB4A 1X38A 4IMAA 1R2RA 2BODX 2WV8A 3AS2A 1XV8A 4QE4A 4JNYA 2JIEA 2NX3A 2X16A 2J9XA 2OKOA 1X8CA 4KWVA 5A8GA 2YDRA 4XKYA 9XIMA 3H4GA 2QGHA 4GI8A 3BW2A 1RQBA 1KV8A 4O10A 3T78A 3TN6A 4D8AA 4PFHA 4B15A 4LRTA 4MNLA 3HG3A 4IQDA 1SO3A 3GO2A 3SJNA 2UZ9A 3FIGA 1E9ZB 4X60A 4YTQA 3FHAA 1MMFA 4GVGA 4RE0A 2V38A 4MPQA 3G1RA 4QDPA 1K3UA 4K8HA 2NVDA 4PBGA 1GVYA 3THUA 2XWEA 5I6SA 3PAOA 4MAZA 1WE5A 3QH2A 4EPDC 3E2RA 5JIWA 2R14A 3D47A 2VFHA 4H8UA 2PTDA 3NL5A 2RDWA 3WFAA 2P88A 3CMFA 3WBEA 1XL9A 4LYKA 4IGSA 3ORWA 1JVNA 1R7OA 4AEOA 5D4YA 4L4PA 1IXQA 3PB0A 1XQKA 3EMCA 3LLDA 4KW2A 3VIGA 3GYCA 4JTKA 4B5WA 1TR1A 1PZ2A 2CZEA 3SRKA 2GVYA 3CUHA 3OHIA 1B3ZA 3VX1A 1FWWA 1PZ3A 2FKPA 3Q2DA 3CEUA 1U5HA 2A1YA 4JTSA 1AL7A 3VE9A 1JCJA 2H3DA 2PZ0A 1WV2A 4R88A 5FJJA 2JEQA 3G1SA 2CW6A 5EL1A 4TVUA 4LYQA 3T05A 4TX6A 1O1HA 2PU1A 2ZRWA 3NSNA 1XC4A 1CGXA 2VD8A 5A6J<