1BFMA

Histone b from methanothermus fervidus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
b'MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE B
publication title NMR structure of HMfB from the hyperthermophile, Methanothermus fervidus, confirms that this archaeal protein is a histone.
pubmed doi rcsb
source organism Methanothermus fervidus
molecule tags Histone protein
total genus 20
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bfmA00
1P3LD 5BT1C 3AZHC 3AN2D 4YS3A 5B24A 3X1VD 1U35D 3WTPA 1P3BB 3REHD 2PYOC 2IO5C 5B1LC 4ZUXB 5GT0A 4KHAA 4KUDB 4J8VA 4G92C 1EQZD 1P3GA 2FJ7B 4NE5A 1ZLAA 3B6GB 5B31C 2NZDC 3LZ0D 3MGPD 1P3IC 2BYKB 3B0DC 3W99C 4DRBA 1KX3C 5BNXA 3MNNB 1HQ3C 2AROB 3C1BC 3AZKA 4QLCC 3WKJB 3VH5W 3UTBD 5BS7C 3AZNA 3AV2A 5B32C 5AVBD 1KX4B 4J8XB 3AZJB 4YM6B 1ZLAC 4H9SC 4LD9C 3MGRC 4HGAC 4R8PD 5B0ZD 3AZKC 3W98B 1KX5C 4J8UB 3AZLA 3AFAD 3RELB 4H9PB 3MVDC 3MGQA 5AV6D 4X23B 3WA9C 1P3FB 4XUJC 2NQBD 2F8NA 3R45B 3REIA 3VH6T 3TU4A 4EO5B 5AVCC 3KUYD 3UT9A 3LJAD 1P3PD 4NE3A 4H9RB 4WU8B 5CPJA 1M19C 1TAFB 5AY8C 3REJB 3MGPA 5E5AA 5F99A 3B6FC 1BH9A 5C3IC 5B2JB 3W96C 2YFVA 5GXQC 5CPKA 1ID3C 1S32B 1AOIC 3LELC 4XZQB 3WAAA 3X1SA 1KU5A 1P34A 1P3AA 5BNVA 3AYWC 5E5AC 5B2ID 5DNNA 5CP6D 5AV5B 4WV4B 3B0CT 5CPKC 2HIOB 4Z5TB 5DNMB 3C1CC 1M18C 5GT3A 3AFAA 1TZYC 3KXBD 3AZMD 2L5AA 3AN2B 1P3LB 3AV1D 5AV6A 3UTAD 5AV9C 5B33A 4J8WC 4KGCA 3AZHD 3O62A 3AZGD 1WWIA 2JSSA 5G49A 5GSUA 3KWQA 3REKA 1P3MB 4UUZB 3MGSA 1JFIB 1EQZB 3AZFA 4H9OB 3LZ0B 4H9NB 4YS3D 5B24D 1P3OC 2CWEA 3REKC 4Z66C 3X1UC 3WTPD 2NZDD 5CPIC 3UTBB 3X1TC 3C1BD 5B0YC 5AVBB 5CPIB 5AV8A 1P3KC 3WTPE 5GT0D 4J8VD 5B0ZB 5B2IA 1M1AC 1P3GD 5B32D 5FUGA 1ZLAD 4WU9C 4NE6A 4JJNA 3AZKD 2NQBB 5JRGC 3LZ1A 1R4VA 2RVQC 3AZND 3A6NC 3KUYB 3AZHA 1BFMA 1P3PB 3B0CW 2PYOA 3AZEC 5B1LA 3MGQD 3VH6A 1P3BC 5AY8D 2F8ND 3REID 5BO0A 5B31A 3TU4D 5B40B 1P3IA 2NZDA 3W99A 4ZUXC 1KX3A 3C1BA 1HQ3A 3UT9D 4KUDC 1N1JA 5GXQD 2CV5C 1ID3D 3NQUA 4QLCA 2LY8A 5CP6B 2FJ7C 5CPJD 4J8XA 2CV5B 3B6GC 5BS7A 5B32A 3MNNC 2AROC 1BH8A 4H9SA 5E5AD 4LD9A 5F99D 3MGRA 3KXBB 3AZMB 3WKJC 3AV1B 5CPKD 3RELA 3UTAB 1KX5A 3C1CD 1M18D 1KX4C 4H9QB 4J8XC 3AZJC 4YM6C 3WAAD 3X1SD 4X23A 1P34D 3AZGB 1P3AD 3MVDA 3WA9A 5DNND 3W98C 4XUJA 4J8UC 1F66B 3B0BA 2YFWB 3RELC 5GT3D 1F1EA 5AVCA 4X23C 4YS3B 1P3FC 5B24B 1M19A 3WTPB 4EO5C 5AY8A 5B33D 4KGCD 1H3OA 3B6FA 3O62D 1P3OD 3W96A 1ULYA 5GSUD 4KHAB 5GT0B 5CHLB 5GXQA 3KWQD 3MGSD 4J8VB 3REKD 4WU8C 1ID3A 1AOIA 3W97B 3LELA 3AZFD 1P3GB 3REJC 4CSRB 5KDMA 5B2JC 3AYWA 1S32C 5B1MB 3VH5A 3AZIB 4XZQC 3C1CA 1M18A 3AZNB 3AV2B 3KSYA 1TZYA 5AV8D 5AV5C 5JA4A 5AV9A 2HIOC 4Z5TC 5DNMC 2RVQD 4J8WA 4E44A 3AZLB 4UUZA 3NQJA 1P3LC 3AN2C 4JJND 4WNNA 3MGQB 1U35C 3V9RA 3REHC 3X1VB 2F8NB 3REIB 1U35B 2F8NK 4Z2MH 3LZ1D 3REHB 4E45A 3TU4B 5BT1D 3UT9B 1P3MC 1P3BD 1EQZC 1P3OA 4G91B 4Z66A 3X1UA 5CPIA 5CPJB 2PYOD 3X1TA 3LZ0C 4ZUXD 5B0YA 5B1LD 4Z2MG 3MGPB 1P3KA 5F99B 1BH9B 3B6GD 2BYMA 2YFVB 3UTBC 1M1AA 4ZBJB 4WZSB 3MNND 2AROD 5AVBC 5B31D 4WU9A 1P3ID 3W99D 3X1SB 3WAAB 1KX3D 1HQ3D 1P34B 1P3AB 1A7WA 5B0ZC 5BNVB 4QLCD 5DNNB 1KX4D 4R8PB 4J8XD 3AZJD 5JRGA 3A6NA 5GT3B 5B32G 3AFAB 4LD9D 4CAYA 3MGRD 2NQBC 3RELD 5AV6B 1KX5D 3AZEA 5B33B 3KUYC 4X23D 4KGCB 4AWLB 1P3FD 3O62B 1P3PC 3MVDD 5G49B 5GSUB 3LJAB 5B40A 3KWQB 1P3BA 3WA9D 4XUJD 3MGSB 2F8NH 3AZFB 4ZUXA 5AVCD 4KUDA 2CV5A 2FJ7A 3B6GA 1M19D 5B40C 2BYKA 2F8NG 3MNNA 2AROA 4M6BA 3B6FD 5AV8B 3WKJA 2HUEB 5CP6C 3W96D 1AOID 5B2IB 3LELD 1KX4A 3AZJA 4YM6A 5FUGB 5AV5D 3KXBC 3AZMC 4JJNB 3AYWD 3AV1C 3UTAC 3W98A 4J8UA 4H9PA 3LZ1B 3AZGC 1TZYD 3AZHB 1P3FA 3R45A 1F66C 5AV9D 4J8WD 2PYOB 2IO5B 1P3MD 3W97A 5B1LB 4YS3C 4H9RA 1WWSA 5B24C 4WU8A 1TAFA 4G92B 3WTPC 4CSRA 3REJA 5BO0B 5B31B 2NZDB 1P3IB 5B2JA 3B0DB 3W99B 1KX3B 5B1MA 5GT0C 1HQ3B 3C1BB 4J8VC 3AZIA 3W97C 1S32A 1N1JB 3NQUB 1B6WA 4QLCB 4Z66D 1P3GC 3X1UD 4XZQA 5CPID 3X1TD 5B32B 5B0YD 1ZLAB 1BH8B 5AV5A 1P3KD 4LD9B 3MGRB 4HGAB 5B1MC 5BNXB 3AZKB 4NFTA 3AZIC 2HIOA 4Z5TA 5DNMA 1M1AD 1KX5B 3AZNC 3AV2C 4WU9D 1P3LA 3AN2A 3X1VA 3MVDB 1U35A 3WA9B 3REHA 4XUJB 3AZLC 5JRGD 3A6ND 5AVCB 1P3MA 3MGQC 1JFIA 1EQZA 3X1VC 4H9OA 3REIC 1M19B 3TU4C 3LZ0A 5AY8B 4H9NA 3AZED 3UT9C 1H3OB 3B6FB 5C3IB 4G91C 3W96B 5B40D 5GXQB 5CPJC 3UTBA 1ID3B 1AOIB 1Q9CA 3LELB 4DRAA 5AVBA 1B67A 3MGPC 5F99C 4KUDD 5KDMB 4R8PA 5B0ZA 2CV5D 3AYWB 5E5AB 2FJ7D 4ZBJC 5CPKB 3WAAC 3C1CB 3X1SC 1M18B 1P34C 5B31G 1P3AC 1TZYB 3WKJD 5DNNC 5JA4B 4R8PC 2NQBA 5AV9B 5GT3C 4YM6D 3KUYA 4J8WB 3AFAC 3LJAA 1P3PA 3NQJB 1F66D 4WNNB 5AV6C 3W98D 4J8UD 3V9RB 5B33C 4KGCC 4AWLC 3O62C 5GSUC 3KWQC 3LJAC 3VH6W 3MGSC 1P3OB 3AZFC 3REKB 3VH5T 4Z66B 3X1UB 3X1TB 5B0YB 3W97D 5CP6A 1P3KB 4WU8D 2BYMB 1M1AB 3REJD 4WU9B 3KXBA 5AV8C 5B2JD 3AZMA 2HUEC 5B1MD 3AZID 3AV1A 3UTAA 1S32D 5B2IC 4H9QA 3AV2D 4XZQD 5JRGB 3AZGA 4JJNC 3A6NB 4CAYB 1F66A 2YFWA 3AZLD 2HIOD 4Z5TD 5DNMD 1HTAA 3LZ1C 3AZEB
chains in the Genus database with same CATH superfamily
1P3LD 5BT1C 3AZHC 3AN2D 4YS3A 5B24A 3X1VD 1U35D 3WTPA 1P3BB 3REHD 2PYOC 2IO5C 5B1LC 4ZUXB 5GT0A 4KHAA 4KUDB 4J8VA 4G92C 1EQZD 3A1IA 1P3GA 2FJ7B 4NE5A 1ZLAA 3B6GB 5B31C 2NZDC 3LZ0D 3MGPD 1P3IC 2BYKB 3B0DC 3W99C 4DRBA 1KX3C 5BNXA 3MNNB 1HQ3C 2AROB 3C1BC 3AZKA 4QLCC 3WKJB 3VH5W 3UTBD 5BS7C 3AZNA 3AV2A 5B32C 5AVBD 1KX4B 4J8XB 3AZJB 4YM6B 1ZLAC 4H9SC 4LD9C 3MGRC 4HGAC 4R8PD 5B0ZD 3AZKC 3EPHA 3W98B 1KX5C 4J8UB 3AZLA 3AFAD 3RELB 2FFFB 4H9PB 2ZM5A 3MVDC 3MGQA 5AV6D 4X23B 3WA9C 1P3FB 4XUJC 2NQBD 2F8NA 3R45B 3REIA 3VH6T 2BG1A 3TU4A 4EO5B 5AVCC 3KUYD 3UT9A 3LJAD 4WJ3C 1P3PD 4NE3A 4H9RB 4WU8B 5CPJA 1M19C 1TAFB 5AY8C 2XD5A 3REJB 3MGPA 5E5AA 5F99A 3B6FC 1BH9A 5C3IC 5B2JB 3W96C 4DQYB 2YFVA 5GXQC 5CPKA 1ID3C 1S32B 1AOIC 3LELC 4XZQB 3WAAA 3X1SA 1KU5A 1P34A 1P3AA 5BNVA 3AYWC 5E5AC 5B2ID 5DNNA 5CP6D 5AV5B 4WV4B 3B0CT 5CPKC 2HIOB 4Z5TB 5DNMB 3C1CC 1M18C 5GT3A 3AFAA 1TZYC 3KXBD 3AZMD 2L5AA 3AN2B 1P3LB 3AV1D 2G5IC 5AV6A 3UTAD 5AV9C 5B33A 4J8WC 4KGCA 3AZHD 3O62A 2RIQA 3AZGD 1WWIA 2JSSA 5G49A 5GSUA 3KWQA 3REKA 1P3MB 4UUZB 3MGSA 1JFIB 1EQZB 3AZFA 4H9OB 3LZ0B 2ZY5A 2XD1A 4H9NB 2G5HC 4YS3D 5B24D 1P3OC 2CWEA 3REKC 4Z66C 3X1UC 3WTPD 2NZDD 5CPIC 3UTBB 3X1TC 3C1BD 5B0YC 5AVBB 5CPIB 5AV8A 1P3KC 5GT0D 3WTPE 4J8VD 5B0ZB 5B2IA 1M1AC 1P3GD 5B32D 5FUGA 1ZLAD 4WU9C 4NE6A 4JJNA 3AZKD 2NQBB 5JRGC 3LZ1A 1R4VA 2RVQC 3AZND 2J8PA 3A6NC 3KUYB 3AZHA 1BFMA 1P3PB 3B0CW 2PYOA 3AZEC 5B1LA 2Y2QA 3MGQD 3VH6A 1P3BC 5AY8D 2F8ND 3REID 3H0MC 5BO0A 5B31A 3TU4D 5B40B 1P3IA 2NZDA 1PZRA 3W99A 4ZUXC 1KX3A 3C1BA 1HQ3A 3UT9D 4KUDC 1N1JA 5GXQD 2CV5C 1ID3D 3NQUA 3H0RC 4QLCA 2LY8A 5CP6B 2FJ7C 5CPJD 4J8XA 2CV5B 3B6GC 5BS7A 1T3UA 5B32A 2Y2GA 3MNNC 2AROC 1BH8A 4H9SA 5E5AD 4LD9A 5F99D 3MGRA 3KXBB 3AZMB 3WKJC 3AV1B 5CPKD 3RELA 3UTAB 1KX5A 3C1CD 1M18D 1KX4C 4H9QB 4J8XC 3AZJC 4YM6C 3WAAD 3X1SD 4X23A 1P34D 2Y2PA 3AZGB 1P3AD 3MVDA 3WA9A 5DNND 3W98C 4XUJA 4J8UC 1F66B 3B0BA 2YFWB 3RELC 5GT3D 1F1EA 5AVCA 4X23C 3KFUG 4YS3B 1P3FC 5B24B 2ZY2A 1M19A 3WTPB 4EO5C 5AY8A 5B33D 4KGCD 1H3OA 3B6FA 3O62D 1P3OD 3F6TA 3W96A 1ULYA 5GSUD 4KHAB 5GT0B 5CHLB 5GXQA 3KWQD 3MGSD 4J8VB 3REKD 4WU8C 1ID3A 4UPKA 1AOIA 3LELA 3AZFD 3W97B 1P3GB 3REJC 4CSRB 3H0LC 5KDMA 5B2JC 3AYWA 1S32C 5B1MB 3VH5A 3AZIB 4XZQC 3C1CA 1M18A 3AZNB 3AV2B 3KSYA 1TZYA 5AV8D 5AV5C 5JA4A 5AV9A 2HIOC 4Z5TC 5DNMC 2RVQD 4J8WA 4E44A 3AZLB 4UUZA 2Y2MA 3NQJA 1P3LC 3AN2C 4JJND 4WNNA 3MGQB 1U35C 3V9RA 3REHC 3X1VB 2F8NB 3REIB 1U35B 2F8NK 4Z2MH 3LZ1D 3REHB 4E45A 3TU4B 5BT1D 3UT9B 1P3MC 1P3BD 1EQZC 1P3OA 4G91B 4Z66A 3X1UA 5CPIA 5CPJB 2PYOD 3X1TA 3LZ0C 2Y2IA 4ZUXD 2DF4C 5B0YA 5B1LD 4Z2MG 3MGPB 1P3KA 5F99B 1BH9B 3B6GD 2BYMA 2YFVB 3UTBC 1M1AA 4ZBJB 4WZSB 3MNND 2AROD 5AVBC 5B31D 4WU9A 1P3ID 3W99D 3X1SB 3WAAB 1KX3D 1HQ3D 1P34B 1P3AB 1A7WA 5B0ZC 5BNVB 4QLCD 5DNNB 1KX4D 4R8PB 4J8XD 3AZJD 5JRGA 3A6NA 5GT3B 5B32G 3AFAB 4LD9D 4CAYA 3MGRD 3EPLA 2NQBC 3RELD 5AV6B 3AL0C 1KX5D 3AZEA 5B33B 3KUYC 4X23D 4KGCB 4AWLB 1P3FD 3O62B 1P3PC 3MVDD 5G49B 5GSUB 3LJAB 5B40A 3KWQB 1P3BA 3WA9D 4XUJD 3MGSB 3EG5B 2F8NH 3AZFB 4ZUXA 5AVCD 4KUDA 2CV5A 2FJ7A 3B6GA 1M19D 5B40C 2BYKA 2F8NG 3MNNA 2AROA 2Y2HA 4M6BA 2Y2LA 3B6FD 5AV8B 3WKJA 2W8SA 2HUEB 5CP6C 3W96D 1AOID 5B2IB 3LELD 1KX4A 2JE5A 2VQRA 3AZJA 4YM6A 5FUGB 5AV5D 3KXBC 3AZMC 4JJNB 3AYWD 3AV1C 3UTAC 3W98A 4J8UA 4H9PA 3LZ1B 3AZGC 1W2EA 1TZYD 3EPKA 3AZHB 1P3FA 3R45A 2ZY4A 1F66C 5AV9D 4J8WD 2PYOB 2IO5B 1P3MD 3W97A 5B1LB 4YS3C 4H9RA 1WWSA 5B24C 4WU8A 1TAFA 4G92B 3WTPC 2JCHA 4CSRA 2Y2JA 3REJA 5BO0B 5B31B 2NZDB 1P3IB 5B2JA 3B0DB 3W99B 1KX3B 5B1MA 5GT0C 1HQ3B 3C1BB 4J8VC 3AZIA 3W97C 1S32A 1N1JB 3NQUB 1B6WA 4QLCB 4Z66D 1P3GC 3X1UD 2UWXA 4XZQA 5CPID 3X1TD 5B32B 5B0YD 2Y2KA 1ZLAB 1BH8B 5AV5A 1P3KD 4LD9B 3MGRB 4HGAB 5B1MC 2F2AC 5BNXB 4NFTA 3AZKB 2HIOA 4Z5TA 5DNMA 3AZIC 1M1AD 1KX5B 3AZNC 3AV2C 4WU9D 1P3LA 3AN2A 3X1VA 3MVDB 1U35A 3WA9B 3REHA 4XUJB 3AZLC 5JRGD 3IP4C 3A6ND 5AVCB 2Y2NA 1P3MA 3MGQC 1JFIA 1EQZA 3X1VC 4H9OA 3REIC 1M19B 3TU4C 3LZ0A 1Z2CB 5AY8B 4H9NA 3AZED 3UT9C 1H3OB 3B6FB 5C3IB 4G91C 3W96B 5B40D 5GXQB 5CPJC 3UTBA 1ID3B 1AOIB 1Q9CA 3LELB 4DRAA 5AVBA 3A1KA 1B67A 3FDDA 3P5JB 3MGPC 5F99C 4KUDD 3EPJA 5KDMB 4R8PA 5B0ZA 2CV5D 3AYWB 5E5AB 2FJ7D 4ZBJC 5CPKB 3WAAC 3C1CB 3X1SC 1M18B 1P34C 5B31G 1P3AC 1TZYB 3WKJD 5DNNC 5JA4B 4R8PC 2NQBA 5AV9B 5GT3C 4YM6D 3KUYA 4J8WB 3AFAC 3LJAA 1P3PA 3NQJB 1F66D 4WNNB 5AV6C 3W98D 4J8UD 3V9RB 5B33C 4KGCC 4AWLC 3O62C 5GSUC 3KWQC 3LJAC 3VH6W 3MGSC 1P3OB 3AZFC 3REKB 3VH5T 4Z66B 3X1UB 3X1TB 5B0YB 3W97D 5CP6A 1P3KB 4WU8D 2ZY3A 2BYMB 1M1AB 2DQNC 3REJD 4WU9B 3KXBA 5AV8C 5B2JD 3AZMA 2HUEC 5B1MD 3AZID 3AV1A 3UTAA 1S32D 5B2IC 4H9QA 3AV2D 4XZQD 5JRGB 3AZGA 4JJNC 3A6NB 2Y2OA 4CAYB 1F66A 2YFWA 3AZLD 2HIOD 4Z5TD 5DNMD 1HTAA 3LZ1C 3AZEB
chains in the Genus database with same CATH topology
1P3LD 5BT1C 3AZHC 3AN2D 4YS3A 5B24A 3X1VD 1U35D 3WTPA 1P3BB 3REHD 2PYOC 2IO5C 5B1LC 4ZUXB 5GT0A 4KHAA 4KUDB 4J8VA 4G92C 1EQZD 3A1IA 1P3GA 2FJ7B 4NE5A 1ZLAA 3B6GB 5B31C 2NZDC 3LZ0D 3MGPD 1P3IC 2BYKB 3B0DC 3W99C 4DRBA 1KX3C 5BNXA 3MNNB 1HQ3C 2AROB 3C1BC 3AZKA 4QLCC 3WKJB 3VH5W 3UTBD 5BS7C 3AZNA 3AV2A 5B32C 5AVBD 1KX4B 4J8XB 3AZJB 4YM6B 1ZLAC 4H9SC 4LD9C 3MGRC 4HGAC 4R8PD 5B0ZD 3AZKC 3EPHA 3W98B 1KX5C 4J8UB 3AZLA 3AFAD 3RELB 2FFFB 4H9PB 2ZM5A 3MVDC 3MGQA 5AV6D 4X23B 3WA9C 1P3FB 4XUJC 2NQBD 2F8NA 3R45B 3REIA 3VH6T 2BG1A 3TU4A 4EO5B 5AVCC 3KUYD 3UT9A 3LJAD 4WJ3C 1P3PD 4NE3A 4H9RB 4WU8B 5CPJA 1M19C 1TAFB 5AY8C 2XD5A 3REJB 3MGPA 5E5AA 5F99A 3B6FC 1BH9A 5C3IC 5B2JB 3W96C 4DQYB 2YFVA 5GXQC 5CPKA 1ID3C 1S32B 1AOIC 3LELC 4XZQB 3WAAA 3X1SA 1KU5A 1P34A 1P3AA 5BNVA 3AYWC 5E5AC 5B2ID 5DNNA 5CP6D 5AV5B 4WV4B 3B0CT 5CPKC 2HIOB 4Z5TB 5DNMB 3C1CC 1M18C 5GT3A 3AFAA 1TZYC 3KXBD 3AZMD 2L5AA 3AN2B 1P3LB 3AV1D 2G5IC 5AV6A 3UTAD 5AV9C 5B33A 4J8WC 4KGCA 3AZHD 3O62A 2RIQA 3AZGD 1WWIA 2JSSA 5G49A 5GSUA 3KWQA 3REKA 1P3MB 4UUZB 3MGSA 1JFIB 1EQZB 3AZFA 4H9OB 3LZ0B 2ZY5A 2XD1A 4H9NB 2G5HC 4YS3D 5B24D 1P3OC 2CWEA 3REKC 4Z66C 3X1UC 3WTPD 2NZDD 5CPIC 3UTBB 3X1TC 3C1BD 5B0YC 5AVBB 5CPIB 5AV8A 1P3KC 5GT0D 3WTPE 4J8VD 5B0ZB 5B2IA 1M1AC 1P3GD 5B32D 5FUGA 1ZLAD 4WU9C 4NE6A 4JJNA 3AZKD 2NQBB 5JRGC 3LZ1A 1R4VA 2RVQC 3AZND 2J8PA 3A6NC 3KUYB 3AZHA 1BFMA 1P3PB 3B0CW 2PYOA 3AZEC 5B1LA 2Y2QA 3MGQD 3VH6A 1P3BC 5AY8D 2F8ND 3REID 3H0MC 5BO0A 5B31A 3TU4D 5B40B 1P3IA 2NZDA 1PZRA 3W99A 4ZUXC 1KX3A 3C1BA 1HQ3A 3UT9D 4KUDC 1N1JA 5GXQD 2CV5C 1ID3D 3NQUA 3H0RC 4QLCA 2LY8A 5CP6B 2FJ7C 5CPJD 4J8XA 2CV5B 3B6GC 5BS7A 1T3UA 5B32A 2Y2GA 3MNNC 2AROC 1BH8A 4H9SA 5E5AD 4LD9A 5F99D 3MGRA 3KXBB 3AZMB 3WKJC 3AV1B 5CPKD 3RELA 3UTAB 1KX5A 3C1CD 1M18D 1KX4C 4H9QB 4J8XC 3AZJC 4YM6C 3WAAD 3X1SD 4X23A 1P34D 2Y2PA 3AZGB 1P3AD 3MVDA 3WA9A 5DNND 3W98C 4XUJA 4J8UC 1F66B 3B0BA 2YFWB 3RELC 5GT3D 1F1EA 5AVCA 4X23C 3KFUG 4YS3B 1P3FC 5B24B 2ZY2A 1M19A 3WTPB 4EO5C 5AY8A 5B33D 4KGCD 1H3OA 3B6FA 3O62D 1P3OD 3F6TA 3W96A 1ULYA 5GSUD 4KHAB 5GT0B 5CHLB 5GXQA 3KWQD 3MGSD 4J8VB 3REKD 4WU8C 1ID3A 4UPKA 1AOIA 3LELA 3AZFD 3W97B 1P3GB 3REJC 4CSRB 3H0LC 5KDMA 5B2JC 3AYWA 1S32C 5B1MB 3VH5A 3AZIB 4XZQC 3C1CA 1M18A 3AZNB 3AV2B 3KSYA 1TZYA 5AV8D 5AV5C 5JA4A 5AV9A 2HIOC 4Z5TC 5DNMC 2RVQD 4J8WA 4E44A 3AZLB 4UUZA 2Y2MA 3NQJA 1P3LC 3AN2C 4JJND 4WNNA 3MGQB 1U35C 3V9RA 3REHC 3X1VB 2F8NB 3REIB 1U35B 2F8NK 4Z2MH 3LZ1D 3REHB 4E45A 3TU4B 5BT1D 3UT9B 1P3MC 1P3BD 1EQZC 1P3OA 4G91B 4Z66A 3X1UA 5CPIA 5CPJB 2PYOD 3X1TA 3LZ0C 2Y2IA 4ZUXD 2DF4C 5B0YA 5B1LD 4Z2MG 3MGPB 1P3KA 5F99B 1BH9B 3B6GD 2BYMA 2YFVB 3UTBC 1M1AA 4ZBJB 4WZSB 3MNND 2AROD 5AVBC 5B31D 4WU9A 1P3ID 3W99D 3X1SB 3WAAB 1KX3D 1HQ3D 1P34B 1P3AB 1A7WA 5B0ZC 5BNVB 4QLCD 5DNNB 1KX4D 4R8PB 4J8XD 3AZJD 5JRGA 3A6NA 5GT3B 5B32G 3AFAB 4LD9D 4CAYA 3MGRD 3EPLA 2NQBC 3RELD 5AV6B 3AL0C 1KX5D 3AZEA 5B33B 3KUYC 4X23D 4KGCB 4AWLB 1P3FD 3O62B 1P3PC 3MVDD 5G49B 5GSUB 3LJAB 5B40A 3KWQB 1P3BA 3WA9D 4XUJD 3MGSB 3EG5B 2F8NH 3AZFB 4ZUXA 5AVCD 4KUDA 2CV5A 2FJ7A 3B6GA 1M19D 5B40C 2BYKA 2F8NG 3MNNA 2AROA 2Y2HA 4M6BA 2Y2LA 3B6FD 5AV8B 3WKJA 2W8SA 2HUEB 5CP6C 3W96D 1AOID 5B2IB 3LELD 1KX4A 2JE5A 2VQRA 3AZJA 4YM6A 5FUGB 5AV5D 3KXBC 3AZMC 4JJNB 3AYWD 3AV1C 3UTAC 3W98A 4J8UA 4H9PA 3LZ1B 3AZGC 1W2EA 1TZYD 3EPKA 3AZHB 1P3FA 3R45A 2ZY4A 1F66C 5AV9D 4J8WD 2PYOB 2IO5B 1P3MD 3W97A 5B1LB 4YS3C 4H9RA 1WWSA 5B24C 4WU8A 1TAFA 4G92B 3WTPC 2JCHA 4CSRA 2Y2JA 3REJA 5BO0B 5B31B 2NZDB 1P3IB 5B2JA 3B0DB 3W99B 1KX3B 5B1MA 5GT0C 1HQ3B 3C1BB 4J8VC 3AZIA 3W97C 1S32A 1N1JB 3NQUB 1B6WA 4QLCB 4Z66D 1P3GC 3X1UD 2UWXA 4XZQA 5CPID 3X1TD 5B32B 5B0YD 2Y2KA 1ZLAB 1BH8B 5AV5A 1P3KD 4LD9B 3MGRB 4HGAB 5B1MC 2F2AC 5BNXB 4NFTA 3AZKB 2HIOA 4Z5TA 5DNMA 3AZIC 1M1AD 1KX5B 3AZNC 3AV2C 4WU9D 1P3LA 3AN2A 3X1VA 3MVDB 1U35A 3WA9B 3REHA 4XUJB 3AZLC 5JRGD 3IP4C 3A6ND 5AVCB 2Y2NA 1P3MA 3MGQC 1JFIA 1EQZA 3X1VC 4H9OA 3REIC 1M19B 3TU4C 3LZ0A 1Z2CB 5AY8B 4H9NA 3AZED 3UT9C 1H3OB 3B6FB 5C3IB 4G91C 3W96B 5B40D 5GXQB 5CPJC 3UTBA 1ID3B 1AOIB 1Q9CA 3LELB 4DRAA 5AVBA 3A1KA 1B67A 3FDDA 3P5JB 3MGPC 5F99C 4KUDD 3EPJA 5KDMB 4R8PA 5B0ZA 2CV5D 3AYWB 5E5AB 2FJ7D 4ZBJC 5CPKB 3WAAC 3C1CB 3X1SC 1M18B 1P34C 5B31G 1P3AC 1TZYB 3WKJD 5DNNC 5JA4B 4R8PC 2NQBA 5AV9B 5GT3C 4YM6D 3KUYA 4J8WB 3AFAC 3LJAA 1P3PA 3NQJB 1F66D 4WNNB 5AV6C 3W98D 4J8UD 3V9RB 5B33C 4KGCC 4AWLC 3O62C 5GSUC 3KWQC 3LJAC 3VH6W 3MGSC 1P3OB 3AZFC 3REKB 3VH5T 4Z66B 3X1UB 3X1TB 5B0YB 3W97D 5CP6A 1P3KB 4WU8D 2ZY3A 2BYMB 1M1AB 2DQNC 3REJD 4WU9B 3KXBA 5AV8C 5B2JD 3AZMA 2HUEC 5B1MD 3AZID 3AV1A 3UTAA 1S32D 5B2IC 4H9QA 3AV2D 4XZQD 5JRGB 3AZGA 4JJNC 3A6NB 2Y2OA 4CAYB 1F66A 2YFWA 3AZLD 2HIOD 4Z5TD 5DNMD 1HTAA 3LZ1C 3AZEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3L D;  5BT1 C;  3AZH C;  3AN2 D;  4YS3 A;  5B24 A;  3X1V D;  1U35 D;  3WTP A;  1P3B B;  3REH D;  2PYO C;  2IO5 C;  5B1L C;  4ZUX B;  5GT0 A;  4KHA A;  4KUD B;  4J8V A;  4G92 C;  1EQZ D;  1P3G A;  2FJ7 B;  4NE5 A;  1ZLA A;  3B6G B;  5B31 C;  2NZD C;  3LZ0 D;  3MGP D;  1P3I C;  2BYK B;  3B0D C;  3W99 C;  4DRB A;  1KX3 C;  5BNX A;  3MNN B;  1HQ3 C;  2ARO B;  3C1B C;  3AZK A;  4QLC C;  3WKJ B;  3VH5 W;  3UTB D;  5BS7 C;  3AZN A;  3AV2 A;  5B32 C;  5AVB D;  1KX4 B;  4J8X B;  3AZJ B;  4YM6 B;  1ZLA C;  4H9S C;  4LD9 C;  3MGR C;  4HGA C;  4R8P D;  5B0Z D;  3AZK C;  3W98 B;  1KX5 C;  4J8U B;  3AZL A;  3AFA D;  3REL B;  4H9P B;  3MVD C;  3MGQ A;  5AV6 D;  4X23 B;  3WA9 C;  1P3F B;  4XUJ C;  2NQB D;  2F8N A;  3R45 B;  3REI A;  3VH6 T;  3TU4 A;  4EO5 B;  5AVC C;  3KUY D;  3UT9 A;  3LJA D;  1P3P D;  4NE3 A;  4H9R B;  4WU8 B;  5CPJ A;  1M19 C;  1TAF B;  5AY8 C;  3REJ B;  3MGP A;  5E5A A;  5F99 A;  3B6F C;  1BH9 A;  5C3I C;  5B2J B;  3W96 C;  2YFV A;  5GXQ C;  5CPK A;  1ID3 C;  1S32 B;  1AOI C;  3LEL C;  4XZQ B;  3WAA A;  3X1S A;  1KU5 A;  1P34 A;  1P3A A;  5BNV A;  3AYW C;  5E5A C;  5B2I D;  5DNN A;  5CP6 D;  5AV5 B;  4WV4 B;  3B0C T;  5CPK C;  2HIO B;  4Z5T B;  5DNM B;  3C1C C;  1M18 C;  5GT3 A;  3AFA A;  1TZY C;  3KXB D;  3AZM D;  2L5A A;  3AN2 B;  1P3L B;  3AV1 D;  5AV6 A;  3UTA D;  5AV9 C;  5B33 A;  4J8W C;  4KGC A;  3AZH D;  3O62 A;  3AZG D;  1WWI A;  2JSS A;  5G49 A;  5GSU A;  3KWQ A;  3REK A;  1P3M B;  4UUZ B;  3MGS A;  1JFI B;  1EQZ B;  3AZF A;  4H9O B;  3LZ0 B;  4H9N B;  4YS3 D;  5B24 D;  1P3O C;  2CWE A;  3REK C;  4Z66 C;  3X1U C;  3WTP D;  2NZD D;  5CPI C;  3UTB B;  3X1T C;  3C1B D;  5B0Y C;  5AVB B;  5CPI B;  5AV8 A;  1P3K C;  3WTP E;  5GT0 D;  4J8V D;  5B0Z B;  5B2I A;  1M1A C;  1P3G D;  5B32 D;  5FUG A;  1ZLA D;  4WU9 C;  4NE6 A;  4JJN A;  3AZK D;  2NQB B;  5JRG C;  3LZ1 A;  1R4V A;  2RVQ C;  3AZN D;  3A6N C;  3KUY B;  3AZH A;  1BFM A;  1P3P B;  3B0C W;  2PYO A;  3AZE C;  5B1L A;  3MGQ D;  3VH6 A;  1P3B C;  5AY8 D;  2F8N D;  3REI D;  5BO0 A;  5B31 A;  3TU4 D;  5B40 B;  1P3I A;  2NZD A;  3W99 A;  4ZUX C;  1KX3 A;  3C1B A;  1HQ3 A;  3UT9 D;  4KUD C;  1N1J A;  5GXQ D;  2CV5 C;  1ID3 D;  3NQU A;  4QLC A;  2LY8 A;  5CP6 B;  2FJ7 C;  5CPJ D;  4J8X A;  2CV5 B;  3B6G C;  5BS7 A;  5B32 A;  3MNN C;  2ARO C;  1BH8 A;  4H9S A;  5E5A D;  4LD9 A;  5F99 D;  3MGR A;  3KXB B;  3AZM B;  3WKJ C;  3AV1 B;  5CPK D;  3REL A;  3UTA B;  1KX5 A;  3C1C D;  1M18 D;  1KX4 C;  4H9Q B;  4J8X C;  3AZJ C;  4YM6 C;  3WAA D;  3X1S D;  4X23 A;  1P34 D;  3AZG B;  1P3A D;  3MVD A;  3WA9 A;  5DNN D;  3W98 C;  4XUJ A;  4J8U C;  1F66 B;  3B0B A;  2YFW B;  3REL C;  5GT3 D;  1F1E A;  5AVC A;  4X23 C;  4YS3 B;  1P3F C;  5B24 B;  1M19 A;  3WTP B;  4EO5 C;  5AY8 A;  5B33 D;  4KGC D;  1H3O A;  3B6F A;  3O62 D;  1P3O D;  3W96 A;  1ULY A;  5GSU D;  4KHA B;  5GT0 B;  5CHL B;  5GXQ A;  3KWQ D;  3MGS D;  4J8V B;  3REK D;  4WU8 C;  1ID3 A;  1AOI A;  3W97 B;  3LEL A;  3AZF D;  1P3G B;  3REJ C;  4CSR B;  5KDM A;  5B2J C;  3AYW A;  1S32 C;  5B1M B;  3VH5 A;  3AZI B;  4XZQ C;  3C1C A;  1M18 A;  3AZN B;  3AV2 B;  3KSY A;  1TZY A;  5AV8 D;  5AV5 C;  5JA4 A;  5AV9 A;  2HIO C;  4Z5T C;  5DNM C;  2RVQ D;  4J8W A;  4E44 A;  3AZL B;  4UUZ A;  3NQJ A;  1P3L C;  3AN2 C;  4JJN D;  4WNN A;  3MGQ B;  1U35 C;  3V9R A;  3REH C;  3X1V B;  2F8N B;  3REI B;  1U35 B;  2F8N K;  4Z2M H;  3LZ1 D;  3REH B;  4E45 A;  3TU4 B;  5BT1 D;  3UT9 B;  1P3M C;  1P3B D;  1EQZ C;  1P3O A;  4G91 B;  4Z66 A;  3X1U A;  5CPI A;  5CPJ B;  2PYO D;  3X1T A;  3LZ0 C;  4ZUX D;  5B0Y A;  5B1L D;  4Z2M G;  3MGP B;  1P3K A;  5F99 B;  1BH9 B;  3B6G D;  2BYM A;  2YFV B;  3UTB C;  1M1A A;  4ZBJ B;  4WZS B;  3MNN D;  2ARO D;  5AVB C;  5B31 D;  4WU9 A;  1P3I D;  3W99 D;  3X1S B;  3WAA B;  1KX3 D;  1HQ3 D;  1P34 B;  1P3A B;  1A7W A;  5B0Z C;  5BNV B;  4QLC D;  5DNN B;  1KX4 D;  4R8P B;  4J8X D;  3AZJ D;  5JRG A;  3A6N A;  5GT3 B;  5B32 G;  3AFA B;  4LD9 D;  4CAY A;  3MGR D;  2NQB C;  3REL D;  5AV6 B;  1KX5 D;  3AZE A;  5B33 B;  3KUY C;  4X23 D;  4KGC B;  4AWL B;  1P3F D;  3O62 B;  1P3P C;  3MVD D;  5G49 B;  5GSU B;  3LJA B;  5B40 A;  3KWQ B;  1P3B A;  3WA9 D;  4XUJ D;  3MGS B;  2F8N H;  3AZF B;  4ZUX A;  5AVC D;  4KUD A;  2CV5 A;  2FJ7 A;  3B6G A;  1M19 D;  5B40 C;  2BYK A;  2F8N G;  3MNN A;  2ARO A;  4M6B A;  3B6F D;  5AV8 B;  3WKJ A;  2HUE B;  5CP6 C;  3W96 D;  1AOI D;  5B2I B;  3LEL D;  1KX4 A;  3AZJ A;  4YM6 A;  5FUG B;  5AV5 D;  3KXB C;  3AZM C;  4JJN B;  3AYW D;  3AV1 C;  3UTA C;  3W98 A;  4J8U A;  4H9P A;  3LZ1 B;  3AZG C;  1TZY D;  3AZH B;  1P3F A;  3R45 A;  1F66 C;  5AV9 D;  4J8W D;  2PYO B;  2IO5 B;  1P3M D;  3W97 A;  5B1L B;  4YS3 C;  4H9R A;  1WWS A;  5B24 C;  4WU8 A;  1TAF A;  4G92 B;  3WTP C;  4CSR A;  3REJ A;  5BO0 B;  5B31 B;  2NZD B;  1P3I B;  5B2J A;  3B0D B;  3W99 B;  1KX3 B;  5B1M A;  5GT0 C;  1HQ3 B;  3C1B B;  4J8V C;  3AZI A;  3W97 C;  1S32 A;  1N1J B;  3NQU B;  1B6W A;  4QLC B;  4Z66 D;  1P3G C;  3X1U D;  4XZQ A;  5CPI D;  3X1T D;  5B32 B;  5B0Y D;  1ZLA B;  1BH8 B;  5AV5 A;  1P3K D;  4LD9 B;  3MGR B;  4HGA B;  5B1M C;  5BNX B;  3AZK B;  4NFT A;  3AZI C;  2HIO A;  4Z5T A;  5DNM A;  1M1A D;  1KX5 B;  3AZN C;  3AV2 C;  4WU9 D;  1P3L A;  3AN2 A;  3X1V A;  3MVD B;  1U35 A;  3WA9 B;  3REH A;  4XUJ B;  3AZL C;  5JRG D;  3A6N D;  5AVC B;  1P3M A;  3MGQ C;  1JFI A;  1EQZ A;  3X1V C;  4H9O A;  3REI C;  1M19 B;  3TU4 C;  3LZ0 A;  5AY8 B;  4H9N A;  3AZE D;  3UT9 C;  1H3O B;  3B6F B;  5C3I B;  4G91 C;  3W96 B;  5B40 D;  5GXQ B;  5CPJ C;  3UTB A;  1ID3 B;  1AOI B;  1Q9C A;  3LEL B;  4DRA A;  5AVB A;  1B67 A;  3MGP C;  5F99 C;  4KUD D;  5KDM B;  4R8P A;  5B0Z A;  2CV5 D;  3AYW B;  5E5A B;  2FJ7 D;  4ZBJ C;  5CPK B;  3WAA C;  3C1C B;  3X1S C;  1M18 B;  1P34 C;  5B31 G;  1P3A C;  1TZY B;  3WKJ D;  5DNN C;  5JA4 B;  4R8P C;  2NQB A;  5AV9 B;  5GT3 C;  4YM6 D;  3KUY A;  4J8W B;  3AFA C;  3LJA A;  1P3P A;  3NQJ B;  1F66 D;  4WNN B;  5AV6 C;  3W98 D;  4J8U D;  3V9R B;  5B33 C;  4KGC C;  4AWL C;  3O62 C;  5GSU C;  3KWQ C;  3LJA C;  3VH6 W;  3MGS C;  1P3O B;  3AZF C;  3REK B;  3VH5 T;  4Z66 B;  3X1U B;  3X1T B;  5B0Y B;  3W97 D;  5CP6 A;  1P3K B;  4WU8 D;  2BYM B;  1M1A B;  3REJ D;  4WU9 B;  3KXB A;  5AV8 C;  5B2J D;  3AZM A;  2HUE C;  5B1M D;  3AZI D;  3AV1 A;  3UTA A;  1S32 D;  5B2I C;  4H9Q A;  3AV2 D;  4XZQ D;  5JRG B;  3AZG A;  4JJN C;  3A6N B;  4CAY B;  1F66 A;  2YFW A;  3AZL D;  2HIO D;  4Z5T D;  5DNM D;  1HTA A;  3LZ1 C;  3AZE B; 
#chains in the Genus database with same CATH topology
 1P3L D;  5BT1 C;  3AZH C;  3AN2 D;  4YS3 A;  5B24 A;  3X1V D;  1U35 D;  3WTP A;  1P3B B;  3REH D;  2PYO C;  2IO5 C;  5B1L C;  4ZUX B;  5GT0 A;  4KHA A;  4KUD B;  4J8V A;  4G92 C;  1EQZ D;  3A1I A;  1P3G A;  2FJ7 B;  4NE5 A;  1ZLA A;  3B6G B;  5B31 C;  2NZD C;  3LZ0 D;  3MGP D;  1P3I C;  2BYK B;  3B0D C;  3W99 C;  4DRB A;  1KX3 C;  5BNX A;  3MNN B;  1HQ3 C;  2ARO B;  3C1B C;  3AZK A;  4QLC C;  3WKJ B;  3VH5 W;  3UTB D;  5BS7 C;  3AZN A;  3AV2 A;  5B32 C;  5AVB D;  1KX4 B;  4J8X B;  3AZJ B;  4YM6 B;  1ZLA C;  4H9S C;  4LD9 C;  3MGR C;  4HGA C;  4R8P D;  5B0Z D;  3AZK C;  3EPH A;  3W98 B;  1KX5 C;  4J8U B;  3AZL A;  3AFA D;  3REL B;  2FFF B;  4H9P B;  2ZM5 A;  3MVD C;  3MGQ A;  5AV6 D;  4X23 B;  3WA9 C;  1P3F B;  4XUJ C;  2NQB D;  2F8N A;  3R45 B;  3REI A;  3VH6 T;  2BG1 A;  3TU4 A;  4EO5 B;  5AVC C;  3KUY D;  3UT9 A;  3LJA D;  4WJ3 C;  1P3P D;  4NE3 A;  4H9R B;  4WU8 B;  5CPJ A;  1M19 C;  1TAF B;  5AY8 C;  2XD5 A;  3REJ B;  3MGP A;  5E5A A;  5F99 A;  3B6F C;  1BH9 A;  5C3I C;  5B2J B;  3W96 C;  4DQY B;  2YFV A;  5GXQ C;  5CPK A;  1ID3 C;  1S32 B;  1AOI C;  3LEL C;  4XZQ B;  3WAA A;  3X1S A;  1KU5 A;  1P34 A;  1P3A A;  5BNV A;  3AYW C;  5E5A C;  5B2I D;  5DNN A;  5CP6 D;  5AV5 B;  4WV4 B;  3B0C T;  5CPK C;  2HIO B;  4Z5T B;  5DNM B;  3C1C C;  1M18 C;  5GT3 A;  3AFA A;  1TZY C;  3KXB D;  3AZM D;  2L5A A;  3AN2 B;  1P3L B;  3AV1 D;  2G5I C;  5AV6 A;  3UTA D;  5AV9 C;  5B33 A;  4J8W C;  4KGC A;  3AZH D;  3O62 A;  2RIQ A;  3AZG D;  1WWI A;  2JSS A;  5G49 A;  5GSU A;  3KWQ A;  3REK A;  1P3M B;  4UUZ B;  3MGS A;  1JFI B;  1EQZ B;  3AZF A;  4H9O B;  3LZ0 B;  2ZY5 A;  2XD1 A;  4H9N B;  2G5H C;  4YS3 D;  5B24 D;  1P3O C;  2CWE A;  3REK C;  4Z66 C;  3X1U C;  3WTP D;  2NZD D;  5CPI C;  3UTB B;  3X1T C;  3C1B D;  5B0Y C;  5AVB B;  5CPI B;  5AV8 A;  1P3K C;  5GT0 D;  3WTP E;  4J8V D;  5B0Z B;  5B2I A;  1M1A C;  1P3G D;  5B32 D;  5FUG A;  1ZLA D;  4WU9 C;  4NE6 A;  4JJN A;  3AZK D;  2NQB B;  5JRG C;  3LZ1 A;  1R4V A;  2RVQ C;  3AZN D;  2J8P A;  3A6N C;  3KUY B;  3AZH A;  1BFM A;  1P3P B;  3B0C W;  2PYO A;  3AZE C;  5B1L A;  2Y2Q A;  3MGQ D;  3VH6 A;  1P3B C;  5AY8 D;  2F8N D;  3REI D;  3H0M C;  5BO0 A;  5B31 A;  3TU4 D;  5B40 B;  1P3I A;  2NZD A;  1PZR A;  3W99 A;  4ZUX C;  1KX3 A;  3C1B A;  1HQ3 A;  3UT9 D;  4KUD C;  1N1J A;  5GXQ D;  2CV5 C;  1ID3 D;  3NQU A;  3H0R C;  4QLC A;  2LY8 A;  5CP6 B;  2FJ7 C;  5CPJ D;  4J8X A;  2CV5 B;  3B6G C;  5BS7 A;  1T3U A;  5B32 A;  2Y2G A;  3MNN C;  2ARO C;  1BH8 A;  4H9S A;  5E5A D;  4LD9 A;  5F99 D;  3MGR A;  3KXB B;  3AZM B;  3WKJ C;  3AV1 B;  5CPK D;  3REL A;  3UTA B;  1KX5 A;  3C1C D;  1M18 D;  1KX4 C;  4H9Q B;  4J8X C;  3AZJ C;  4YM6 C;  3WAA D;  3X1S D;  4X23 A;  1P34 D;  2Y2P A;  3AZG B;  1P3A D;  3MVD A;  3WA9 A;  5DNN D;  3W98 C;  4XUJ A;  4J8U C;  1F66 B;  3B0B A;  2YFW B;  3REL C;  5GT3 D;  1F1E A;  5AVC A;  4X23 C;  3KFU G;  4YS3 B;  1P3F C;  5B24 B;  2ZY2 A;  1M19 A;  3WTP B;  4EO5 C;  5AY8 A;  5B33 D;  4KGC D;  1H3O A;  3B6F A;  3O62 D;  1P3O D;  3F6T A;  3W96 A;  1ULY A;  5GSU D;  4KHA B;  5GT0 B;  5CHL B;  5GXQ A;  3KWQ D;  3MGS D;  4J8V B;  3REK D;  4WU8 C;  1ID3 A;  4UPK A;  1AOI A;  3LEL A;  3AZF D;  3W97 B;  1P3G B;  3REJ C;  4CSR B;  3H0L C;  5KDM A;  5B2J C;  3AYW A;  1S32 C;  5B1M B;  3VH5 A;  3AZI B;  4XZQ C;  3C1C A;  1M18 A;  3AZN B;  3AV2 B;  3KSY A;  1TZY A;  5AV8 D;  5AV5 C;  5JA4 A;  5AV9 A;  2HIO C;  4Z5T C;  5DNM C;  2RVQ D;  4J8W A;  4E44 A;  3AZL B;  4UUZ A;  2Y2M A;  3NQJ A;  1P3L C;  3AN2 C;  4JJN D;  4WNN A;  3MGQ B;  1U35 C;  3V9R A;  3REH C;  3X1V B;  2F8N B;  3REI B;  1U35 B;  2F8N K;  4Z2M H;  3LZ1 D;  3REH B;  4E45 A;  3TU4 B;  5BT1 D;  3UT9 B;  1P3M C;  1P3B D;  1EQZ C;  1P3O A;  4G91 B;  4Z66 A;  3X1U A;  5CPI A;  5CPJ B;  2PYO D;  3X1T A;  3LZ0 C;  2Y2I A;  4ZUX D;  2DF4 C;  5B0Y A;  5B1L D;  4Z2M G;  3MGP B;  1P3K A;  5F99 B;  1BH9 B;  3B6G D;  2BYM A;  2YFV B;  3UTB C;  1M1A A;  4ZBJ B;  4WZS B;  3MNN D;  2ARO D;  5AVB C;  5B31 D;  4WU9 A;  1P3I D;  3W99 D;  3X1S B;  3WAA B;  1KX3 D;  1HQ3 D;  1P34 B;  1P3A B;  1A7W A;  5B0Z C;  5BNV B;  4QLC D;  5DNN B;  1KX4 D;  4R8P B;  4J8X D;  3AZJ D;  5JRG A;  3A6N A;  5GT3 B;  5B32 G;  3AFA B;  4LD9 D;  4CAY A;  3MGR D;  3EPL A;  2NQB C;  3REL D;  5AV6 B;  3AL0 C;  1KX5 D;  3AZE A;  5B33 B;  3KUY C;  4X23 D;  4KGC B;  4AWL B;  1P3F D;  3O62 B;  1P3P C;  3MVD D;  5G49 B;  5GSU B;  3LJA B;  5B40 A;  3KWQ B;  1P3B A;  3WA9 D;  4XUJ D;  3MGS B;  3EG5 B;  2F8N H;  3AZF B;  4ZUX A;  5AVC D;  4KUD A;  2CV5 A;  2FJ7 A;  3B6G A;  1M19 D;  5B40 C;  2BYK A;  2F8N G;  3MNN A;  2ARO A;  2Y2H A;  4M6B A;  2Y2L A;  3B6F D;  5AV8 B;  3WKJ A;  2W8S A;  2HUE B;  5CP6 C;  3W96 D;  1AOI D;  5B2I B;  3LEL D;  1KX4 A;  2JE5 A;  2VQR A;  3AZJ A;  4YM6 A;  5FUG B;  5AV5 D;  3KXB C;  3AZM C;  4JJN B;  3AYW D;  3AV1 C;  3UTA C;  3W98 A;  4J8U A;  4H9P A;  3LZ1 B;  3AZG C;  1W2E A;  1TZY D;  3EPK A;  3AZH B;  1P3F A;  3R45 A;  2ZY4 A;  1F66 C;  5AV9 D;  4J8W D;  2PYO B;  2IO5 B;  1P3M D;  3W97 A;  5B1L B;  4YS3 C;  4H9R A;  1WWS A;  5B24 C;  4WU8 A;  1TAF A;  4G92 B;  3WTP C;  2JCH A;  4CSR A;  2Y2J A;  3REJ A;  5BO0 B;  5B31 B;  2NZD B;  1P3I B;  5B2J A;  3B0D B;  3W99 B;  1KX3 B;  5B1M A;  5GT0 C;  1HQ3 B;  3C1B B;  4J8V C;  3AZI A;  3W97 C;  1S32 A;  1N1J B;  3NQU B;  1B6W A;  4QLC B;  4Z66 D;  1P3G C;  3X1U D;  2UWX A;  4XZQ A;  5CPI D;  3X1T D;  5B32 B;  5B0Y D;  2Y2K A;  1ZLA B;  1BH8 B;  5AV5 A;  1P3K D;  4LD9 B;  3MGR B;  4HGA B;  5B1M C;  2F2A C;  5BNX B;  4NFT A;  3AZK B;  2HIO A;  4Z5T A;  5DNM A;  3AZI C;  1M1A D;  1KX5 B;  3AZN C;  3AV2 C;  4WU9 D;  1P3L A;  3AN2 A;  3X1V A;  3MVD B;  1U35 A;  3WA9 B;  3REH A;  4XUJ B;  3AZL C;  5JRG D;  3IP4 C;  3A6N D;  5AVC B;  2Y2N A;  1P3M A;  3MGQ C;  1JFI A;  1EQZ A;  3X1V C;  4H9O A;  3REI C;  1M19 B;  3TU4 C;  3LZ0 A;  1Z2C B;  5AY8 B;  4H9N A;  3AZE D;  3UT9 C;  1H3O B;  3B6F B;  5C3I B;  4G91 C;  3W96 B;  5B40 D;  5GXQ B;  5CPJ C;  3UTB A;  1ID3 B;  1AOI B;  1Q9C A;  3LEL B;  4DRA A;  5AVB A;  3A1K A;  1B67 A;  3FDD A;  3P5J B;  3MGP C;  5F99 C;  4KUD D;  3EPJ A;  5KDM B;  4R8P A;  5B0Z A;  2CV5 D;  3AYW B;  5E5A B;  2FJ7 D;  4ZBJ C;  5CPK B;  3WAA C;  3C1C B;  3X1S C;  1M18 B;  1P34 C;  5B31 G;  1P3A C;  1TZY B;  3WKJ D;  5DNN C;  5JA4 B;  4R8P C;  2NQB A;  5AV9 B;  5GT3 C;  4YM6 D;  3KUY A;  4J8W B;  3AFA C;  3LJA A;  1P3P A;  3NQJ B;  1F66 D;  4WNN B;  5AV6 C;  3W98 D;  4J8U D;  3V9R B;  5B33 C;  4KGC C;  4AWL C;  3O62 C;  5GSU C;  3KWQ C;  3LJA C;  3VH6 W;  3MGS C;  1P3O B;  3AZF C;  3REK B;  3VH5 T;  4Z66 B;  3X1U B;  3X1T B;  5B0Y B;  3W97 D;  5CP6 A;  1P3K B;  4WU8 D;  2ZY3 A;  2BYM B;  1M1A B;  2DQN C;  3REJ D;  4WU9 B;  3KXB A;  5AV8 C;  5B2J D;  3AZM A;  2HUE C;  5B1M D;  3AZI D;  3AV1 A;  3UTA A;  1S32 D;  5B2I C;  4H9Q A;  3AV2 D;  4XZQ D;  5JRG B;  3AZG A;  4JJN C;  3A6N B;  2Y2O A;  4CAY B;  1F66 A;  2YFW A;  3AZL D;  2HIO D;  4Z5T D;  5DNM D;  1HTA A;  3LZ1 C;  3AZE B; 
#chains in the Genus database with same CATH homology
 1P3L D;  5BT1 C;  3AZH C;  3AN2 D;  4YS3 A;  5B24 A;  3X1V D;  1U35 D;  3WTP A;  1P3B B;  3REH D;  2PYO C;  2IO5 C;  5B1L C;  4ZUX B;  5GT0 A;  4KHA A;  4KUD B;  4J8V A;  4G92 C;  1EQZ D;  3A1I A;  1P3G A;  2FJ7 B;  4NE5 A;  1ZLA A;  3B6G B;  5B31 C;  2NZD C;  3LZ0 D;  3MGP D;  1P3I C;  2BYK B;  3B0D C;  3W99 C;  4DRB A;  1KX3 C;  5BNX A;  3MNN B;  1HQ3 C;  2ARO B;  3C1B C;  3AZK A;  4QLC C;  3WKJ B;  3VH5 W;  3UTB D;  5BS7 C;  3AZN A;  3AV2 A;  5B32 C;  5AVB D;  1KX4 B;  4J8X B;  3AZJ B;  4YM6 B;  1ZLA C;  4H9S C;  4LD9 C;  3MGR C;  4HGA C;  4R8P D;  5B0Z D;  3AZK C;  3EPH A;  3W98 B;  1KX5 C;  4J8U B;  3AZL A;  3AFA D;  3REL B;  2FFF B;  4H9P B;  2ZM5 A;  3MVD C;  3MGQ A;  5AV6 D;  4X23 B;  3WA9 C;  1P3F B;  4XUJ C;  2NQB D;  2F8N A;  3R45 B;  3REI A;  3VH6 T;  2BG1 A;  3TU4 A;  4EO5 B;  5AVC C;  3KUY D;  3UT9 A;  3LJA D;  4WJ3 C;  1P3P D;  4NE3 A;  4H9R B;  4WU8 B;  5CPJ A;  1M19 C;  1TAF B;  5AY8 C;  2XD5 A;  3REJ B;  3MGP A;  5E5A A;  5F99 A;  3B6F C;  1BH9 A;  5C3I C;  5B2J B;  3W96 C;  4DQY B;  2YFV A;  5GXQ C;  5CPK A;  1ID3 C;  1S32 B;  1AOI C;  3LEL C;  4XZQ B;  3WAA A;  3X1S A;  1KU5 A;  1P34 A;  1P3A A;  5BNV A;  3AYW C;  5E5A C;  5B2I D;  5DNN A;  5CP6 D;  5AV5 B;  4WV4 B;  3B0C T;  5CPK C;  2HIO B;  4Z5T B;  5DNM B;  3C1C C;  1M18 C;  5GT3 A;  3AFA A;  1TZY C;  3KXB D;  3AZM D;  2L5A A;  3AN2 B;  1P3L B;  3AV1 D;  2G5I C;  5AV6 A;  3UTA D;  5AV9 C;  5B33 A;  4J8W C;  4KGC A;  3AZH D;  3O62 A;  2RIQ A;  3AZG D;  1WWI A;  2JSS A;  5G49 A;  5GSU A;  3KWQ A;  3REK A;  1P3M B;  4UUZ B;  3MGS A;  1JFI B;  1EQZ B;  3AZF A;  4H9O B;  3LZ0 B;  2ZY5 A;  2XD1 A;  4H9N B;  2G5H C;  4YS3 D;  5B24 D;  1P3O C;  2CWE A;  3REK C;  4Z66 C;  3X1U C;  3WTP D;  2NZD D;  5CPI C;  3UTB B;  3X1T C;  3C1B D;  5B0Y C;  5AVB B;  5CPI B;  5AV8 A;  1P3K C;  5GT0 D;  3WTP E;  4J8V D;  5B0Z B;  5B2I A;  1M1A C;  1P3G D;  5B32 D;  5FUG A;  1ZLA D;  4WU9 C;  4NE6 A;  4JJN A;  3AZK D;  2NQB B;  5JRG C;  3LZ1 A;  1R4V A;  2RVQ C;  3AZN D;  2J8P A;  3A6N C;  3KUY B;  3AZH A;  1BFM A;  1P3P B;  3B0C W;  2PYO A;  3AZE C;  5B1L A;  2Y2Q A;  3MGQ D;  3VH6 A;  1P3B C;  5AY8 D;  2F8N D;  3REI D;  3H0M C;  5BO0 A;  5B31 A;  3TU4 D;  5B40 B;  1P3I A;  2NZD A;  1PZR A;  3W99 A;  4ZUX C;  1KX3 A;  3C1B A;  1HQ3 A;  3UT9 D;  4KUD C;  1N1J A;  5GXQ D;  2CV5 C;  1ID3 D;  3NQU A;  3H0R C;  4QLC A;  2LY8 A;  5CP6 B;  2FJ7 C;  5CPJ D;  4J8X A;  2CV5 B;  3B6G C;  5BS7 A;  1T3U A;  5B32 A;  2Y2G A;  3MNN C;  2ARO C;  1BH8 A;  4H9S A;  5E5A D;  4LD9 A;  5F99 D;  3MGR A;  3KXB B;  3AZM B;  3WKJ C;  3AV1 B;  5CPK D;  3REL A;  3UTA B;  1KX5 A;  3C1C D;  1M18 D;  1KX4 C;  4H9Q B;  4J8X C;  3AZJ C;  4YM6 C;  3WAA D;  3X1S D;  4X23 A;  1P34 D;  2Y2P A;  3AZG B;  1P3A D;  3MVD A;  3WA9 A;  5DNN D;  3W98 C;  4XUJ A;  4J8U C;  1F66 B;  3B0B A;  2YFW B;  3REL C;  5GT3 D;  1F1E A;  5AVC A;  4X23 C;  3KFU G;  4YS3 B;  1P3F C;  5B24 B;  2ZY2 A;  1M19 A;  3WTP B;  4EO5 C;  5AY8 A;  5B33 D;  4KGC D;  1H3O A;  3B6F A;  3O62 D;  1P3O D;  3F6T A;  3W96 A;  1ULY A;  5GSU D;  4KHA B;  5GT0 B;  5CHL B;  5GXQ A;  3KWQ D;  3MGS D;  4J8V B;  3REK D;  4WU8 C;  1ID3 A;  4UPK A;  1AOI A;  3LEL A;  3AZF D;  3W97 B;  1P3G B;  3REJ C;  4CSR B;  3H0L C;  5KDM A;  5B2J C;  3AYW A;  1S32 C;  5B1M B;  3VH5 A;  3AZI B;  4XZQ C;  3C1C A;  1M18 A;  3AZN B;  3AV2 B;  3KSY A;  1TZY A;  5AV8 D;  5AV5 C;  5JA4 A;  5AV9 A;  2HIO C;  4Z5T C;  5DNM C;  2RVQ D;  4J8W A;  4E44 A;  3AZL B;  4UUZ A;  2Y2M A;  3NQJ A;  1P3L C;  3AN2 C;  4JJN D;  4WNN A;  3MGQ B;  1U35 C;  3V9R A;  3REH C;  3X1V B;  2F8N B;  3REI B;  1U35 B;  2F8N K;  4Z2M H;  3LZ1 D;  3REH B;  4E45 A;  3TU4 B;  5BT1 D;  3UT9 B;  1P3M C;  1P3B D;  1EQZ C;  1P3O A;  4G91 B;  4Z66 A;  3X1U A;  5CPI A;  5CPJ B;  2PYO D;  3X1T A;  3LZ0 C;  2Y2I A;  4ZUX D;  2DF4 C;  5B0Y A;  5B1L D;  4Z2M G;  3MGP B;  1P3K A;  5F99 B;  1BH9 B;  3B6G D;  2BYM A;  2YFV B;  3UTB C;  1M1A A;  4ZBJ B;  4WZS B;  3MNN D;  2ARO D;  5AVB C;  5B31 D;  4WU9 A;  1P3I D;  3W99 D;  3X1S B;  3WAA B;  1KX3 D;  1HQ3 D;  1P34 B;  1P3A B;  1A7W A;  5B0Z C;  5BNV B;  4QLC D;  5DNN B;  1KX4 D;  4R8P B;  4J8X D;  3AZJ D;  5JRG A;  3A6N A;  5GT3 B;  5B32 G;  3AFA B;  4LD9 D;  4CAY A;  3MGR D;  3EPL A;  2NQB C;  3REL D;  5AV6 B;  3AL0 C;  1KX5 D;  3AZE A;  5B33 B;  3KUY C;  4X23 D;  4KGC B;  4AWL B;  1P3F D;  3O62 B;  1P3P C;  3MVD D;  5G49 B;  5GSU B;  3LJA B;  5B40 A;  3KWQ B;  1P3B A;  3WA9 D;  4XUJ D;  3MGS B;  3EG5 B;  2F8N H;  3AZF B;  4ZUX A;  5AVC D;  4KUD A;  2CV5 A;  2FJ7 A;  3B6G A;  1M19 D;  5B40 C;  2BYK A;  2F8N G;  3MNN A;  2ARO A;  2Y2H A;  4M6B A;  2Y2L A;  3B6F D;  5AV8 B;  3WKJ A;  2W8S A;  2HUE B;  5CP6 C;  3W96 D;  1AOI D;  5B2I B;  3LEL D;  1KX4 A;  2JE5 A;  2VQR A;  3AZJ A;  4YM6 A;  5FUG B;  5AV5 D;  3KXB C;  3AZM C;  4JJN B;  3AYW D;  3AV1 C;  3UTA C;  3W98 A;  4J8U A;  4H9P A;  3LZ1 B;  3AZG C;  1W2E A;  1TZY D;  3EPK A;  3AZH B;  1P3F A;  3R45 A;  2ZY4 A;  1F66 C;  5AV9 D;  4J8W D;  2PYO B;  2IO5 B;  1P3M D;  3W97 A;  5B1L B;  4YS3 C;  4H9R A;  1WWS A;  5B24 C;  4WU8 A;  1TAF A;  4G92 B;  3WTP C;  2JCH A;  4CSR A;  2Y2J A;  3REJ A;  5BO0 B;  5B31 B;  2NZD B;  1P3I B;  5B2J A;  3B0D B;  3W99 B;  1KX3 B;  5B1M A;  5GT0 C;  1HQ3 B;  3C1B B;  4J8V C;  3AZI A;  3W97 C;  1S32 A;  1N1J B;  3NQU B;  1B6W A;  4QLC B;  4Z66 D;  1P3G C;  3X1U D;  2UWX A;  4XZQ A;  5CPI D;  3X1T D;  5B32 B;  5B0Y D;  2Y2K A;  1ZLA B;  1BH8 B;  5AV5 A;  1P3K D;  4LD9 B;  3MGR B;  4HGA B;  5B1M C;  2F2A C;  5BNX B;  4NFT A;  3AZK B;  2HIO A;  4Z5T A;  5DNM A;  3AZI C;  1M1A D;  1KX5 B;  3AZN C;  3AV2 C;  4WU9 D;  1P3L A;  3AN2 A;  3X1V A;  3MVD B;  1U35 A;  3WA9 B;  3REH A;  4XUJ B;  3AZL C;  5JRG D;  3IP4 C;  3A6N D;  5AVC B;  2Y2N A;  1P3M A;  3MGQ C;  1JFI A;  1EQZ A;  3X1V C;  4H9O A;  3REI C;  1M19 B;  3TU4 C;  3LZ0 A;  1Z2C B;  5AY8 B;  4H9N A;  3AZE D;  3UT9 C;  1H3O B;  3B6F B;  5C3I B;  4G91 C;  3W96 B;  5B40 D;  5GXQ B;  5CPJ C;  3UTB A;  1ID3 B;  1AOI B;  1Q9C A;  3LEL B;  4DRA A;  5AVB A;  3A1K A;  1B67 A;  3FDD A;  3P5J B;  3MGP C;  5F99 C;  4KUD D;  3EPJ A;  5KDM B;  4R8P A;  5B0Z A;  2CV5 D;  3AYW B;  5E5A B;  2FJ7 D;  4ZBJ C;  5CPK B;  3WAA C;  3C1C B;  3X1S C;  1M18 B;  1P34 C;  5B31 G;  1P3A C;  1TZY B;  3WKJ D;  5DNN C;  5JA4 B;  4R8P C;  2NQB A;  5AV9 B;  5GT3 C;  4YM6 D;  3KUY A;  4J8W B;  3AFA C;  3LJA A;  1P3P A;  3NQJ B;  1F66 D;  4WNN B;  5AV6 C;  3W98 D;  4J8U D;  3V9R B;  5B33 C;  4KGC C;  4AWL C;  3O62 C;  5GSU C;  3KWQ C;  3LJA C;  3VH6 W;  3MGS C;  1P3O B;  3AZF C;  3REK B;  3VH5 T;  4Z66 B;  3X1U B;  3X1T B;  5B0Y B;  3W97 D;  5CP6 A;  1P3K B;  4WU8 D;  2ZY3 A;  2BYM B;  1M1A B;  2DQN C;  3REJ D;  4WU9 B;  3KXB A;  5AV8 C;  5B2J D;  3AZM A;  2HUE C;  5B1M D;  3AZI D;  3AV1 A;  3UTA A;  1S32 D;  5B2I C;  4H9Q A;  3AV2 D;  4XZQ D;  5JRG B;  3AZG A;  4JJN C;  3A6N B;  2Y2O A;  4CAY B;  1F66 A;  2YFW A;  3AZL D;  2HIO D;  4Z5T D;  5DNM D;  1HTA A;  3LZ1 C;  3AZE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...