1BF6A

Phosphotriesterase homology protein from escherichia coli
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
291
structure length
291
Chain Sequence
SFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOTRIESTERASE HOMOLOGY PROTEIN
publication title Biochemical characterization and crystallographic structure of an Escherichia coli protein from the phosphotriesterase gene family.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Phosphotriesterase
total genus 125
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1bf6A00
3E2VA 2FTWA 4OFCA 3OJGA 2Z25A 2FTYA 1K70A 4CNUA 4DLMA 4H9ZA 2YB4A 2R1PA 3F2DA 4R85A 3MDWA 1EJTC 1EJWC 1XRTA 3PNZA 4D8LA 3TN5A 4QRNA 2PLMA 3B0XA 2R1KA 4XD4A 4PCNA 4C6PA 4H01A 2DVTA 4HA0A 1A5KC 3B40A 1PTAA 4TQTA 3G77A 2O4MA 4IQJA 1FWAC 3F2BA 4XD3A 3OU8A 4GYFA 4WGXA 5CH9A 2FVKA 4F0SA 3PNUA 3MTWA 3S2JA 3MKVA 4CNTA 3SO7A 3FDKA 3GIQA 3EWCA 1J5SA 1A5LC 2ANUA 3ID7A 4DNMA 3MSRA 3GTHA 1ONWA 4H9UA 3IJ6A 4DI8A 1NDZA 1IE7C 4G2DA 3URBA 1FWJC 1RAKA 4B91A 2D2JA 2E1WA 4LFYA 1FWGC 3E3HA 2KAUC 1FWEC 1FKWA 2RAGA 2IMRA 3OOQA 3LU2A 1ADDA 3MVIA 2R1LA 3OVGA 3TNBA 4KEVA 4RDVA 2Z29A 4C6EA 3CJPA 2EG7A 4H00A 4IGMA 3QY8A 1YMYA 3S4TA 3UR5A 4H9VA 3FDGA 4NP7A 1A5NC 2GZXA 1EJSC 2PGRA 3GU2A 4R7WA 3PBMA 4GY7A 2WJEA 4KESA 4KF1A 4RZBA 2G3FA 1ZZMA 3LA4A 4C6IA 5HMEA 1A4LA 1QXLA 2AMXA 2HBXA 1RJRA 2ADAA 4EPKA 1YBQB 4MUPA 3IV8A 4NI8A 4KEUA 3N2CA 3IACA 3GIPA 2EG8A 3LSCA 3QGAC 4XAGA 4C6KA 3PAOA 1RJQA 1DPMA 2ICSA 4DZIA 2Z2BA 1NDVA 1R9XA 4F0LA 3WMLA 2WJDA 1I0BA 1YBQA 1POKA 4LCQA 4CEXC 3NURA 2D2GA 4XAFA 4CQCA 3CS2A 4IH3A 4RDYA 2ZC1A 3ICJA 4NG3A 3HTWA 4GY0A 4J35A 4QSFA 3LY0A 2HPMA 3BE7A 4LEFA 3F4DA 2GSEA 3NEHA 1KRCC 2DVXA 1XWYA 4XD5A 4CQDA 3OQEA 3LSBA 4H9TA 4LAOA 1W1IE 1YNYA 2PUZA 4HK7A 3AU6A 2YB1A 4RE0A 3IARA 3WZ0E 3LGDA 2WJFA 2Z2AA 1I0DA 2YZ5A 4CQBA 4L9XA 1KRBC 1KCXA 3A4JA 1J79A 2Z27A 1R9ZA 3F2CA 3TN4A 1ITUA 3ITCA 2W9MA 2Y1HA 1NFGA 4E3TA 4C6QA 3UPMA 1P1MA 2Z26A 4GX8A 1GKRA 4RDWA 4INFA 2HQAA 2Q09A 2VR2A 4F0RA 1PSCA 2GWGA 1BF6A 4J5NA 3GTFA 4EPBC 5FSEC 3LNPA 4I6VA 1O12A 3MDUA 3TN3A 4C60A 1YIXA 2AQOA 4IFKB 4XAYA 1XGEA 4BKNA 2DVUA 4CNSA 2PGFA 1WXYA 1E9YB 1FWBC 3E0FA 3R0DA 4UB9A 3S2NA 4C6MA 5LXXA 2D2HA 4IFOA 1FWFC 2XIOA 1M7JA 1FWIC 4C65A 1KRMA 3QY6A 4R88A 2UBPC 1NDYA 3NQBA 4IFKA 4BY3A 4EP8C 4H9YA 2FFIA 4GX9A 2OOFA 3GU9A 4V1YA 1K6WA 3DUGA 4QTGA 3WYZA 1P6CA 1EJUC 2Q01A 3RYSA 3V7PA 1S3TC 3T1GA 1K1DA 4ERIA 2BGNE 4WHBA 4IG2B 1RA5A 3D6NA 4LCRA 2QT3A 4C6JA 4KEZA 4IF2A 4LAKA 3UBPC 4HK6A 3URNA 4HJWA 4KERA 4IFRA 2QS8A 2PAJA 4P5UA 3HPAA 2BB0A 3K5XA 3QY7A 4IG2A 3UR2A 2AQVA 3LS9A 4GC3A 3URAA 4JOMA 1V79A 4GK8A 3GU1A 4EPEC 3AU2A 3KM8A 1VFLA 4XD6A 1RJPA 2OGJA 3K2GA 2VC7A 4GOAA 3DC8A 4Z42C 4DO7A 2F6KA 3JZEA 4C6LA 2UZ9A 3IPWA 3IRSA 3GRIA 3SFWA 4ERGA 1POJA 4BJHA 1PB0A 1XRFA 2O4QA 3GTXA 4EPDC 3TN6A 3PANA 1NDWA 2I9UA 3AUOA 4GBDA 1JGMA 4YIWA 1E9ZB 1RK6A 4L6DA 4C6DA 2HPIA 2Z7GA 1J6OA 3LGGA 1KRAC 5A6TC 1EF2A 2R1NA 2YXOA 2VUNA 3MVTA 1QW7A 3E74A 2OB3A 2QPXA 3EWDA 4KIRA 2Z00A 3QGKC 3E38A 4PE8A 4H9MA 3A3XA 3C86A 1UIPA 1EYWA 1M68A 3ISIX 2VM8A 3EGJA 4LCSA 3RCMA 2EG6A 4C6OA 4C5ZA 3MPGA 1FWCC 1EZ2A 3O7UA 2R1MA 5FSDC 4ZSUA 1UBPC 3RN6A 2Z24A 1A5MC 1ONXA 1J6PA 4GZ7A 4QS5A 3DCPA 2A3LA 3RHGA 4QS6A 3K4WA 3HM7A 1R9YA 2GOKA 1WXZA 1HZYA 2Z28A 1GKQA 4LANA 4ICMA 2Z4GA 4AQLA 4UBPC 4XAZA 2P53A 2VHLA 2OODA 3GTIA 4B90A 4KETA 2OQLA 4KQNA 5HMDA 3F4CA 4PBEA 4DI9A 1FKXA 2I5GA 4PBFA 1V7AA 3B0YA 4DLFA 1FWDC 2QVNA 2HBVA 1UIOA 4GXWA 4C6CA 3O0FA 4I6KA 1EJXC 3T81A 4M51A 1FWHC 1A4MA 3UF9A 4LAMA 3T8LA 1RA0A 3GUWA 1RK5A 2WM1A 3IGHX 4C6FA 4DZHA 4V1XA 4HK5A 3MJMA 3FEQA 4G7EB 1V4YA 4ZSTA 3A3WA 4B3ZA 1ITQA 1UMLA 1A5OC 2E25A 5G4HC 2HNHA 4C5YA 4IGNA 1V51A 5HMFA 4C6NA 4WVXA 1EJVC 1V77A 1YRRA 3GG7A 2GWNA 4AC7C 4ERAA 3ORWA 4CEUC 3CAKA 3S2LA 1O5RA 4G7EA 4LH8A 4B92A 4GY1A 4C6BA 3URQA 4DYKA 1P6BA 2FVMA 3OODA 4H9XA 4PCPA 4QROA 3S2MA 5AKQA 3E0LA 1EJRC 1GKPA 2P50A 4RDZA 2VC5A 1M65A 2CZVA 4J2MA 4DIAA 4LALA 5E5CA 1PO9A
chains in the Genus database with same CATH superfamily
2GJNA 4RLIA 5C2GA 3VK5A 3BLFA 4JBRA 2JKAA 1H7XA 2WSRA 5LNUA 4AFYA 2Z25A 3H54A 2FZ8A 3W86A 4P61A 2R1PA 3GY1A 4E4PA 4CD8A 1EJTC 1SZRA 3VCCA 1CXEA 4UQEA 3IUDA 5JBEA 4QG6A 3CV7A 4AMAA 2YKKA 1XIHA 2P8CA 3FNDA 2TSYA 2ISFA 4GYFA 4WGXA 3OA3A 3POHA 1TQXA 1C7TA 1B30A 2ZE0A 4M1BA 3DAQA 3UWYA 3NEVA 3WQ5A 1P0NA 3M47A 4IMGA 2ON3A 1XCWA 3GS6A 3BANA 4PMZA 4PUEA 3EBVA 4AIBA 3OVGA 5TAOA 3EOEA 2V2CA 1DXIA 3KDNA 3IJ8A 1MEIA 2FZMA 4FXSA 2VEGA 3TA6A 1FUYA 3APYA 2W61A 3CV2A 1XG4A 3EOUA 4FR6A 1VGAA 3WEZA 1Q45A 5MKGB 3U0HA 4H2CA 3VILA 5LGXA 4M6UA 4ZB0A 4IT1A 3WQWA 4NRRA 1RJRA 3ZSSA 4YCPA 3VKBA 4L56A 4AD4A 2CWNA 3U57A 4HYVA 3WQ4A 1SO4A 1VH7A 3GIPA 2FTPA 3SSJA 3A4AA 4GUJA 1JDEA 4HNTA 4GVIA 4CNNA 4AWSA 4P7OA 1VFFA 4MB5A 1ZBVA 3FN9A 1JUEA 1U5JA 3PPGA 3ZT5A 1IZJA 3LOTA 4M5PA 1GQKA 4LEQA 4NG3A 4GY0A 2OWXA 4UNIA 1UPMB 4H8NA 4IM4A 3I65A 1OFEA 2VQTA 4RR4A 3CUXA 3G3DA 2GUUA 1WCGA 1UQYA 1E55A 3P2VA 1UHVA 1VBHA 4DELA 3KLLA 1K9DA 3UZZA 3LHZA 1QPKA 4D72A 3AHTA 1QAPA 2XM2A 1EC9A 4DZAA 1K7EA 1J2BA 3CUZA 1WDQA 2NT1A 1PX4A 1EOMA 2Y5SA 4LYPA 4BKNA 4S3DA 3I3DA 1JNEA 3BAJA 5A6MA 1VHNA 5DANA 1ECQA 4LNCA 4HHHA 2F8QA 2WKJA 2VURA 4J3WA 4DNHA 2J62A 2NVDA 3SSZA 4WKAA 3NL3A 3WDPP 2FZ9A 4WDUA 1W2VA 4W8BA 2PB1A 3L4WA 3KOWA 5EPDA 2Q01A 3HN3A 3NIYA 3LV5A 4ZO7A 3I7RA 1RA5A 1MXDA 2VR4A 3GD6A 2V82A 2D22A 3MW7A 4GISA 1ZL1A 1DQXA 3FV9A 3NO5A 4UTTC 4IFRA 4JGDA 1I2QA 4IG2A 2QF8A 1MMFA 3LS9A 2IKGA 2VC9A 3H55A 3VD9A 3FY1A 2XHYA 2WNQA 3NL2A 2RFGA 2BG5A 3QQWA 4NAEB 2FGBA 1T6MA 2A3AA 2H8XA 1TV8A 2YR1A 1W1VA 4JIHA 3B9AA 2NWSA 3VU2A 4C6LA 1NF7A 3CLMA 1ZU8A 4ZEPA 3U5YA 1L6YA 2PTYA 4W8LA 1HKIA 2NLIA 4NJKA 4LUJA 5C9UA 4L6DA 2R91A 1ZJAA 3EPOA 2DPEA 3PM6A 3FJ6A 4DUXA 1LZOA 3KDOA 4O4WA 4KIRA 1LWJA 5LSMA 1NFBA 3A3XA 1EYWA 3WLTA 4HVXA 4JEJA 5GPRA 3B03A 3MPGA 2YPIA 5AHNA 1N55A 2HXUA 3O7UA 5FSDC 1UBPC 3KOYA 4WJXA 2QAFA 1TMQA 4WX2A 3BARA 3DCPA 5BU9A 4B5TA 5GJNA 1Q6RA 3JR2A 5CKSA 2YXXA 1KXVA 2E1DA 3QZ6A 4Y8FA 2Z28A 4L9YA 5DN1A 2BGSA 2Z4GA 3A22A 1FCUA 1B4KA 2DUZA 2JALA 4P8XA 4UQ9A 2PRHA 2YYTA 3KFTA 4N42A 3ABXA 1IQ8A 4PYSA 3O6CA 3B9NA 1ZP3A 1V7AA 4JQ4A 1T7LA 1P0EA 5GQBA 2QPSA 4WR3A 5I79A 1QI0A 4K38A 2NQLA 3R7MA 5JIPA 4IP5A 3BLEA 3PF3A 3A21A 5AYYA 2D23A 3NUKA 3O9NA 1JRBA 1WZLA 2NSXA 3IGHX 1XX1A 4V1XA 4HK5A 3N11A 2W63A 1V4YA 3SUTA 2E9LA 4G56A 4AG0A 2E25A 3MP5A 1RH9A 1R46A 1E1EA 1V51A 4DO5A 3IAPA 3GDMA 4U3CA 4ERAA 4XV0A 3P8JA 2J47A 3GXFA 4UIOA 4LH8A 2OZ3A 1CXIA 3QLLA 3R94A 3R12A 3MY9A 3WBXA 3IIOA 3FX4A 4XZHA 2OZTA 3NOEA 5GNYA 4GINA 3UERA 1EO5A 3M41A 5M5DA 1GKPA 3EKLA 1VD6A 4QM1A 4J2MA 1K9TA 4A35A 1UKPA 5DLCA 3WDRA 4IMAA 4DBUA 4JIRA 3SCPA 5BOOA 1G4TA 3PUOA 3NO1A 1BYAA 4WF7A 1AQ0A 1OF6A 1X7IA 4I9JA 3B97A 1GVEA 4R85A 3LLDA 4W85A 2PWGA 4PL1A 4DXXA 4OV9A 4DAIA 4PCNA 3W2NA 2G4JA 4XUYA 1W3IA 3N6HA 4HA0A 3SY5A 1W9PA 3LYEA 3TAOA 1YDOA 2YYUA 3OGSA 1H49A 3NM1A 4JEQA 4B5NA 4YTTA 2WVVB 2FPTA 5L9FA 3MTWA 3KP1A 3W02A 2X0SA 2X1RA 3MU7A 5FAJA 5IHSA 5HQEA 3N13A 4XZ9A 3VGHA 4JL2A 2Y7EA 1R2TA 3HGRA 4G2DA 1Q6DA 2D0GA 3UPBA 4PUJA 3KVLA 4GZJA 2ZOXA 4JHZA 4XG1A 1XDJA 3LRLA 1L0PA 3NPXA 3CK5A 2G41A 1A53A 4YL2A 1A0DA 3QV9A 3VAVA 2PPGA 1Q6LA 4OZOA 4B15A 5FAGA 3NXFA 4ZA0A 4FEZA 1MFVA 3GDLA 3H12A 2G3FA 3NDOA 1XSJA 2DSVA 5AOUA 3MWCA 2Q8XA 4M7TA 3WN6A 2HBXA 2B7QA 1W9DM 1XBVA 4JDBA 4JIIX 2QJNA 3W7DA 3OA5A 5U7SA 4GGBA 4FR1A 3PY2A 4ZCWA 4BS0A 1A50A 3MC5A 3O6DA 1RP9A 4QG9A 4F2BA 4NZ3A 1RJQA 1DPMA 3QHMA 4IL0A 1P0BA 4LAUA 4HHMA 1R9XA 1UJQA 3WMLA 3G6MA 1W8GA 3HURA 3QPEA 2VGGA 1WBHA 1R5YA 4M7SA 4YLWA 1IXOA 2A0NA 3FVMA 2ZC1A 1ZAHA 4AIUA 4NI3A 4LEFA 4D8AA 3GVVA 1ZBKA 1KRCC 2DVXA 3ITOA 3IJQA 3GR8A 3H4XA 1D8WA 1GONA 3TQVA 1ONEA 4LS1A 1ZGDA 4IMDA 3R5EA 4E4UA 4UTHA 1SO5A 1CENA 1W56A 3IK2A 2O9RA 3HG4A 3UZ5A 3N2BA 1UOKA 5I7GA 5BXSA 3TN4A 1XR2A 2W4XA 4LWWA 3UPMA 3UU0A 1P1MA 1R85A 2YFOA 3MB9A 5E6ZA 1H61A 3CQ0A 4F0RA 2GWGA 2PWEA 4AX6A 1H4PA 1XBXA 4Y9PA 1I45A 2X1IA 3N2OA 3ENLA 4FOKA 3N04A 1V8EA 4HMNA 3CT7A 3W76A 1AH0A 4M19A 1E9YB 3V35A 5DT5A 3E9AA 4LT9A 1QR7A 3DX5A 5D2YA 1AL8A 2BHYA 3G1HA 4UUIA 1TWIA 1FWIC 1KO0A 3A9IA 3CZGA 5JUVA 1NDYA 4BY3A 1HN1A 1TB3A 2OOFA 1EOKA 4TMCA 1P6CA 4GQGA 2J7HA 2CBIA 5FF3A 3BWWA 1X7FA 2V69A 4MB1A 3TQPA 3K8KA 1KBLA 4LSBA 5K9XA 2FDSA 4MWAE 1M7XA 1U1JA 3URNA 1BWLA 5A2CA 4UWMA 5DF0A 2ZTKA 2BB0A 2WKLA 3ARWA 2GFTA 3C56A 7CGTA 1XYFA 5LZLA 2TODA 2O7QA 4BCEA 3URAA 1BRLB 3AAMA 1DJYA 5EB8A 1JULA 3TOYA 3KM8A 3U2ZA 1S2TA 4A6GA 3IGXA 2OQHA 3WFLA 4O8AA 4DO7A 3KVJA 3UFYA 3DHUA 4RNIA 5LIKX 2ODOA 2B31A 3PANA 2WSPA 3DU0A 3S83A 2OWCA 1T96A 3IANA 1PX8A 4G9PA 3M0IA 4YIWA 1RPKA 3WSUA 4PZVA 3TJXA 4O0QA 3WJWA 1REQB 2VUNA 1ADOA 2IQDA 4XUGA 3QTGA 1UD6A 4XB3A 1QVBA 4H9MA 2B7OA 1S2WA 5E9XA 2IKIA 3QBUA 3WQ8A 1SJBA 3VKKA 2Z24A 1RD6A 4UFKA 1J6PA 5C9XA 1HKVA 4W9TA 3UXKA 4QS5A 3JVAA 4GC4A 4MJMA 4DPQA 3MA8A 4A21A 1SZEA 2OSYA 1TMLA 2BOGX 3ITLA 4TO8A 4JPGA 3AISA 3JUGA 3KCLA 4XAZA 4ML4A 3QTPA 4XTDA 5A5WA 1TJ2A 3AOFA 1XBZA 3ANUA 6XIMA 3V3WA 4GI6A 3FEMA 3GIYA 3RF9A 5FKYA 4ROQA 3TLQA 5LIXX 4MTVA 1D3CA 1UD5A 5JH2A 4RK8A 4AVNA 4GXWA 1WDDA 5I0DA 3OP2A 3THDA 3WLPA 2HRWA 2UV8G 3M1ZA 3MKKA 1GYNA 4ZQOA 1A4MA 3PZ9A 4DZHA 4KGLA 4L61A 2RJHA 5KSWA 2PDCA 1KM2A 4LC8A 4MJ2A 5D2TA 3G2GA 3TUUA 1VC4A 1WP6A 3ORWA 2ASHA 1GJWA 3CAKA 4BEUA 1IEQA 4OBSA 5E0CA 3N4FA 1YPIA 3OODA 2QUNA 4P8UA 3UEQA 2BY3A 1YHTA 3M0MA 1MUCA 3ZIZA 1EJRC 4O1BA 4PODA 2GLKA 2PWFA 1Q7MA 2QJMA 5CGMA 1GOIA 2CNCA 2WC7A 4D1IA 4JNMA 1Q13A 3GKAA 2D69A 2VFGA 4FOUA 2XVGA 5BRPA 3M0VA 4MPKA 4JTHA 3WLQA 1EHAA 4KRZA 2DZVA 3VNJA 4W8AA 2R14A 5D02A 4IIGA 4RX0A 4G6CA 2R1KA 3M46A 4GYKA 3OLIA 3ZLHA 3B40A 1KCKA 1V02A 4F9JA 1G5AA 4GHRA 2CZFA 3EKZA 4WXYA 4AYSA 2HROA 4GFSA 3LERA 5F1VA 4R7OA 3S6DA 5C9ZA 3KRUA 2HJPA 1NU5A 2Q8ZA 3LRKA 3KUMA 1GK8A 1O5QA 3VOIA 4CNTA 4HPJA 1VPXA 2FDMA 4KCTA 2WV8A 2VEMA 2X7WA 3W7JA 3GTHA 3V75A 3WQDA 1JD7A 5EMKA 5D30A 4U2ZA 2OLHA 1J8VA 2BNJA 1RAKA 1XH1A 3SCUA 3FLUA 2D2JA 2EPKX 5XIMA 1V6XA 1ISWA 1LUCA 3W7EA 2HV5A 2ZZ4A 3TVAA 2Z29A 2MANA 4PC8A 4H00A 4W5ZA 3IUHA 3NSMA 3IVUA 3EB3A 5GJPA 1XIBA 3KCJA 1BKHA 1A5NC 1Q5MA 3VIHA 4W88A 1S5TA 3V0TA 2Y61A 3AHZA 2J78A 1JCMP 4ZMGA 4NJJA 1UW9A 1J0ZA 4BQ5A 1TVNA 1CB7B 3FKRA 3AO0A 1YBQB 4HN8A 3NQCA 2C16A 2J7BA 1JDCA 2QJGA 3A6OA 4AMCA 5IFPA 5CXPA 2BOEX 3A23A 2ZZ7A 1XLIA 2WVUA 1E5JA 4H8HA 1TWDA 1OGBA 3LUTA 3CL6A 4M6VA 3TP4A 2YCJA 4JFUA 4F4RA 4XAFA 3C2FA 1WXJA 2CHOA 2ISSA 3V0UA 3P0WA 5CZ0A 3AMDA 3CUHA 1LRTA 3TLLA 1P7TA 5CQ1A 3OVPA 1WQ5A 2YA1A 4ZENA 3SN0A 5D05A 2QULA 1KFLA 3KOZA 4ZQPA 3PPCA 3W6LA 1SPQA 3G8EA 3QOMA 3EYPA 3WZ0E 4AZGA 4Z2KA 1VCVA 1I0DA 1KCXA 2QZRA 1H09A 1UC5A 3KBVA 1JUBA 4YPJA 1Q3NA 4KS0A 1G67A 4RDWA 1DORA 2X7VA 1WKYA 2YBVA 4D6FA 3KX6A 4K2SA 2Y8KA 3SCTA 1UUMA 4D6GA 4S3BA 4EPBC 1GG0A 8XIMA 1W1TA 2DZWA 3LNMA 3NQGA 3Q45A 4IFKB 4QQUA 2XIJA 1QWGA 1DP0A 1XCFA 5T8GA 1Z32X 3N3TA 4IQEA 3GO2A 4MDPA 3KBWA 3WF1A 1WYIA 5H1WA 3V5FA 2OG9A 5LIWX 2UBPC 4Z1BA 4YS1A 2CU0A 1KLZA 3QMSA 4B4FA 3H70A 4GABA 3DUGA 3VI2A 3S5ZA 2I56A 3DHFA 1KWKA 3AHVA 4HNUA 4DX3A 5CSYA 4D1JA 2EF9A 3ZR6A 3NGFA 4YTRA 4AD5A 4ADSA 2H3BA 1IR2A 1WUEA 3BLKA 2E6FA 2PCEA 1R87A 4L7ZA 4NJGA 1ZQ5A 2PF0A 3GH5A 5EGRA 4IGHA 5HUPA 4OQVA 4R33A 7TIMA 2E77A 3E5PA 2XWEA 3BW4A 1E0UA 2PMQA 2HXTA 5DMNA 4FXRA 1SW0A 4Z2HA 3MMTA 3UJ2A 3JRKA 3MUIA 3OBEA 3LMYA 1UD4A 2OGJA 1F4AA 4GVFA 4UQCA 4GCXA 3WCZA 1V3JA 4O11A 2WHMA 4QLLA 4QHRA 1BTMA 1DEDA 3ABRA 4LB3A 4H4IA 4ERGA 2VRJA 3TV8A 2CCRA 4FALA 4HN4A 1RK6A 5F7UA 1XIMA 2HPIA 1TUXA 4Q3MA 5K4ZA 1Z44A 3LLXA 2VOMA 5D4YA 3QGKC 4F2TA 3P7YA 4M80A 1M01A 3UXDA 3W85A 1JPKA 3T0CA 2GUBA 1EA0A 3RDKA 3GWQA 3V4BA 4DWSB 4QE5A 4AXNA 1OFBA 5E0FA 2Q8LA 1C3FA 1O6IA 2QR6A 1CEOA 5LGZA 3BK0A 4IIFA 1K7XA 3GHUA 4JICA 1ODUA 4OOZA 2PZ0A 4TUFA 2YCLB 4JFWA 3VNZA 1DJQA 4LUTB 2BXVA 3UCDA 1HUVA 4NZ5A 2P53A 2VHLA 1FHLA 1YNQA 1JZ7A 3IS4A 1SR9A 2GGIA 4KETA 1FWSA 2OQLA 3NQ7A 3EEGA 4DI9A 4GWEA 1SSGA 2X0YA 4Q22A 3I6TA 4J28A 3VABA 2CERA 3HQ1A 4C6CA 1MW0A 2A3HA 2GJLA 2DSUA 2GK1B 5E09A 1JR1A 3UF9A 2FZNA 2H90A 2Y70A 1N82A 3BZJA 2WMJA 1TJRA 3H2AA 5FJOA 4LUSA 1RBLA 1TV5A 3GAKA 3PBYA 3AHYA 1DE5A 4PUKA 3NZRA 3IIVA 2NXGA 3LHUA 4ILSA 1F2JA 2NV2A 4LY4A 4XKYA 1F07A 1LBMA 4K8HA 2HEJA 3URQA 1Z89A 2FVMA 4E8CA 1J11A 4UTTA 4I9AA 2YXGA 4MM1A 4RPPA 2P50A 1LG1A 1XIEA 1E1CA 4KGJA 4H7CA 8XIAA 3PPFA 3E2VA 2JFEX 2YOCA 1KM3A 4E2VA 3C4UA 1UJPA 2VWSA 3SY1A 2VCCA 4QXIA 3VNKA 5D33A 4H9ZA 1W2PA 1TTPA 2PTDA 3RRXA 4GVHA 3TN5A 3A24A 4E2DA 3GB6A 3H4WA 3ZJ7A 1R3SA 5FJUA 5CPMA 2DIEA 3W7PA 3BLIA 1SM9A 5H8MA 3GNOA 2IPJA 4AZCB 5IDZA 3T55A 1Q2SA 5HQLA 3THUA 4LU0A 4XZNX 3PNUA 4NAFB 3NGJA 2PS2A 3NG3A 1PDZA 3MANA 4XSMA 5XIAA 2X1SA 3HPXA 1XLAA 3A47A 2NWRA 2V0TA 3EZ4A 1VCGA 3U48A 4PMOA 5CGQA 2QXWA 1C92A 1VEOA 1UA7A 2QAPA 3BLPX 1EYEA 4L5ZA 1JEZA 3RR4A 3TNBA 4YYCA 1VJZA 2ZICA 2ZXBA 1MO0A 3E2RA 5D2WA 3K30A 3EPNA 4US5A 4EK7A 1WV2A 2QJHA 4RZ5A 1IHIA 1TRIA 2Z1VA 2GZXA 3B0UX 4ASTA 3EOLA 4LV9A 2GQ8A 4XO6A 1ICQA 1ZZMA 2EEXA 4RNHA 3GNXA 2G96A 1L6GA 3NYDA 3LQGA 4QJ1A 3VC6A 3ZOAA 1X6UA 4MYXA 3SI9A 2CHNA 2VVSA 5EL1A 1TPEA 3RX3A 1H7RA 2QV4A 1RHCA 4ROPA 1GORA 1X6NA 3NZQA 2YL6A 3P67A 5GVJA 4CNOA 1I0BA 4L4OA 4ACYA 4ZXOA 1Y0EA 5C9WA 3L4ZA 1U5VA 3W71A 1EWEA 2WC4A 3F03K 4X9SA 4ZVJA 1VQTA 4QSFA 3TC7A 2RJGA 4JTJA 3CHDA 3ATYA 4JTTA 1R30A 1LORA 3UWUA 1ZFJA 1QPNA 4HK7A 3AU6A 3AHXA 3VX1A 1JDDA 4A8NA 5HMSA 3VIGA 3EX4A 3IVTA 2G97A 3UVIA 1OX4A 3SCOA 1OX6A 4FF5A 5E6YA 3OEXA 3BC9A 2FYMA 5DFAA 4AY7A 3DG6A 3TDFA 2C1IA 3L5MA 1RCXB 3MDUA 5K9DA 3U4FA 5JU6A 3H22A 1NM9A 2B7PA 4YCOA 6CGTA 1TA3A 4PCSA 1QI5A 1Q2RA 1CNVA 3E0FA 1JCLA 4FP1A 2D2HA 2ZQ0A 1TX0A 5I6SA 4P7NA 2PC4A 5G2WA 3VDAA 1OINA 2DSZA 2GVGA 2WJZA 1FQ0A 3GNDA 1GVIA 4IIDA 3GXNA 1YDVA 4ZO9A 3CPRA 4YN5A 1H7PA 1V0NA 2WBGA 3VC5A 2C91A 3NFUA 4PTDA 1JUKA 3WK1A 2E9BA 4L6OA 3W6MA 3S5SA 4EIVA 1WB0A 4OUEA 2QT3A 3VYLA 4LVGA 3TYBA 4NY2A 1JIBA 3H7RA 5FJJA 5CBJA 3BV7A 4OT7A 3W01A 1H60A 2A85A 2W67A 4JIPA 1ISXA 1JCTA 5F4XA 3HJZA 3CQHA 3UQNA 3WLOA 4O54A 2G5WA 5CPTA 1JZ4A 1OIMA 3QRHA 1W1YA 2C14A 3MBFA 2VNCA 4S3EA 1ZP4A 1VS1A 1Z9AA 2D1ZA 4E8GA 2EPLX 1FH8A 3HGJA 3CWOX 1TTJA 2E7FA 1Q66A 1AVAA 2F2KA 4O13A 2YL9A 4PUDA 2XH2A 1JYWA 1O94A 1IEVA 1H7OA 3FAXA 4U31A 3MMWA 5CLWA 4RXGA 3HMJG 3PJXA 2X30A 4M6QA 2EG6A 1EDTA 2NQZA 1EZ2A 1A47A 4MZYA 3ZXWA 1S39A 1J12A 2A6NA 1BXNA 4U3AA 3OLDA 2AL1A 2GOKA 1QNOA 3BGJA 3L68A 2CZ5A 2A1YA 2QCGA 3ZS4A 3LD5A 3OYZA 3O15A 1E4MM 1G4EA 2WMIB 4PGLA 5HMDA 2ZTJA 3S47A 4C1LA 3KTCA 1FKXA 3ZR4A 1R7AA 2WBKA 2GDQA 4PBFA 4Q8MA 5I02A 1H51A 3B0YA 2HVMA 2QVNA 4F9DA 4ZTXA 3UA4A 2YSWA 2G3IA 3SGUA 3L4TA 3GNNA 1VFMA 1E6NA 3W1LA 4R9OA 2ZZ2A 4V28A 1YYAA 3A5VA 4PBGA 1JXJA 3NAVA 3H21A 3W2UA 1V0KA 1EPVA 1MEHA 4JHMA 4UFHA 4W4QA 2HTMA 1GOMA 5HMFA 1QJWA 4JTAA 2V67A 3G5EA 1QOQA 1PKYA 1O5RA 4GIAA 3WDIA 5G2HA 4G7EA 2Z6IA 4NJHA 5FF4A 2VFHA 1R7OA 2CW6A 4NL1A 2VWTA 4UTWC 1EIBA 2I17A 3ZM8A 1Z48A 3AS0A 4XVEA 3SIZA 1CGXA 3H2MA 3UY7A 5CSRA 3L0NA 4XBJA 4UOJA 3WBYA 4UZUA 1QHZA 2H9AA 1XBYA 4CNUA 4DLMA 1XJBA 3EDFA 2TRSA 5FD0A 3MS8A 4PB3A 2XGBA 2AKMA 2NUXA 4GO8A 3LPOA 1CGYA 1A5KC 1JI1A 3ES8A 3PAJA 3IJDA 4XO7A 3TJ4A 4NIRA 1DBTA 4H3DA 5ABEA 4ML9A 2WSYA 4MY9A 3TJLA 1XSIA 2H6RA 3EOOA 4GUHA 3WJYA 5A95A 4FLRA 4BQ4A 3L23A 4MWAB 4HTBA 3IJ6A 2ACRA 1ML1A 1FWJC 3DFSA 4WKHA 4JTFA 4AEFA 3LTSA 4OTKA 3E0IA 3VGDA 1AL7A 2HE5A 1JPIA 2QCDA 2ZX7A 2ATSA 4X0NA 1OB0A 1KR0A 4C6EA 1JCJA 4TVUA 1XIDA 3I4KA 3UJFA 4F0MA 1TPC1 4H9VA 2R82A 4MNKA 2FJUB 3DFNA 1HG3A 3QC0A 4WJEA 3W1RA 4F48A 2X8RA 3R10A 3QHOA 4E8DA 2PDHA 6REQB 1X39A 2J8GA 5I24A 3PZTA 1WDRA 4MFDA 3TTEA 1U33A 2IXUA 4OBRA 3TYEA 4Z2GA 3BVJA 2PD9A 5A8MA 3G24A 3S1VA 4JCMA 4HOWA 3GFZA 5ECVA 5IRPA 3G3MA 2GPTA 4M0XA 1BSLA 4PFMA 1Y5VA 2INZA 1AH4A 5A69A 3TW7A 5FA5A 2ONEA 3MCNA 2CBUA 1GQNA 4RDYA 4U10A 4DM1A 1ZHAA 2BMBA 3ZR5A 3UNTA 3NEHA 1RY0A 3WJZA 2VFFA 2GDVA 1R6WA 4KBXA 1TSIA 3KBSA 2VFEA 1J4EA 4PMVA 3T6CA 2GDUA 1R38A 1XXXA 3TYDA 4Q8WA 3BSMA 3JS3A 1TTQA 4RE0A 4BZYA 4D6DA 1JL8A 5HWMA 3SGGA 3K4DA 4JIEA 3T2PA 3QYQA 4B5SA 3VOJA 3WL0A 3ZO9A 1QNQA 2ZVRA 2WSQA 3IJIA 4GX8A 1ONRA 2Q09A 2JF7A 2F6UA 1TKKA 1TX2A 4AD0A 2EHHA 4EE9A 3UNDA 4C60A 5BXRA 7REQB 1TIMA 2W92A 4OJYA 1N8WA 5RUBA 2CLIA 4XWUA 1SO6A 1FWBC 3TE9A 2QF7A 4I5XA 3SN1A 3M0JA 3T4WA 3LI0A 5TIMA 3OZPA 1EQCA 1KRMA 2WANA 3EX3A 1LROA 1LTDA 1AW1A 4EKJA 4POCA 1TPFA 4S23A 1Q7QA 4FNRA 1BYCA 5IBXA 1PKLA 3PTKA 1TWSA 5KEZA 5LYRA 3PBUA 4URIA 2XH4A 1L2QA 2QUUA 2RUSA 3TONA 3OHMB 4QX4A 5LA1A 3MKCA 5I23A 3RFAA 2IKJA 5T9BG 2FGLA 1TQJA 4LAKA 3WH8A 3O8AA 5FEXA 3AMLA 1QFEA 3AMGA 1BTCA 1B90A 1PEZA 2QS8A 3WNOA 2J77A 3DKLA 3OZOA 1UUOA 1XG3A 2QVHA 2NXIA 1ZJHA 3L4UA 1OY0A 3G1RA 1UKTA 1UR1A 2E5CA 4G7FA 4I9MA 2JGQA 2RDWA 3BL3A 3L4YA 4A8IA 2IQ0A 3QM3A 3DZ1A 4Z42C 2V9DA 4LC6A 4WIWA 3IPWA 1KA9F 2PLJA 2YDRA 1GJUA 4WXZA 4NU7A 2E6AA 5MHBA 1PUDA 1PYMA 1XLLA 3TW6A 1HW6A 1XL9A 2WLYA 5D9NA 3P14A 1IXPA 2BGQA 1R3VA 1YTDA 1EF2A 4HMDA 4HA3A 2R1NA 3CH0A 3P60A 4LS2A 1EA9C 4W86A 3N6JA 2J25A 3ANYA 4WY0A 1W0MA 3QFEA 4NRSA 2G3JA 2E3ZA 1VRXA 3RCMA 1HJXA 3BMXA 3UXIA 1TCDA 2R1MA 2OO0A 4Q4RA 4JQ1A 3UT0A 2ZA2A 1AUSL 1OX5A 4TOQA 1IT7A 4LVDA 4WY0F 1O5XA 3CV1A 6ALDA 1QT1A 3HM7A 1EWDA 3K8MA 1E72M 4LANA 2BBFA 5FJIA 4UC5A 4EXBA 1YDYA 3DN5A 4YNGA 3GTIA 1WAUA 4X2RA 4KQNA 3NOYA 2XSBA 4QLKA 2C71A 1F5ZA 1EZWA 3VM7A 4G1KA 2OYLA 5ABHA 2GJXB 1G94A 3TTYA 2WZMA 4HU0A 1NIUA 4HZ7A 3LHVA 4ZGYA 2OEMA 5JMUA 4LVAA 3PVFA 2E40A 2V3GA 2CXEA 3VDHA 2EPMX 2A21A 4I7VA 3OW1A 4JTEA 4C7DA 3SJ3A 4MMWA 2XDFA 1RY8A 1LL4A 2PWDA 5G2IA 3VIOA 4XIAA 4AEEA 4AZ7A 2WXDM 4ZR8A 4REQA 3SCWA 8A3HA 1EJVC 4LF1A 3N6QA 1UR2A 3EMCA 5GNZA 4LOCA 3TTSA 1LBLA 3LTYA 3CV6A 1V0MA 3REQA 4XZIA 2YL5A 2YDSA 3V36A 2VELA 4GBUA 4JFVA 4TIMA 2VC5A 4PFHA 5IM51 1P4CA 2OPJA 1EEXA 3D47A 1DIKA 3NL5A 4GNVA 1WZKA 1XDLA 2BASA 2UY3A 2A79A 1E6QM 2FIQA 4A3YA 1UYQA 3XISA 4YMZA 4JTDA 5D09A 4FHAA 3LQLA 3B0XA 2IXVA 2POTA 4MAZA 1I6NA 3W82A 4RW5A 9XIMA 3M0XA 4JTKA 4Y7EA 3DG3A 5LKYA 4GNJA 1T99A 3ATZA 4HSNA 4OV4A 3MCMA 3BAYA 5K9CA 1UOZA 3DC0A 2BHZA 4K39A 1KQZA 4JTCA 2ZVIA 2PWHA 1KV5A 3FDKA 2PWVA 2CBJA 4ATDA 5TBOA 5JQ9A 2HK1A 5AC7A 3SEPA 4DJEC 5KZ6A 4H41A 4KH2A 5AHEA 1S46A 4NX0A 3U8GA 3TQKA 3RO6A 3PBGA 1JPDX 3LCHA 1FWEC 1FKWA 1V3KA 5D37A 2F61A 3LU2A 3M5ZA 4Q4SA 3WLMA 3W72A 5FJRA 4OGZA 4BA0A 4LXFA 3TC6A 1LQAA 1CIUA 3AS3A 4GPNA 3FSUA 4R7WA 3NQ6A 4OKDA 3W1NA 4KF1A 2X16A 1ZS2A 1V3HA 1NTHA 1KLYA 4NVTA 1QXLA 1XGDA 4EPKA 4WQ6A 3LBOA 5G1TA 2J27A 3N9RA 2PRMA 1WPCA 2C19A 3R25A 5T26A 4QQ3A 3QGAC 4HHLA 1W5PA 3OBAA 3GDKA 3WMSA 3C52A 2ICSA 4LVFA 2WAGA 1I60A 4QE4A 2ZCGA 1HP4A 2D2GA 3C0QA 5J8LA 3MYPA 3QZAA 3GLCA 3VCRA 1IZCA 1E4IA 3FJLA 3QH2A 4I90A 3WUGA 3GAYA 1ALDA 2NT0A 4Q6JA 1VEMA 1GZ1A 1PTGA 5I3JA 3V16A 3VIPA 1CDGA 1Q6EA 2DSKA 1RXOB 5C7HA 3EPMA 3O2LA 3MWAA 4AIOA 3JU2A 1J79A 2BP1A 1ITUA 1B57A 1ITXA 2W9MA 1MQQA 4ZB2A 3B8SA 4AZHA 3GNPA 2FB2A 4WOZA 3T08A 1PSCA 4X0VA 1TIWA 4W5UA 3UCQA 5EBUA 5I03A 5FSEC 1MXSA 4WZHA 5C71A 1C93A 4NZ4A 4HKPA 2WWCA 1Q6CA 1B3YA 3AMKA 4J3UA 2CC0A 3FSTA 3VD4A 3CEUA 3IEBA 3CHFA 4M29A 2XIOA 1JFHA 2IKHA 3TSMA 1JCXA 4GRSA 3CHVA 4NF7A 3NQBA 3VUPA 3GC2A 4S2BA 5GJMA 5C9RA 5HWJA 1H63A 3TSDA 3V7PA 1ZNNA 4UCFA 4R9XA 4JY8A 4HP5A 4NJIA 1K1DA 1VYRA 4IG2B 3F5JA 5D32A 4W7VA 1RQBA 4R53A 2V38A 4OUIA 3BCDA 4CVWA 3C2EA 5G5IA 4KEZA 1IWPA 3RGTA 1IGSA 4IPPA 3UWEA 2YLAA 4P5UA 2GJRA 3FKKA 1G69A 3VZYA 2XJ7A 2D73A 2WVSA 3S2CA 1X8CA 2PFHA 3IIXA 3RPDA 1VZWA 4NQ1A 2WVTA 4RJEA 1B9BA 1XIFA 4GYPC 2PGEA 3V1PA 3K2GA 4U28A 3HJEA 3NQAA 1FH9A 2D20A 2OX1A 7XIMA 3DH7A 2W6RA 4U2YA 3ABSA 2PCQA 1L9WA 1NP2A 1ME8A 3FA3A 3CASA 2OVLA 2QIWA 2DORA 2VFDA 4JHOA 2YCEA 2Z6JA 4S1FA 2V30A 3TTOA 4C6DA 3LGGA 2B7NA 4ZZ9A 3AFBA 1GGOA 5D2XA 3TAKA 1V6YA 3GR4A 1SFLA 1W5OA 4G8TA 3EWDA 1P43A 3SUVA 2OYKA 1UIPA 1I9CB 5FF7A 3SDOA 3WG6A 2YZRA 3OQ8A 4N6EA 3ABOA 2QDGA 4UQAA 3PUDA 2G50A 2NXHA 1R9YA 2ZX6A 3P74A 1XLEA 1ZENA 4UBPC 1DWHM 2OSXA 2SFPA 2Q71A 3WNMA 3GFYA 3TNOA 1E51A 1TJ1A 3DFPA 2FH8A 1EO7A 2Y62A 2KX9A 4XAPA 3O0KA 3KL3A 3LENA 1XUUA 4J27A 2XG9A 5A8OA 5G1YA 3CUIA 1JG9A 2HBVA 4IJCA 1UASA 3L0GA 4N9CA 4CVUA 5F2GA 3CAVA 1DJZA 6XIAA 1LT7A 4MY8A 3W1QA 4AXKA 4RUBA 2A5HA 2V2DA 5H8UA 2DZXA 3T0TA 2GQAA 3N9SA 3C6CA 1WX0A 2BLEA 2J6VA 4JKLA 2V2HA 3S5OA 2KZHA 2NUYA 2VCBA 1ICPA 3M5XA 2O9PA 3F4VA 3W4RA 2F7FA 4DPPA 4BFAA 4BI7A 4OHQA 5IHRA 2J7EA 4I8YA 3D3AA 5G1MA 5AECA 4DJFC 2XWDA 4W89A 1LOQA 4LALA 2XSAA 3F5LA 4O0KA 4E0CA 5ENLA 2X05A 4FOJA 2D24A 1EBGA 4PCTA 2YB4A 3BG5A 3DGRA 2WNNA 5A6AA 4AISA 2DZAA 1HT6A 1S5NA 5DT7A 4XK2A 2PLMA 3VD5A 1TPB1 4C6PA 2VZVA 1VJIA 3O63A 1PTAA 2ZX9A 1KTCA 2XTKA 3OGVA 3MQTA 1RVKA 1VYSX 3OU8A 3SURA 5CH9A 4F0SA 1G0CA 1JXKA 1PZ0A 3LEPA 1S1RA 4MWAC 2VO5A 3OBKA 3N15A 1MW1A 1OC7A 2O56A 3SQSA 4EOUA 3ECQA 2J9ZA 2AOSA 1E6XM 1I2RA 3GDRA 3E0WA 2E1WA 4KW2A 2XVNA 3LHTA 2F9RA 3GM8A 3HZ3A 3WJXA 2BZNA 1IT0A 1IEIA 3VNLA 3D3FA 4LVBA 4N9BA 1FCBA 3R89A 3ARSA 3FDGA 3WLRA 4IMFA 4WD0A 5K7JA 2WJEA 1VLWA 3KOXA 2J24A 4X61A 3RX4A 5I78A 2BS9A 4NZ1A 4PUMA 1LCOA 2Y8UA 3W87A 4CGTA 1K77A 4QITA 1SJDA 4J40A 4PRTA 1VFSA 3TZFA 1OCQA 1TR9A 1FRBA 3WQ6A 2PBOA 4H6RA 4C91A 4V27A 4YVXA 4L1XA 3QR0A 2Y8VA 1MWOA 2MNRA 2Y63A 1YQ2A 3E5BA 3QZEA 1H41A 1XP3A 1TPDA 1QHOA 4BF5A 4CQAA 1HO1A 4QJ5B 5DX7A 1RBAA 2V6AA 3CIXA 8CGTA 3UYIA 1MFUA 2PDFA 2Y5EA 1GVQA 9RUBA 1XLMA 1H7NA 1TO3A 2HCVA 3W7LA 3VKAA 4UTWA 4MIMA 2R24A 4CQDA 5I2UA 4PR4A 1W9XA 4GIYA 4H9TA 4LAOA 2TAAA 3ARVA 4WSKA 2PI6A 3HMCA 4HZMA 3W2JA 3HA1A 3W38A 3L65A 2OYMA 2WQPA 3VIKA 2EJAA 4B16A 4CQBA 1DTNA 3E2SA 5HNRA 3PR2A 2PP3A 2WO5A 4WDXA 4MFEA 2ZE3A 2WCSA 1VKFA 4AH7A 4MSSA 1FWTA 2QW5A 3GVQA 3VX0A 3CU2A 3I7QA 1CBGA 3AXHA 3BG9A 3CZEA 3DFTA 5JIWA 4HHPA 5CSUA 3N18A 1K8YA 3I68A 1F6YA 1T8XA 1VRDA 3FOKA 3RCYA 1YEYA 3SQMA 1X96A 3WQGA 4HU4A 3B4YA 4QTGA 3WYZA 2QCNA 4NYUA 1RZMA 4N7QA 3WQEA 3ARYA 2YX0A 1RALA 4Y9AA 1CCWB 4D6JA 1XYCA 2DY3A 7PTDA 4LCRA 3UG5A 4XZLX 2VENA 5I5RA 1XRVA 3UBPC 3UG4A 4AU0A 3MO4A 3BQ6A 4GQQA 1WKDA 3R79A 1XDMA 4KCWA 1CXFA 3CNYA 4Q8TA 4ZE4A 3IRDA 1J0IA 4GK8A 3AYVA 3LPGA 1EX1A 1RJPA 3VNYA 3PUEA 4J7RA 2YCIX 3ZVHA 1QNPA 4IQLA 1E56A 4PUNA 3FCPA 1EX5A 1ZAJA 4FLOA 4US6A 4C1NA 3GRIA 2QCFA 4CN1A 4JS3A 1XRFA 1P0KA 2F6XA 1SZGA 3LBCA 3U9IA 4TV6A 1SVDA 3LZ5A 1F3TA 3VE7A 3N2TA 5EYWA 2QCMA 3GXMA 4JD4A 1S2AA 1ISZA 1MQPA 5M2FX 4C6OA 3NO3A 1OFPA 5AVNA 4EWND 2JE8A 1RUSA 5AHIA 4K7YA 4GQ0A 2OOGA 3KRBA 3THAA 1UKQA 1N8IA 3RHGA 3BUVA 1ADSA 3C3NA 3PTQA 3H2NA 1GKQA 2RDTA 1X1OA 2ISVA 1YADA 1E73M 1QPQA 2J8FA 4AX7A 3WDJA 3W7NA 3ZWTA 4B90A 5CPLA 4HIBA 1HQTA 5FIPA 1OGGA 5LNWA 2YGYA 3GYCA 3WF2A 3K13A 2JK2A 3ARQA 4ACZA 2PU0A 1OYBA 3F1QA 1EUNA 2BXYA 2E9MA 1BXCA 4K7VA 2WM0A 3WMCA 3MUXA 4I6KA 1CWYA 1FA2A 3W22A 1G7VA 3EA1A 4PMYA 3DERA 1DE6A 5CJNA 5D04C 4CLMA 3QN3A 1C8QA 4A22A 1B3WA 4ZSTA 4LPCA 3CH9A 4CCEA 3C3UA 3L2IA 4KRTA 3WEOA 3W2LA 5EY5A 1KM1A 1UP2A 4BHYA 4HJFA 5FACA 3MP3A 4HCHA 4CUCA 2NQJA 4A3HA 1EKOA 4AC7C 1M5WA 4UOZA 4JXCA 3ITXA 3I3BA 4QR6A 5A6KA 3NPWA 2VKZG 1IXNA 4GY1A 3H24A 2C7FA 4D71A 4XBKA 2FJKA 3AC0A 1D3GA 3E0LA 2GYIA 5CPSA 4CN4A 5DY2A 4GUFA 2CZVA 4DUWA 3G0SA 5BOEA 4HPXA 4YYFA 1B5TA 3W37A 1J0HA 4IGSA 1J2WA 5DBTA 4Y6GA 2FTWA 1HJWA 1OYAA 1SSDA 2FTYA 5CPQA 3LG3A 2Q3RA 3SCQA 1NQ6A 2QKFA 1I4NA 1VBRA 4PCFA 2BX7A 4H01A 2V3DA 3G77A 1I1XA 4IQJA 3DYMA 1JI2A 1GVOA 5DQPA 3VIIA 5ABGA 2RKXA 1EDGA 3BLDA 3AJ7A 1YE6A 4DF1A 2BDQA 3V0SA 1Z69A 2NVCA 3N3MA 1KKRA 1LUCB 3H7UA 1TPH1 1G1YA 2O0TA 2VEKA 3ALGA 5BZAA 4DN1A 1FFRA 4RNFA 4F0KA 1R3QA 3FAWA 4JX6A 1V6VA 1HF6A 3W7IA 1PIIA 2JQXA 4PB5A 3ZT6A 1NDZA 3JW7A 3URBA 2WCGA 3TQ0A 4LFYA 2RAGA 4UR9A 3W27A 3M9YA 4IGMA 1W5QA 4PSRA 2WNWA 2FVLA 2PGRA 4GY7A 1E6ZA 3BCJA 4O19A 1TWZA 1FVPA 5HMEA 1XIJA 3W0KA 2XPKA 3QVQA 4U33A 2AAAA 1BGGA 3B9DA 4H6QA 4KEUA 4IPNB 4QNEA 5FCZA 2BVTA 2EG8A 4Z2LA 3W83A 2EXOA 5AFDA 4D9PA 1OD8A 1UB3A 1P7TB 4ICCX 2R6OA 1OFRA 4RNJA 3TA9A 1LRNA 3W74A 4O50A 3R2GA 2VOTA 3Q37A 3HTWA 4EF9A 2E0PA 3COTA 4J35A 4H6EA 4K8GA 2H8ZA 1MNZA 2O9TA 3HV9A 1ITCA 3Q94A 3A9BA 4IPJA 3QOKA 1ESWA 2QMKA 5EFDA 1AFSA 3L4XA 5BXPA 1WOAA 2X1UA 3G1VA 1MUMA 4H8UA 2BVYA 3G8RA 4L4LA 4WK9A 3BSHA 3W53A 2YZ5A 3QV7A 5BWAA 1R3YA 1PE1A 3F2CA 1PYFA 2ALDA 1ECEA 2E5DA 2VR2A 3NPVA 1XYAA 4S3JA 4K1WA 4BK9A 5H6HA 2PD5A 1UWRA 4MUZA 1PV8A 3RU6A 3AIRA 3EB2A 4F79A 2PDQA 2QDEA 1NWRA 1WXYA 3PBWA 4YU1A 4KFPA 1M7JA 2YLLA 1GEQA 4TVDA 4Y9OA 2V81A 3VOCA 1GVSA 4EP8C 1K8ZA 2Q3OA 3GBEA 3N9KA 4NZJA 4JTLA 3GFXA 3H4GA 4AD1A 1UD3A 2Y7GA 1OQFA 3SM0A 3VMNA 1S3TC 3VDBA 5A8PA 3U5UA 1XI3A 1XUZA 2OCZA 1EL3A 2QIIA 3KHDA 5M3WA 4C6JA 4JTIA 3CB3A 3MI6A 2PTZA 4HJWA 1F76A 2PA6A 4QG8A 1J96A 3MSYA 4I9TA 1JZ3A 3UWQA 4ZOAA 4ATLA 3VOGA 1EF3A 3GG0A 1SYTA 4H19A 1BVWA 2JBMA 2A3BA 3WH9A 5EA9A 1ZAIA 4ZQNA 1R86A 2ZRZA 4U5KA 2CLMA 3QGVA 3RITA 4EPDC 4XISA 3WD4A 1CGWA 2V5JA 1W3TA 2VQUA 5A6TC 4MZ1A 5CBIA 4FNTA 1HKMA 2H3DA 4O0ZA 1T5AA 2DIKA 4Y8EA 2J9XA 3ISIX 1M68A 2VM8A 3EGJA 1OD0A 5AB3A 3T42A 2ZUVA 2ZRWA 2IS7A 3GE7A 4TX9A 3H23A 1MW3A 4GI8A 2JKEA 3N12A 2WHKA 1AZ1A 1YTKA 3VOHA 4C90A 1CXHA 1O95A 5A8GA 1CGTA 2CFFA 4ICMA 4QLJA 1NY1A 4H7VA 4AZIA 3FYYA 1K9EA 5CEWA 3L4VA 3ITGA 3IGSA 4TXEA 4PEEA 2CLFA 5I06A 2I5GA 3GDTA 3W7CA 5E1QA 4H7ZA 1DHPA 1XC6A 3EDJA 3OHIA 1XYMA 2REQA 2BVWA 3LI1A 5M03A 1J10A 1XRSA 1QO5A 1XGZA 4LUSB 2Z0IA 1TE1A 2PE4A 3VA8A 5BU6A 5IDIA 1NH6A 1OC5A 3HGOA 4KPLA 1QW8A 3KE0A 3KVMA 1PVNA 2VDHA 1OABA 3MZNA 1AJ2A 4XKYB 1VIZA 4HZ8A 4GXPA 3A3WA 1UMLA 5EMJA 3AIEA 1V6WA 1QW9A 4HMEA 3GBDA 3WL1A 1TVLA 4Q8PA 1E1CB 1ISYA 1YLVA 1DWFM 3L66A 3VVGA 3BZGA 1UR9A 3CAWA 1VEPA 3WD0A 3ARTA 3S2MA 4FZIA 3SCRA 3LB0A 1TV4A 4PB4A 1V08A 1BYDA 3G18A 4HPGA 1B3ZA 3LCWA 4RDZA 1Q6GA 2OXNA 1C91A 4WOQA 3V5CA 1GUVA 3KHJA 2O92A 1VCFA 1DWAM 2W79A 2GSHA 2V5BA 1XW8A 1DJNA 4GYPA 5CGTA 4XZBA 5HPOA 1F9CA 3PC0A 4EXQA 4L64A 2V5LA 4Y90A 3A5FA 1VPQA 3ALFA 3NQEA 3RLUA 5I3DA 3TFXA 3UWWA 2BFGA 4TQTA 1ZJIA 1FWAC 1K03A 5HUOA 3EEZA 4FIRA 2E68A 2PC8A 4H8VA 1Q85A 1ICSA 3M0HA 1XFBA 1OVDA 3B04A 1B1YA 1VENA 2ZXDA 3GUGA 3TCSA 4HNVA 4AHQA 5FL1A 2WMGA 1JCNA 3NSXA 3SRHA 5CG7A 4HA4A 4Z1DA 2INFA 3PWGA 1BPLB 1D7FA 3MUZ1 4ZOBA 4FI4A 3OOQA 1SJAA 3MVIA 4AEOA 2R1LA 1VIWA 3WEMA 1KFCA 3NYZA 1F3EA 3T7VA 2P76A 2DZSA 4S3FA 2J75A 1E6PA 5FI8A 3PWIA 4S2CA 3QLDA 3ARPA 3AIUA 5BMXA 4F2UA 5CAKA 4KEMA 5CJ5A 1F73A 3B9OA 4IXHA 1V6TA 3W7RA 4AVOA 2GGJA 2Q02A 1PIFA 4GJJA 4XKMA 3S0CA 3T2OA 3AIQA 1EUAA 3LPPA 3TCEA 3AWNA 3N4EA 4NI8A 2YA0A 4BF7A 1NVMA 3IACA 4IUOA 2Y0FA 2PRLA 3BLOA 5AYZA 2X40A 3N14A 4DZIA 3KBJA 3MCOA 2ZADA 3MI3A 2WKGA 2XU2A 4LCQA 4AAJA 2XFWA 4F66A 1VFOA 2DJXA 4BEQA 4ZL1A 4GGHA 5DMYA 3H7VA 3W73A 1OK4A 3DESA 4O10A 1PXGA 3S5YA 3M6DA 1T0OA 3NVTA 1OX4B 4DJFA 5C2CA 2X41A 3LSBA 1NSJA 4Z2IA 1KM6A 2EJ1A 2WOQA 2OT0A 3DEQA 1US0A 3VXGA 1OM0A 4MY1A 5ABFA 4L80A 1HP5A 4EX4A 5EFFA 4NNCA 3IARA 3MSDA 1UPPA 5K3VA 1GVRA 3R0UA 3GH7A 5HXMA 3M4HA 2Z27A 1TA3B 1NFGA 2C3ZA 2JGYA 3B8DA 4OBTA 4X9YA 1JD9A 3AMCA 4J5NA 5EKYA 4I6VA 3BH4A 2OZ0A 4FX6M 2Y5JA 4DYJA 2CHRA 4PTXA 1FWFC 1BSIA 5T91A 4GKLA 1KBJA 5EMUA 5AC5A 3DKJA 1BKSA 3RLHA 4Q8UA 3UG8A 1M7PA 1S2CA 1SQ7A 5E70A 1G01A 3IAQA 8TIMA 4JY9A 2RH9A 3NQDA 3KZPA 1R3RA 1TCMA 1U22A 3IVSA 3OZMA 2YIHA 5JBFA 4QBXA 1UZHA 4JTUA 2DDXA 2ZXAA 1CLKA 3SAZA 5HJYA 3GSMA 2EQDA 3WQOA 2ZIDA 3TR9A 1IIGA 3VZXA 3D5HA 1PKNA 1PX3A 2ABBA 3FGCA 1YXYA 3ZJ8A 3QY7A 3R1ZA 4Z1AA 4QAIA 1NF0A 2W27A 3VKDA 1IZKA 1R47A 1BYBA 1HO4A 3SQLA 3SCVA 3GU1A 2DZTA 3CM4A 1S1PA 1UUQA 3BJTA 2BV9A 4CU6A 2XFRA 4EANA 4GOAA 4LV4A 1OT1A 3NR0A 4MGGA 3JZEA 2V5DA 4WSHA 4PRRA 2WZIA 3VCNA 1K8XA 2V3EA 3L67A 3NQ8A 3AXXA 3J7HA 1DIOA 4R27A 1S3HA 1GHRA 1H2JA 2ZC8A 5H91A 4NHVA 3MVTA 1I2NA 1QW7A 1U1UA 3S8HA 2QPXA 4LCSA 1FWCC 1JAKA 2VZSA 3IJLA 2DQXA 2VRKA 2CWXA 1SJCA 3W07A 3CYVA 3ABQA 4YJ5A 3SIMA 2OWWA 4OWGA 3LCFA 1S2UA 3IGUA 4M1RA 5DO8A 2FPYA 4O17A 1QI4A 1HIZA 4JIQA 5B7ZA 5C55A 1JZ8A 3S1GA 3L2LA 4GE8A 1GQIA 3QSRA 3FYPA 2WZTA 4AW7A 1RPXA 4JFSA 4RV3A 2OKOA 1E4LA 3TROA 4IP4A 3R13A 1FWDC 3AXKA 2VD8A 1S5WA 2YW3A 3QEZA 1XICA 1DJIA 5TF0A 4U5IA 2PURA 3LV6A 2JF6A 3QJAA 1NJJA 1UWIA 1FDYA 2WQDA 2G0WA 3VE9A 1DWGM 4G7EB 1X97A 1XFCA 3ERPA 3QQ1A 1LWHA 3GTNA 1ZLPA 2RGMA 2OELA 2C15A 4WVXA 2DH2A 4IIEA 2GWNA 1CZ1A 2JIWA 3RMEA 3S2LA 3S6TA 3RG6A 1AJZA 2CETA 4DF2A 1KB3A 1QOXA 3PHAA 4WGHA 4DZ5A 4DYKA 4UCGA 3VIMA 1OFOA 4FX7A 5CC3A 4NYYA 1XLKA 2H9AB 2ZYFA 3PS7A 3BDKA 3L12A 1M65A 1SZFA 3LXBA 4GQBA 1PO9A 3GDBA 3EMQA 3CMJA 1T8QA 4HSOA 1CX9A 3R4IA 1AMKA 3SECA 4J3TA 3KOFA 2VX6A 1K70A 3E1F1 1JYVA 3TYCA 3PG8A 4J3ZA 1EJWC 3PNZA 4D8LA 5DEZA 2DVTA 2POZA 4IP7A 1V0LA 2IW0A 2L5HA 4A29A 4EAYA 5F1UA 4OIFA 4RZ4A 4UTIA 1KKOA 3Q2DA 2QCDB 2FH6A 4LF2A 1JVNA 2XZ9A 4I5RA 5CJMA 2C13A 2OJPA 3W26A 5DMLA 3CZLA 4FF7A 4DXKA 3SRDA 4JDYA 2DGAA 1EPXA 1A5CA 3GQYA 1IGWA 3NSNA 2P0OA 2HZGA 2KAUC 2QEZA 1OADA 2VD9A 1P6WA 1ME9A 1TE6A 5HNNA 3CZJA 5KZMA 5I00A 1ZBWA 4JTQA 1VFUA 3UR5A 3NQVA 1ZB5A 1JYXA 3P0XA 1HKKA 4A3UA 4HU8A 4TU1A 1US2A 4AIEA 3CO8A 2PDLA 3HGSA 5HR6A 1O60A 3BAKA 3LMZA 2FZBA 6TIMA 7ODCA 3N73A 1ZJBA 3WBEA 1K7FA 2ADAA 3O07A 1VHCA 3M5YA 1H50A 2PU1A 4ZO8A 1ODZA 1PZ2A 4UFLA 4ZXLA 4GNKB 5BRQA 4GIRA 4PSPA 4MZ8A 3VGFA 1Y7VA 1O1ZA 4F0LA 1TTIA 2BSLA 1SZNA 3PG9A 1UR3M 1KXTA 1POKA 3SR7A 4CQCA 2ZUUA 1C9WA 3NNTA 1OHLA 3ZLFA 3PTMA 1SGJA 4LYRA 2Z1SA 5KTLA 1SUXA 2WHJA 2XIQA 1KBIA 5D2VA 3AS1A 3N34A 2DSWA 1V03A 3VGGA 1LT8A 1A49A 3APTA 2NLYA 2Z1XA 1DVJA 2XVPA 4QJ3B 1GYMA 4NX5A 3NCOA 4ZO6A 2OKTA 1BF6A 5DCBA 1PCWA 5REQA 3NQ2A 5EU9A 3TN3A 3DIPA 4HNNA 2ZA3A 4XBSA 4B5XA 5I3GA 3EXRA 1MZRA 1RVGA 1H0IA 4UB9A 3R0DA 3WLJA 3STGA 1IYXA 3OIHA 1OZQA 1B3VA 1V3LA 2B4GA 2C1HA 2X42A 2XUCA 3EAUA 1LL6A 2FFIA 3R8RA 3WKZA 5DXXA 2VGBA 4I3GA 2OEJA 1QBBA 3NJ3A 2BHUA 4MNLA 2J88A 3VKJA 4WLCA 2J74A 5A94A 1XYLA 1PZ1A 2YL8A 4CN6A 4HK6A 4XZMX 3PWAA 4I7UA 3STPA 1WZMA 2MUCA 2OU4A 4P7RA 4LBSA 2NV9A 1VB9A 4NXKA 1D9EA 1KW1A 2G8ZA 1W31A 4IJBA 3RM9A 4UMBA 3P81A 4W93A 1XC4A 2HK0A 1WE5A 3LPFA 3TMLA 2D3LA 3HB9A 1DL3A 1XHGA 3M16A 3R8HA 3UG3A 5FESA 3W1UA 3IRSA 2AMGA 4MADA 3NZ1A 4WY0B 1POJA 3CB8A 3GTXA 1HJVA 4DBEA 3BXWA 4PMRA 1YNPA 5EMMA 2I9UA 3AUOA 1R0MA 1JF6A 3FA4A 2OTDA 4Q4MA 1UWSA 1OEPA 1QMLA 1THFD 4O18A 4I7WA 2ZUTA 2QGHA 2I1OA 5CZTA 3NDZA 3WF0A 4MKVA 1SFSA 4ALDA 4HOXA 1EGZA 3BICA 3FS2A 1HGWA 3W84A 4Q4OA 3VD7A 4DY1A 3G6LA 2XN2A 4J9JA 3SW6A 1ONXA 5E93A 3SUSA 4GZ7A 1QUMA 3V5OA 1FHDA 1EXPA 3AZRA 3CL8A 1XLCA 1DOSA 2P3ZA 4UTMA 4HCDA 2X09A 1AA1B 1AJ0A 1OG6A 1KFKA 1SFJA 4D6EA 1E1FA 5TQLA 1BWKA 2VP8A 3GX9A 1HL2A 2PP1A 1O7AA 3S1XA 2FKPA 3NDYA 1WO2A 1H3GA 3O6YX 2VJXA 1MDRA 3O0FA 2GSJA 1EC8A 2D3NA 1GOQA 2P88A 5DY3A 5BRBA 4M51A 5KZEA 1UA3A 4REQB 4ZFCA 3T8LA 1AZ2A 3IUIA 1M04A 4PH6A 2DUAA 1KGWA 3EWUA 3V1HA 8RUCA 4UZSA 1ITQA 3B8IA 5HATA 1ZRQA 3NXLA 5G4HC 1C8YA 1F3WA 1VFTA 3QR1A 3REQB 1UG6A 4O57A 3TU9A 1V77A 4P8WA 1P1XA 1XINA 1FY6A 1KM5A 1HFBA 5DXYA 3GG1A 2PZNA 2DT2A 5CC7A 3UJEA 1UCWA 9XIAA 2HNEA 5G4WA 3TEVA 1KCZA 4H2HA 1JJKA 2OFJA 1TV2A 1KM0A 3KEHA 3PZMA 4ORIA 1SMDA 2J7DA 1E0VA 1OGSA 1GOKA 3QW4B 3QC3A 1AW5A 2W62A 3L2MA 1YXCA 2CBVA 4FSAA 3P84A 1XD0A 4Q4QA 3NVDA 4AF0A 4YTQA 1LLZA 3LHYA 1M3UA 3CTLA 4HT3A 4XD4A 3CIVA 2J4GA 4S3KA 1GVYA 3PK7A 1HL9A 2O4MA 4PUUA 2FHFA 4O1FA 1QCWA 1DWJM 4AY1A 3SBFA 1IF2A 4WEVX 1Z42A 1VP5A 3MKVA 3ZFHA 3SO7A 1UH2A 4K36A 3EWCA 2CXGA 3LXCA 2ANUA 4IPIA 3GHTA 3C2VA 4F0HA 4H9UA 3UYCA 1E5NA 2C79A 4FS9A 4DAFA 4B91A 2C1GA 1DQUA 4M82A 3VKCA 3EMZA 4DWSD 3JZUA 1Q8JA 4KEVA 3MHFA 3UXAA 2Q6ZA 3UZWA 3RILA 3CJPA 4GA8A 3P62A 3QY8A 3BG3A 1Z8AA 4JN7A 4MKNA 2Z1BA 4W7WA 4RZBA 1A80A 1E3ZA 1H11A 2ZZ6A 1LDCA 3HPFA 4M81A 1A4LA 3PBVA 4TX8A 3WX7A 1W5MA 1IWBA 2W66A 1H0GA 1VBGA 3N19B 5AC6A 3XIMA 5D38A 4FAMA 3TOPA 1KXHA 2E09A 2C0AA 1LLWA 4ZTYA 4C6KA 3EA3A 4S3AA 1QATA 2Z2BA 1FX6A 2VVNA 2V68A 3RCNA 4CCCA 1E3XA 4G5DA 1X38A 1OFAA 3U4AA 1Q6QA 4FLSA 3XINA 2VI0A 4GJ1A 3DI1A 2ZWYA 2HPMA 4GUIA 2PDJA 1KC7A 2YDQA 1F05A 5DBUA 2V8ZA 3P6LA 3WQCA 3OQEA 4AZBA 1KV8A 2OO6A 2NUWA 3OB8A 3BMVA 4DRSA 2WB5A 3N2XA 3W2KA 1MRAA 3SCSA 2WJFA 3IV3A 3EX1A 2GVJA 1EH9A 2E28A 5CZSA 1W1ZA 3GR7A 1QO2A 2Y1HA 3GW3A 1US3A 4LX4A 1J0KA 3WQFA 4HSHA 1NAL1 1E40A 3OVRA 1XM3A 1YIXA 3KS6A 1LRQA 3CWNA 2AL2A 1VR6A 3WF4A 3FXGA 4JX5A 3KLKA 3AYTA 4C65A 4KIEA 2IPGA 4KWWA 2VZTA 3FA5A 2GQ3A 1KCLA 5BOFA 5HANA 5HNUA 4C7GA 4LBRA 1ZALA 3BURA 1X1ZA 1OFDA 3D46A 3WELA 1CPUA 1NQKA 3ARUA 3LZ3A 4V33A 3QFWA 1WAWA 1ZY9A 3DENA 3P3BA 3W1PA 1BWVA 3PFRA 2ISWA 1DQWA 4Y9NA 2DT0A 4C7FA 4ZQMA 1CXLA 4M6PA 3G1YA 7ENLA 1LOLA 3CPUA 3P5YA 4IISA 1VLIA 4DJED 3KRZA 2QPUA 1C29A 3GKFA 3H6OA 4D6HA 1RP8A 3K5XA 1W3NA 5FJTA 3TK7A 4MNJA 3LK6A 2GGEA 4K6AA 1TV3A 3I7SA 5EBAA 3PN8A 3DOPA 1E6RA 2FHCA 2I57A 4GZIA 4PTMA 2C18A 2F6KA 3H8AA 5HULA 2O4QA 4DQWA 2I16A 2R9RA 1Q4NX 2GL5A 1I75A 1SFTA 4JAWA 1E9ZB 1LP6A 2PF8A 1JGIA 1MYRA 2W5FA 1F74A 1GWJA 4AZ5A 4JKMA 3BCFA 4Y96A 2Z00A 2OGYA 1JCYA 3C86A 1R3WA 1E15A 4QNWA 1TPUA 4QS6A 4R5EA 5HR7A 1WXZA 3B05A 4DXVA 4B5VA 1GPWA 2QYGA 1X8FA 3PFMA 3TMQA 1J93A 4X3ZA 1YPFA 2EO7A 2ZKMX 1HJUA 4LTSA 4PTNA 5CAHA 2OODA 1C90A 2J7GA 4XIMA 4IMEA 3F4CA 2VUYA 1D8CA 2XN0A 3W81A 3WQVA 1GQJA 2FMOA 3RK8A 3VMPA 3WH5A 2PP0A 3TC3A 2YFNA 3G1DA 1X1NA 4J3VA 3T4CA 1VJSA 1CW2A 2XIMA 2FHBA 4DO4A 3VFCA 3UPWA 1RA0A 1RK5A 4Z17A 4C6FA 3IIZA 2HVNA 4MHBA 2PDYA 1PTDA 4O53A 3WUEA 4WJ8A 2NX1A 4OECA 3GH4A 2ZUMA 4C6NA 4L4PA 1FP9A 1MNSA 4HZ6A 3QQ0A 2ZZ3A 2ABAA 5A8QA 3CIWA 2A3EA 1XPYA 5LIUX 4P7LA 3T8QA 5CCZA 2ACQA 5AKQA 3BW3A 1XH0A 3P5ZA 1S2VA 1KBBA 3AXIA 4UTLA 4CCZA 3MUY1 2DJLA 1ME7A 2E4TA 3PZNA 3W88A 1KFEA 3W25A 2VFIA 3MBDA 3PUGA 1E0TA 1Q8AA 2GQ9A 3INPA 1TR1A 4LYKA 1JPHA 4DM2A 4GCAA 3W75A 1EP1A 5AZ1A 3STEA 1PZ3A 3NM3A 1V93A 4KFNA 1FWRA 1XRTA 1A3WA 4NILA 1UD8A 4DJDD 3GXIA 2F84A 4JNYA 2PWUA 1YTEA 1TZ9A 5C0QA 5AC4A 1C9DA 1M53A 4Q32A 3WUFA 3VGEA 2ZDRA 4XD3A 2DZUA 4ZOCA 2BXZA 2B81A 3BW2A 3LN3A 3S2JA 1DJWA 4KFOA 1JQVA 4ZE5A 4RL3A 1ONWA 1V02E 4DI8A 3SUUA 3RAOA 3C0SA 2I5QA 2PDIA 3E3HA 3L9CA 3CWHA 1ADDA 3R0KA 5GNXA 3CC1A 3LGEA 2Y2WA 4A8RA 4ZOEA 4I8DA 1YXDA 5ABTA 2G4FA 3EXTA 4BWLC 4HYWA 3DFOA 4HPNA 3SJNA 4GZEA 3C5QA 1E9IA 3S4TA 5I07A 3KS5A 2F38A 2BOFX 1EXBA 5MF5A 1CT5A 3NQMA 3R43A 1V3MA 5JH1A 1DTUA 1KFBA 1HTIA 3PZVA 3DG7A 4ADTA 2OEKA 1PKMA 1C8VA 5BXTA 2VTFA 4YHEA 2CZDA 3DBPA 3OG3A 2VXNA 1XLDA 4Q4KA 5MKGA 3MZ2A 4DBDA 4YXGA 1SO3A 4ATWA 3LSCA 3KRSA 3W9ZA 4XAGA 3RM8A 1AK5A 3DXIA 4AVFA 1FWNA 3BV4A 2DT1A 4IWWA 1SW3A 2EPHA 1H62A 4AUBA 1NOWA 2G37A 3U2OA 3W7OA 4G1NA 1ZUAX 1YE4A 4D8ZA 1V7YA 3L0KA 3M43A 4J4KA 4AHPA 3K8LA 1W6TA 4QAWA 3VIFA 4PTVA 4ONVA 4XD5A 3S6OA 1ELSA 4I5UA 3THQA 1W1IE 3N29A 1YNYA 2OT1A 3CMFA 3Q65A 4O16A 3GXDA 3CUJA 2C0HA 1JFXA 5AVHA 3LHWA 2VGIA 4LRTA 1JZ5A 1KRBC 2EKGA 4ZBCA 3A4JA 4DWSC 4DJFD 1DXFA 3TFCA 2CLKA 1E43A 2FMNA 4Z1YA 4O12A 1KTNA 4GJIA 2OZ8A 4HD5A 3M7SA 2Z2UA 5CC6A 1Q6OA 5IBXC 3ABZA 4UR8A 4UTKA 4CNSA 3SRKA 1TV7A 3KBMA 3W28A 3W2MA 1XKJA 2WZHA 1FCQA 4FK9A 4UFMA 3QYSA 3S9YA 1L6SA 2YDAA 3UWVA 2J66A 3KL5A 4K68A 1JZ6A 4H9YA 2WHLA 3WFAA 4PRWA 1WBJA 3WNNA 2A3CA 4XX6A 3GHRA 1TPWA 3WFZA 3FJNA 4DBWA 1XLGA 5B80A 1G7UA 1J01A 5FEWA 4UFJA 4MNMA 4WHBA 4KCUA 1B3XA 4MWAD 3AS2A 3UWZA 3STCA 5HNTA 4LAZA 3I6EA 3B8UA 4TTUA 3W70A 4KERA 1ZCOA 3ZVHB 2PAJA 5A6SA 4PMJA 1GZJA 5G4EA 2PSNA 1PWMA 3PJWA 4QIUA 4XTIA 2IQTA 2WW5A 3N17A 4C1NB 4LBUA 2ZA1A 3PTDA 7A3HA 1FCVA 5D8WA 3W00A 3W1MA 4EPEC 2RHGA 3QV6A 1M1BA 3B06A 1EQPA 3AZSA 4RZ6A 1TJ0A 1NOFA 3W6YA 2TMDA 3PB0A 3H2EA 3DGBA 2W0UA 3W24A 4NAEA 1PJ9A 5D9PA 1Y5WA 2VR5A 1UH3A 4DF0A 1JGMA 4JX4A 3KWXA 1PHQA 4FIQA 1Z41A 3GVGA 3ONCA 4KMQA 3BTNA 2TPSA 1KRAC 2YXOA 4B9ZA 2DH3A 3SFKA 4UFIA 3E74A 4FNQA 3KVKA 1UKSA 1KXQA 1UZ1A 5LA0A 4CD6A 4E2BA 3WBAA 3C0JA 3PP7A 4A3QA 1W9UA 4A3RA 3P93A 3RN6A 1H1NA 1L2UA 2DQWA 3K1DA 1OSEA 1SR0A 2C6QA 3I3EA 3HF3A 5LNRA 1HZYA 4TV5A 1E9LA 3AICA 4N6FA 4ACZB 1BQCA 2GOUA 4PMUA 1YPXA 3C2OA 4LRSA 1CTNA 1K4GA 2WZEA 1J18A 5JXQA 2E6DA 1BLIA 2XINA 1PDYA 2FFCA 4QP0A 4XSLA 4PL2A 4YTUA 3EWBX 1WUFA 3ZJ6A 1E0XA 2XM1A 3AIWA 3T81A 3U7BA 4Q7BA 5C70A 4QISA 1JRCA 2FZDA 1X98A 4L4MA 3FEQA 1XIIA 1E0WA 3RPMA 2FGZA 2HS8A 4JTGA 4PMXA 1FOBA 1L6FA 1CLXA 4WSJA 3PB2A 1FDJA 4KRUA 4MYAA 1VYPX 4QCFA 5KMYA 4LYQA 4FA3A 1L8NA 3POCA 2WMFA 3W3OA 4C6BA 4RCXA 2XGZA 4ADUA 4PCPA 5A6BD 4BQ2A 3AYSA 4PMNA 5F2LA 2BY0A 1JQXA 1QOPA 4GMEA 4DUOA 2PDMA 1I2OA 2GUYA 3EX2A 4LS0A 5DMMA 3B8WA 4J1OA 2E8YA 4B2DD 4OFCA 3QF0A 3CAQA 1KGXA 3WF3A 3HFYA 3F2DA 4S3GA 3MDWA 2D2OA 4O14A 1IT8A 2OSWA 3W1XA 4NASA 3WK0A 2RGLA 2ZZ5A 3G1FA 4NSBA 3ZQ9A 3WJSA 5KINA 1M6JA 1V6UA 2YJQA 1DJXA 1N8FA 1UR8A 3NZGA 1UZ4A 3WK3A 3A12A 3KWSA 1OJXA 2OMAA 3E2QA 3M44A 3RX2A 2R94A 4GXMA 2GGHA 3MP4A 4UTFA 3WDHA 3GIQA 1O66A 3ES7A 5K4XA 1J5SA 1A5LC 2XIBA 2NV1A 1WKEA 9CGTA 2EAWA 1B2YA 1G6CA 2X2YA 1YDNA 3CYJA 1HJSA 2QUTA 1IE7C 4CD4A 5HA7A 2PBGA 2WVVA 3TTQA 4LNYA 1FWGC 2YBUA 4O1AA 1U30A 2ZRYA 1M7OA 1XKYA 4WUIA 3EA2A 1SU5A 2VX7A 4BR1A 1MI3A 3WNPA 1XSKA 3GU2A 1LJYA 4UQDA 3W7HA 2VX5A 3EB4A 4DWDA 4MVAA 4J3XA 1UMYA 3USZA 2GVLA 3ELFA 2FQIA 3G0XA 1A5BA 3IJ7A 6PTDA 5KETA 3W29A 4GACA 1CGVA 2J7FA 1JPMA 4FXJA 5KITA 2J6XA 3WBWA 5HJLA 3N2CA 1E6SM 4MLRA 2HDJA 3TKFA 2WSKA 1JF5A 3VTRA 1WKFA 2DV0A 4QFUA 3PULA 4ZODA 3HBLA 4PN2A 4DJDC 2VT0A 1QHPA 2WJDA 3OVQA 1GZGA 4Q8NA 2YW4A 3KZSA 4HNCA 4IH3A 4W87A 2XYLA 5I3HA 2IPWA 6A3HA 1D2KA 3KAOA 4UOQA 3ZVIA 1TVPA 4EAMA 4Y9MA 2UY4A 4GYJA 3BPWA 1MDLA 4E38A 3MUCA 3UESA 1QBAA 3LGDA 3VMOA 3QV8A 4X22A 3GW0A 4N9DA 2WMHA 1RD5A 2Y88A 1R9ZA 3EWWA 5HJXA 1MSSA 4AHOA 1LOSA 2XSXA 2VMFA 1DIDA 2PTWA 3G0UA 1RLDA 2Y7DA 3LNPA 4EWJA 1O12A 4QGCA 4Z2JA 3HU7A 3LCXA 3R6IA 4HCLA 2DVUA 1DHKA 1UZDA 2DIJA 2CKRA 4IFOA 4S3CA 1EDQA 1MEWA 3P82A 4JN8A 1BXBA 3WK2A 3BOFA 3BAWA 1W9VA 2D0FA 3LLFA 5LNVA 4WCJA 3HO8A 3FHAA 3MMUA 3CEPA 3GU9A 1K6WA 2J9YA 2GVYA 5CSSA 2ZRVA 3T0AA 5HOSA 4FPSA 4ERIA 3SRFA 2BGNE 4O52A 3W23A 3D6NA 1W3HA 3UJRA 2IPFA 5AHFA 1OC6A 4IZGA 3GG8A 3AWOA 4AY8A 1P5BA 4CD5A 1QDSA 3MSGA 1RCQA 2PEVA 5M17A 2VEIA 4IUGA 2Z1WA 5CBBA 3T40A 3UR2A 4M24A 4NZCA 4GC3A 3TXZA 4YVVA 3HG2A 1UROA 2BY2A 1KM4A 1PS9A 2BTMA 3VNMA 3AU2A 2GGGA 3AZTA 3WD3A 2CZEA 5AN7A 3EWZA 4QJ4B 3DC8A 4FLQA 1BG9A 5DELA 4FNUA 5D9OA 2PDGA 1PWLA 1Z7AA 1BRLA 1U5HA 3CTTA 3DYPA 4AWEA 3PJUA 2VX4A 1X6LA 1NDWA 1PL9A 2HMCA 2A7NA 1VF8A 4Q8VA 1AQMA 4H04A 3PPHA 1TFVA 5LHFA 1XF0A 2WPBA 3OG2A 4CKQA 1TMHA 3RRAA 4NKCA 5LHEA 1QWKA 2JEQA 1RQEA 3ANVA 2OB3A 5CPOA 4PE8A 4RKAA 3TSBA 4B5WA 3AROA 1EP2A 1PAMA 4PMQA 3LBMA 1EHNA 2DFAA 3CQJA 4GIEA 1REQA 3IIPA 2F2HA 4FMVA 1I2PA 4HU3A 2ZDSA 3BQ5A 2XH0A 1CI1A 3KL0A 5HK4A 1S5VA 3WNLA 2REQB 4KWVA 4CQ9A 1QPRA 3A3HA 1UR4A 4NXSA 4GQRA 3RJXA 2XIIA 1AW2A 3AQUA 4PBEA 4MLJA 4K8EA 3G1AA 3TYZA 2EBNA 3F4WA 1GT8A 1EJXC 3WDQA 2CEQA 1LF1A 4E4FA 3UR8A 2ZUWA 3MUAA 3GUWA 2VDGA 4YWSA 3QPYA 3UZYA 3WH6A 1BFNA 1QK2A 4L6HA 4UR7A 4IJRA 5CLTA 3T07A 2QJJA 4C5YA 4CD7A 4IGNA 5BW6A 4B3LA 2PGWA 3AI0A 3UA3A 3MHGA 1O4UA 1YRRA 3TYAA 5FF2A 1PBGA 3O3RA 4LQ1A 3RO8A 3RM4A 1OIFA 3BAIA 5CG0A 4CU8A 1SW7A 3ARZA 3DFYA 1V3IA 3TH6A 4V15A 3ME3A 4WRHA 5T9CE 3QKZA 4ORMA 2TYSA 2B0MA 1DXEA 1TWWA 3T0BA 1GEHA 3F7JA 4CQ8A 2QCHA 1NOUA 1EBHA 4XQ6A 3II1A 1D3HA 5C8BB 2J13A 1PHWA 3OJGA 5F2MA 2VGFA 1AQHA 2QNEA 1EC7A 3IWPA 4Q7IA 1EFZA 3O1NA 4JL1A 2RDUA 3FFSA 4DBSA 1FXPA 2VL4A 1DYSA 3E6EA 2I5IA 1ZSXA 2V5CA 1FH7A 3M0ZA 5BNKA 3BOXA 4ICNA 4TX6A 2XZ7A 2ZX8A 3HG3A 4IIHA 2CYGA 3DDMA 3G1XA 3HOJA 4U4MA 1I8JA 2CLEA 4W84A 3WNKA 5BCAA 4IQDA 2FVKA 3W7GA 1DV7A 3KBNA 3LCGA 3W1AA 4QCEA 1A5UA 3RIKA 1KQYA 3ID7A 3CHCA 3MSRA 5IFTA 4O15A 3UGVA 4KWUA 4NNBA 4GG9A 4ZQRA 4O28A 2QDHA 3O16A 1XLBA 4O4VA 4W7UA 1T40A 1UC4A 2HWGA 5KZDA 1RLCL 3HQOA 3U2CA 5AYIA 1OZMA 1KD0A 1Q65A 2NZLA 1UH4A 1CB2A 1W8SA 4DB7A 5EMLA 2OLAA 2WYSA 1U83A 3WLSA 2EG7A 5AYXA 3AYRA 2XH7A 4LGXA 4A05A 1HVQA 3PSWA 4NP7A 4EXAA 1K8CA 2EKCA 1S5MA 1F7BA 1E71M 2INEA 2ZRXA 4LJ3A 4C6IA 3KTXA 1GYLA 1K6AA 1LBFA 4F8XA 1DIEA 4JYFA 1U1HA 2AMXA 1F6KA 2ZXQA 2ACSA 1OBAA 2E8ZA 4JTRA 3HQNA 5C6MA 5LIYX 2VZOA 2PDWA 4MUPA 3IV8A 2XVLA 5HWNA 4J3SA 3OLGA 1HVXA 5E0KA 3ONBA 3RLGA 3WQPA 1P48A 4WDTA 2O7SA 4Z08A 4EVZA 4WKFA 1NDVA 1QI2A 3CXOA 2NW0A 6ENLA 1AG1O 2CIPA 1YBQA 5BWFA 5CC5A 2Y85A 3CS2A 5ABFB 1ZCCA 3ICJA 1AQFA 2GSEA 3W7QA 3K4AA 1E4NA 3KCOA 3TZNA 4CNPA 2HS6A 2P0IA 3B3DA 4N02A 3A64A 1SMAA 2PUZA 3BGAA 3P80A 2DUXA 5IOBA 4L65A 2Z2AA 2EPNA 4L9XA 2I9EA 4E6MA 5AHLA 2JIEA 4YHGA 4HNLA 3KW3A 3ITVA 3S3GA 4MAVA 2XVKA 2Y24A 1GKRA 2HQAA 3EDEA 1M03A 5DRIA 5ECUA 3GTFA 3RJYA 4D6IA 4LW7A 2ALRA 2WK2A 3GXTA 3S2NA 1W91A 2V3FA 2X0HA 1BG4A 3PZIA 5PTDA 3UD6A 1C8XA 4JKKA 4R88A 1O5KA 2PDUA 2NVAA 4IFKA 3B0PA 4Z1CA 1QK0A 1TYGA 2J79A 4M56A 1QNVA 1MUWA 4V1YA 2JEPA 3M07A 1H1YA 4UTJA 2XFFA 3W7MA 3RYSA 1ZPTA 1BEUA 1HKWA 1OCBA 3FGCB 4F40A 3Q67A 1W3JA 4ZFMA 1A3XA 3NTYA 4BI6A 4BWLA 1A5AA 2P8BA 3E49A 5C5YA 4FNPA 3FW6A 2P10A 3R8GA 2WMKA 4X63A 3U3HA 1J0YA 5H8PA 1PCKA 5B7YA 5JVLA 2E6YA 4JOMA 4KCVA 3LX9A 1V79A 1LG2A 2WC3A 4YWIA 4NNAA 4P7QA 3OTRA 1XCXA 2QV5A 2WWDA 5LA2A 4Z0JA 1TZ7A 3ZMRA 2ZUSA 3SFWA 1K4HA 1GNXA 4J2PA 4BJHA 3TR2A 3TWBA 5D03A 2OQYA 1IEXA 4GBDA 2HVOA 3I6RA 4AB4A 3PZOA 1GG1A 3ITTA 4CCDA 3FIGA 1VPYA 2Z7GA