1BFMA

Histone b from methanothermus fervidus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
69
structure length
69
Chain Sequence
MELPIAPIGRIIKDAGAERVSDDARITLAKILEEMGRDIASEAIKLARHAGRKTIKAEDIELAVRRFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of HMfB from the hyperthermophile, Methanothermus fervidus, confirms that this archaeal protein is a histone.
pubmed doi rcsb
source organism Methanothermus fervidus
molecule tags Histone protein
molecule keywords HISTONE B
total genus 20
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1bfmA00
3UT9D 1P3BD 4XZQD 2F8NB 4ZUXD 4UUZA 3X1TD 3LZ0A 3TU4B 4J8WC 4KUDD 1AOIC 5AVBA 3REKB 4R8PB 1F66A 3MGRC 1M19C 3AV2A 4Z66A 3LZ1B 5AVCC 3WTPA 5JA4A 3AZEB 3VH5W 4NFTA 3X1SC 1TZYA 1AOIB 3B6GD 3AZLD 3REKC 5JRGD 3AZJA 2AROC 4NE3A 5AVCB 4WZSB 5E5AD 4DRBA 4Z5TA 5AV8C 4UUZB 5B2ID 5AY8D 1P3IB 3MNNA 3WKJC 3WAAD 5B0YA 3AFAD 3AZMB 1EQZB 1M1AC 1ID3B 5B32B 3UTAD 5AV6C 4J8VA 3AZJB 5G49A 5B31D 3WKJB 5GT0C 5GT3A 3WAAC 3AZMC 5B1MA 5AV9A 3UTBD 3WTPB 3RELA 5GXQC 5AV8A 3AZGC 1B6WA 4G91B 1P3PB 5B1LB 3W97D 3W98C 3W99B 4J8XC 5FUGA 5AV6B 3AZJC 5F99B 4LD9B 3X1SA 3KXBD 3AZHB 5CPKB 3W99C 5CPJD 4QLCB 2CV5B 3MGRB 3A6NC 3AYWB 1M19B 3AN2A 3LZ1C 4J8WD 2HIOC 1AOIA 4HGAB 5B40B 4XUJC 4WNNB 4WU8A 3MVDA 3X1TC 4KGCC 1KX3A 3LELD 1ZLAD 1M18A 4J8VB 5C3IC 1P3FA 4KHAB 4JJNA 1P34C 2FJ7C 3MGPA 3AZFC 2FJ7B 3A6ND 1HQ3C 5B32G 3AZHA 5CPKA 4YS3D 2NQBA 5B31G 2BYKB 3RELC 5C3IB 1S32B 5BT1C 3C1BC 1M1AB 3MGQC 5CPIA 3WA9A 3AZID 3AZKB 1BFMA 4WU9D 1P3GC 3NQUB 5KDMB 4JJND 4ZBJC 3O62B 3O62D 1KX3D 3AZNC 5B32A 3MGPC 1KX5D 3C1CD 5AV5B 3MGQB 4WU8D 1WWSA 3UTAC 5B24B 1M1AD 4DRAA 1S32D 5AV9B 1H3OB 2IO5B 5B31B 3MGPB 3WKJD 1KX3C 1Q9CA 5B24A 2HUEC 5AY8C 5BNXB 4J8UA 3REIC 5GSUD 5B0ZB 3A6NB 3REHA 1HQ3A 3AYWC 1F66C 2AROD 1EQZD 3AZEA 3AFAB 2RVQC 5BNXA 4J8UB 5GT0B 1KX4C 4XUJB 4QLCA 3RELD 3MGRA 1M19A 5DNNC 3REJA 5AVBB 3REKA 1F66B 3AV1C 2FJ7A 5GXQB 3W98B 4WV4B 5B1LC 3MGRD 4AWLB 1M19D 3AZFD 1A7WA 4QLCD 1P3MC 2PYOB 3UTAA 3B6GB 3VH5T 3AZED 1P3OA 4LD9D 3WAAA 4EO5B 5B1MC 2HIOD 4J8UD 4Z2MH 5AY8A 3X1UC 3MNNC 3AV1A 1P3MD 3WKJA 2HIOB 3UTBB 1S32A 3B0CW 1M1AA 3KUYC 3AZMA 4EO5C 3KXBC 3B6GA 2CV5A 5B32D 1U35D 2NZDD 2RVQD 3KWQB 4Z66D 4NE6A 5GXQD 3W98D 3AN2C 1F66D 2F8NA 5AVBD 3AZIA 4KUDA 4E44A 2HUEB 5AY8B 5B2IB 3MVDC 5B1LA 5GT0D 3X1TA 1ID3A 3LZ0C 2F8NH 4Z66B 3LZ1A 3UT9A 1P3BA 1B67A 2F8NK 1U35B 4J8UC 5G49B 3AV2C 4WU8C 5CP6A 5GXQA 3W98A 3MGPD 3AZEC 3MGSD 3KWQA 3LZ0B 3LELA 3TU4A 1ZLAA 4H9QA 4QLCC 5B2JC 5AV6A 5B40A 3MGQD 2AROB 5JRGC 4J8WA 1P3KA 3V9RB 3AZLC 1P3GA 3B6FA 3WA9B 4WU9B 5CPJA 3AZNA 5DNMC 2PYOD 3B0BA 3V9RA 4H9RA 1P3OB 4R8PC 3AYWD 1P3OD 2BYKA 4H9SA 5JA4B 4YM6B 4KUDC 2JSSA 5DNNB 3WA9C 1KX5B 1BH8A 5BNVB 3RELB 1P3PA 4XUJD 1S32C 4KHAA 4JJNB 5F99D 2FJ7D 3WTPC 5GT3D 4YM6C 3B6FB 3AZIB 4CAYB 4J8VD 3WTPE 1P3PD 4H9NA 5B33C 4JJNC 4G92B 2AROA 3AYWA 5GSUA 3REHD 5DNNA 3REJC 2PYOA 3B6FC 3UTAB 5B24D 2BYMA 3B6FD 3KUYB 5E5AA 1KX3B 4HGAC 3KXBB 5B40D 5AV6D 3NQJA 1TAFA 3C1CA 4J8WB 3R45B 4YM6D 3X1UD 3WTPD 3AN2B 3O62A 3KWQD 1P3AC 2NZDB 4H9OA 4WU9A 5CPJB 5CP6D 4CSRA 4LD9C 4H9SC 3WA9D 3KUYA 5B33A 5CHLB 3LZ1D 3W96D 1ID3D 2CV5C 4H9PA 4XZQA 4AWLC 1P3MB 2PYOC 5B1LD 5GT0A 3W97B 3AV1D 4H9QB 1P3ID 4YS3A 2NQBD 2F8ND 4H9RB 1P3IC 1P3FD 1N1JA 4CAYA 5AVCD 2NZDA 3W96C 5CPIB 1U35A 4H9OB 1EQZC 3AZGD 3AZKA 3B0CT 1H3OA 2CV5D 3W97C 1AOID 3AZMD 5CP6C 4ZUXC 1P3LA 5B31C 4XZQC 5AV5A 1P3MA 3UT9C 1P3BC 3KWQC 5E5AB 2HIOA 4G91C 5B40C 3AFAC 4LD9A 5B2JA 3X1VB 5GSUB 5B0ZD 1P3GB 1ULYA 3TU4C 4ZBJB 3O62C 1P3AA 3UT9B 1P3BB 3R45A 5AVBC 5AV8D 3AZFA 5AV9D 3UTBA 3REIA 4Z66C 5B24C 2NZDC 5B31A 3REKD 3C1BD 1N1JB 3REJD 3AV2B 3WAAB 1P3PC 1EQZA 1WWIA 5GT3C 1HQ3D 5B0YD 4J8VC 5AV8B 3MNND 3W99A 1P34B 3AZFB 5DNMA 1JFIB 4Z5TB 3VH6A 1KX4B 4KGCD 2YFWB 5AV5C 3VH6T 3AZLA 3C1BA 4YS3B 1TZYD 5DNMB 1JFIA 4R8PD 1P3OC 1P3KB 1KX5A 1P3FC 5CPJC 3LELB 1ZLAB 2NQBC 5BS7C 4H9PB 4XZQB 3AZGB 3AZNB 5CPID 5B1MB 5B2JD 4J8XD 1P3FB 5GSUC 5FUGB 3UTBC 1R4VA 3LJAD 4WNNA 4WU8B 2YFVA 3AV1B 5AV5D 3C1CB 4X23D 1P34A 3C1BB 3AZHD 2L5AA 5CPKD 1P3LD 3A6NA 3X1VA 1M18D 3AZGA 3AZKD 3MVDD 5CP6B 3C1CC 2LY8A 3X1VD 3X1UB 3MVDB 5B2IC 3AN2D 1P3IA 5E5AC 3LJAA 5AV9C 1P3AB 3REHC 4H9NB 3W96A 4E45A 1U35C 5KDMA 3VH6W 3X1SD 3KXBA 4J8XA 3B6GC 5B33D 3KUYD 3REIB 3LJAB 2BYMB 4YS3C 3W97A 3AZKC 5BS7A 1M18C 5F99C 1HTAA 3X1UA 5B1MD 4YM6A 3LELC 1ZLAC 4R8PA 3AZHC 5CPKC 3VH5A 2NQBB 3AZLB 3B0DB 1F1EA 5B33B 3X1SB 5GT3B 1BH9A 4M6BA 4G92C 1M18B 3W96B 4KGCA 1KX4A 1TZYB 5DNMD 3AFAA 2F8NG 2IO5C 3B0DC 3W99D 5BNVA 5DNND 5B2IA 3X1TB 3NQJB 1KX4D 3KSYA 4Z5TD 2CWEA 4KGCB 3AZJD 5JRGA 1P3KC 1ID3C 4Z2MG 4CSRB 3X1VC 3MGSC 5F99A 3REID 1P3LB 4XUJA 4X23B 3AV2D 1P3AD 5B0ZA 3LZ0D 3REHB 2YFWA 5B0YC 5B2JB 4J8XB 4ZUXA 3MGSB 1P3LC 1KX5C 1BH9B 3AZND 4X23C 1KU5A 5JRGB 3LJAC 1BH8B 5BO0A 1P3GD 1TAFB 3MNNB 3AZIC 4WU9C 5B0YB 1P3KD 5CPIC 5B32C 3MGQA 5BO0B 4Z5TC 5BT1D 4KUDB 3TU4D 4NE5A 5AVCA 3REJB 3NQUA 4ZUXB 3MGSA 5B0ZC 1TZYC 1P34D 4X23A 2YFVB 1HQ3B
chains in the Genus database with same CATH superfamily
1W2EA 3UT9D 1P3BD 2UWXA 4XZQD 3H0MC 2F8NB 4ZUXD 4UUZA 3X1TD 3LZ0A 3TU4B 4J8WC 4KUDD 1AOIC 5AVBA 3REKB 4R8PB 1F66A 3MGRC 1M19C 3AV2A 4Z66A 3LZ1B 5AVCC 2J8PA 3WTPA 5JA4A 3AZEB 3VH5W 4NFTA 3X1SC 1TZYA 1AOIB 3B6GD 3AZLD 3REKC 5JRGD 3AZJA 2AROC 4NE3A 2Y2PA 5AVCB 5E5AD 4WZSB 4DRBA 4Z5TA 5AV8C 4UUZB 5B2ID 5AY8D 3KFUG 1P3IB 3MNNA 3WKJC 3WAAD 5B0YA 3AFAD 3AZMB 1EQZB 1M1AC 1ID3B 5B32B 3UTAD 5AV6C 4J8VA 3AZJB 5G49A 5B31D 3WKJB 5GT0C 5GT3A 3WAAC 3AZMC 5B1MA 5AV9A 3UTBD 3WTPB 3RELA 5GXQC 5AV8A 3AZGC 1B6WA 4G91B 1P3PB 5B1LB 3W97D 3W98C 3W99B 4J8XC 5FUGA 2Y2MA 5AV6B 3AZJC 5F99B 4LD9B 3X1SA 3KXBD 3AZHB 5CPKB 3W99C 5CPJD 4QLCB 2CV5B 3MGRB 3A6NC 3AYWB 1M19B 3AN2A 3LZ1C 4J8WD 2HIOC 1AOIA 4HGAB 5B40B 4XUJC 4WNNB 4WU8A 3MVDA 3X1TC 4KGCC 4DQYB 1KX3A 3LELD 1ZLAD 1M18A 2RIQA 4J8VB 5C3IC 1P3FA 4KHAB 4JJNA 1P34C 2FJ7C 3MGPA 3AZFC 2FJ7B 3A6ND 1HQ3C 5B32G 3AZHA 5CPKA 4YS3D 2NQBA 5B31G 2BYKB 3RELC 5C3IB 1S32B 5BT1C 3C1BC 1M1AB 3AL0C 3MGQC 5CPIA 3WA9A 2G5HC 3AZID 3AZKB 1BFMA 4WU9D 1P3GC 3NQUB 5KDMB 4JJND 4ZBJC 3O62B 3O62D 1KX3D 3AZNC 5B32A 3MGPC 1KX5D 3C1CD 5AV5B 3MGQB 4WU8D 1WWSA 3UTAC 5B24B 1M1AD 4DRAA 3F6TA 1S32D 5AV9B 1H3OB 2IO5B 5B31B 3MGPB 3WKJD 1KX3C 1Q9CA 5B24A 2HUEC 5AY8C 5BNXB 4J8UA 3REIC 5GSUD 5B0ZB 3A6NB 3REHA 1HQ3A 3AYWC 1F66C 2AROD 1EQZD 3AZEA 3AFAB 2RVQC 2Y2NA 5BNXA 4J8UB 5GT0B 1KX4C 4XUJB 4QLCA 3RELD 2ZY4A 3MGRA 5DNNC 3REJA 1M19A 5AVBB 3REKA 1F66B 3AV1C 2FJ7A 5GXQB 3W98B 4WV4B 5B1LC 2Y2GA 2VQRA 3MGRD 4AWLB 1M19D 3AZFD 1A7WA 4QLCD 1P3MC 2PYOB 3UTAA 3B6GB 2DF4C 3VH5T 3AZED 3A1IA 1P3OA 4LD9D 3WAAA 4EO5B 5B1MC 2HIOD 4J8UD 4Z2MH 5AY8A 3X1UC 3MNNC 3AV1A 1P3MD 3WKJA 2HIOB 3UTBB 1S32A 3B0CW 1M1AA 3KUYC 3AZMA 4EO5C 3KXBC 3B6GA 2CV5A 5B32D 1U35D 2NZDD 2RVQD 3KWQB 4Z66D 4NE6A 5GXQD 3W98D 3AN2C 2Y2KA 1F66D 2ZY5A 2F8NA 5AVBD 3AZIA 4KUDA 4E44A 2HUEB 5AY8B 5B2IB 3MVDC 5B1LA 5GT0D 3X1TA 1ID3A 3LZ0C 2F8NH 4Z66B 3LZ1A 3UT9A 1P3BA 1B67A 2F8NK 3EPLA 1U35B 4J8UC 2FFFB 5G49B 3AV2C 4WU8C 5CP6A 5GXQA 3W98A 3MGPD 3AZEC 3MGSD 3KWQA 3LZ0B 3LELA 3TU4A 1ZLAA 4H9QA 4QLCC 5B2JC 5AV6A 5B40A 3MGQD 2AROB 5JRGC 4J8WA 1P3KA 3V9RB 3AZLC 1P3GA 3B6FA 3WA9B 4WU9B 5CPJA 3AZNA 5DNMC 2PYOD 3B0BA 3V9RA 4H9RA 1P3OB 4R8PC 3AYWD 1P3OD 2BYKA 4H9SA 5JA4B 4YM6B 4WJ3C 4KUDC 2JSSA 5DNNB 3WA9C 1KX5B 1BH8A 5BNVB 3RELB 1P3PA 4XUJD 1S32C 4KHAA 4JJNB 5F99D 2FJ7D 3WTPC 5GT3D 4YM6C 3B6FB 3AZIB 4CAYB 4J8VD 3WTPE 1P3PD 4H9NA 5B33C 1PZRA 4JJNC 4G92B 2AROA 3AYWA 5GSUA 3REHD 5DNNA 3REJC 2PYOA 3B6FC 3UTAB 5B24D 2BYMA 2Y2HA 3B6FD 3KUYB 5E5AA 2Y2IA 1KX3B 4HGAC 2F2AC 3KXBB 5B40D 5AV6D 3NQJA 1TAFA 3C1CA 4J8WB 3R45B 4YM6D 3X1UD 3WTPD 3AN2B 3O62A 3KWQD 1P3AC 2NZDB 4H9OA 4WU9A 5CPJB 5CP6D 4CSRA 4LD9C 4H9SC 3WA9D 1Z2CB 3KUYA 5B33A 5CHLB 3LZ1D 3W96D 1ID3D 2CV5C 4H9PA 4XZQA 4AWLC 1P3MB 2PYOC 5B1LD 5GT0A 3P5JB 3W97B 3AV1D 4H9QB 1P3ID 4YS3A 2NQBD 2F8ND 3FDDA 4H9RB 1P3IC 1P3FD 1N1JA 3EG5B 4CAYA 5AVCD 2NZDA 3W96C 2Y2JA 5CPIB 1U35A 4H9OB 1EQZC 3AZGD 3AZKA 3B0CT 1H3OA 2CV5D 3W97C 2DQNC 1AOID 3AZMD 5CP6C 4ZUXC 1P3LA 5B31C 4XZQC 5AV5A 1P3MA 3UT9C 1P3BC 2JE5A 3KWQC 5E5AB 2HIOA 4G91C 5B40C 3AFAC 4LD9A 5B2JA 3X1VB 2Y2QA 3H0RC 5GSUB 5B0ZD 1P3GB 1ULYA 3TU4C 4ZBJB 3O62C 1P3AA 3UT9B 1P3BB 3R45A 5AVBC 5AV8D 3AZFA 1T3UA 5AV9D 3UTBA 3REIA 4Z66C 3A1KA 5B24C 2NZDC 5B31A 3REKD 3C1BD 1N1JB 3REJD 3AV2B 2JCHA 2ZY2A 3WAAB 4UPKA 1P3PC 1EQZA 1WWIA 5GT3C 1HQ3D 5B0YD 4J8VC 5AV8B 3MNND 3W99A 1P34B 3AZFB 5DNMA 1JFIB 4Z5TB 3VH6A 1KX4B 4KGCD 2YFWB 5AV5C 3VH6T 3AZLA 3C1BA 4YS3B 1TZYD 5DNMB 1JFIA 4R8PD 1P3OC 1P3KB 1KX5A 1P3FC 5CPJC 2BG1A 3LELB 1ZLAB 2NQBC 5BS7C 4H9PB 4XZQB 3AZGB 3AZNB 5CPID 5B1MB 5B2JD 4J8XD 1P3FB 2ZY3A 5GSUC 5FUGB 3UTBC 1R4VA 3H0LC 3LJAD 4WNNA 4WU8B 2YFVA 3AV1B 5AV5D 3C1CB 4X23D 1P34A 2XD1A 3C1BB 3AZHD 2L5AA 5CPKD 1P3LD 3A6NA 3X1VA 1M18D 3AZGA 3AZKD 3MVDD 5CP6B 3C1CC 2LY8A 2G5IC 2Y2OA 3X1VD 3X1UB 5B2IC 3MVDB 3AN2D 1P3IA 5E5AC 3LJAA 5AV9C 1P3AB 3REHC 4H9NB 3W96A 4E45A 1U35C 5KDMA 3VH6W 3X1SD 3KXBA 4J8XA 3B6GC 5B33D 3EPHA 3KUYD 3REIB 3LJAB 2BYMB 4YS3C 3W97A 3AZKC 5BS7A 1M18C 5F99C 3X1UA 1HTAA 5B1MD 4YM6A 2ZM5A 3LELC 1ZLAC 4R8PA 3AZHC 5CPKC 3VH5A 2NQBB 3AZLB 3B0DB 1F1EA 5B33B 3X1SB 5GT3B 1BH9A 4M6BA 4G92C 1M18B 3W96B 4KGCA 1KX4A 1TZYB 5DNMD 3AFAA 2F8NG 2IO5C 3B0DC 3W99D 5BNVA 5DNND 5B2IA 3X1TB 3NQJB 1KX4D 3KSYA 4Z5TD 2CWEA 4KGCB 3AZJD 5JRGA 3IP4C 1P3KC 1ID3C 4Z2MG 4CSRB 3X1VC 3MGSC 5F99A 3REID 1P3LB 4XUJA 4X23B 3AV2D 1P3AD 5B0ZA 3LZ0D 3REHB 2YFWA 5B0YC 5B2JB 4J8XB 4ZUXA 3MGSB 1P3LC 1KX5C 1BH9B 2XD5A 3AZND 4X23C 1KU5A 5JRGB 2W8SA 3LJAC 1BH8B 5BO0A 1P3GD 1TAFB 3MNNB 3AZIC 4WU9C 5B0YB 1P3KD 5CPIC 5B32C 3MGQA 5BO0B 4Z5TC 5BT1D 4KUDB 2Y2LA 3TU4D 4NE5A 5AVCA 3EPJA 3EPKA 3NQUA 3REJB 4ZUXB 3MGSA 5B0ZC 1TZYC 1P34D 4X23A 2YFVB 1HQ3B
chains in the Genus database with same CATH topology
1W2EA 3UT9D 1P3BD 2UWXA 4XZQD 3H0MC 2F8NB 4ZUXD 4UUZA 3X1TD 3LZ0A 3TU4B 4J8WC 4KUDD 1AOIC 5AVBA 3REKB 4R8PB 1F66A 3MGRC 1M19C 3AV2A 4Z66A 3LZ1B 5AVCC 2J8PA 3WTPA 5JA4A 3AZEB 3VH5W 4NFTA 3X1SC 1TZYA 1AOIB 3B6GD 3AZLD 3REKC 5JRGD 3AZJA 2AROC 4NE3A 2Y2PA 5AVCB 5E5AD 4WZSB 4DRBA 4Z5TA 5AV8C 4UUZB 5B2ID 5AY8D 3KFUG 1P3IB 3MNNA 3WKJC 3WAAD 5B0YA 3AFAD 3AZMB 1EQZB 1M1AC 1ID3B 5B32B 3UTAD 5AV6C 4J8VA 3AZJB 5G49A 5B31D 3WKJB 5GT0C 5GT3A 3WAAC 3AZMC 5B1MA 5AV9A 3UTBD 3WTPB 3RELA 5GXQC 5AV8A 3AZGC 1B6WA 4G91B 1P3PB 5B1LB 3W97D 3W98C 3W99B 4J8XC 5FUGA 2Y2MA 5AV6B 3AZJC 5F99B 4LD9B 3X1SA 3KXBD 3AZHB 5CPKB 3W99C 5CPJD 4QLCB 2CV5B 3MGRB 3A6NC 3AYWB 1M19B 3AN2A 3LZ1C 4J8WD 2HIOC 1AOIA 4HGAB 5B40B 4XUJC 4WNNB 4WU8A 3MVDA 3X1TC 4KGCC 4DQYB 1KX3A 3LELD 1ZLAD 1M18A 2RIQA 4J8VB 5C3IC 1P3FA 4KHAB 4JJNA 1P34C 2FJ7C 3MGPA 3AZFC 2FJ7B 3A6ND 1HQ3C 5B32G 3AZHA 5CPKA 4YS3D 2NQBA 5B31G 2BYKB 3RELC 5C3IB 1S32B 5BT1C 3C1BC 1M1AB 3AL0C 3MGQC 5CPIA 3WA9A 2G5HC 3AZID 3AZKB 1BFMA 4WU9D 1P3GC 3NQUB 5KDMB 4JJND 4ZBJC 3O62B 3O62D 1KX3D 3AZNC 5B32A 3MGPC 1KX5D 3C1CD 5AV5B 3MGQB 4WU8D 1WWSA 3UTAC 5B24B 1M1AD 4DRAA 3F6TA 1S32D 5AV9B 1H3OB 2IO5B 5B31B 3MGPB 3WKJD 1KX3C 1Q9CA 5B24A 2HUEC 5AY8C 5BNXB 4J8UA 3REIC 5GSUD 5B0ZB 3A6NB 3REHA 1HQ3A 3AYWC 1F66C 2AROD 1EQZD 3AZEA 3AFAB 2RVQC 2Y2NA 5BNXA 4J8UB 5GT0B 1KX4C 4XUJB 4QLCA 3RELD 2ZY4A 3MGRA 5DNNC 3REJA 1M19A 5AVBB 3REKA 1F66B 3AV1C 2FJ7A 5GXQB 3W98B 4WV4B 5B1LC 2Y2GA 2VQRA 3MGRD 4AWLB 1M19D 3AZFD 1A7WA 4QLCD 1P3MC 2PYOB 3UTAA 3B6GB 2DF4C 3VH5T 3AZED 3A1IA 1P3OA 4LD9D 3WAAA 4EO5B 5B1MC 2HIOD 4J8UD 4Z2MH 5AY8A 3X1UC 3MNNC 3AV1A 1P3MD 3WKJA 2HIOB 3UTBB 1S32A 3B0CW 1M1AA 3KUYC 3AZMA 4EO5C 3KXBC 3B6GA 2CV5A 5B32D 1U35D 2NZDD 2RVQD 3KWQB 4Z66D 4NE6A 5GXQD 3W98D 3AN2C 2Y2KA 1F66D 2ZY5A 2F8NA 5AVBD 3AZIA 4KUDA 4E44A 2HUEB 5AY8B 5B2IB 3MVDC 5B1LA 5GT0D 3X1TA 1ID3A 3LZ0C 2F8NH 4Z66B 3LZ1A 3UT9A 1P3BA 1B67A 2F8NK 3EPLA 1U35B 4J8UC 2FFFB 5G49B 3AV2C 4WU8C 5CP6A 5GXQA 3W98A 3MGPD 3AZEC 3MGSD 3KWQA 3LZ0B 3LELA 3TU4A 1ZLAA 4H9QA 4QLCC 5B2JC 5AV6A 5B40A 3MGQD 2AROB 5JRGC 4J8WA 1P3KA 3V9RB 3AZLC 1P3GA 3B6FA 3WA9B 4WU9B 5CPJA 3AZNA 5DNMC 2PYOD 3B0BA 3V9RA 4H9RA 1P3OB 4R8PC 3AYWD 1P3OD 2BYKA 4H9SA 5JA4B 4YM6B 4WJ3C 4KUDC 2JSSA 5DNNB 3WA9C 1KX5B 1BH8A 5BNVB 3RELB 1P3PA 4XUJD 1S32C 4KHAA 4JJNB 5F99D 2FJ7D 3WTPC 5GT3D 4YM6C 3B6FB 3AZIB 4CAYB 4J8VD 3WTPE 1P3PD 4H9NA 5B33C 1PZRA 4JJNC 4G92B 2AROA 3AYWA 5GSUA 3REHD 5DNNA 3REJC 2PYOA 3B6FC 3UTAB 5B24D 2BYMA 2Y2HA 3B6FD 3KUYB 5E5AA 2Y2IA 1KX3B 4HGAC 2F2AC 3KXBB 5B40D 5AV6D 3NQJA 1TAFA 3C1CA 4J8WB 3R45B 4YM6D 3X1UD 3WTPD 3AN2B 3O62A 3KWQD 1P3AC 2NZDB 4H9OA 4WU9A 5CPJB 5CP6D 4CSRA 4LD9C 4H9SC 3WA9D 1Z2CB 3KUYA 5B33A 5CHLB 3LZ1D 3W96D 1ID3D 2CV5C 4H9PA 4XZQA 4AWLC 1P3MB 2PYOC 5B1LD 5GT0A 3P5JB 3W97B 3AV1D 4H9QB 1P3ID 4YS3A 2NQBD 2F8ND 3FDDA 4H9RB 1P3IC 1P3FD 1N1JA 3EG5B 4CAYA 5AVCD 2NZDA 3W96C 2Y2JA 5CPIB 1U35A 4H9OB 1EQZC 3AZGD 3AZKA 3B0CT 1H3OA 2CV5D 3W97C 2DQNC 1AOID 3AZMD 5CP6C 4ZUXC 1P3LA 5B31C 4XZQC 5AV5A 1P3MA 3UT9C 1P3BC 2JE5A 3KWQC 5E5AB 2HIOA 4G91C 5B40C 3AFAC 4LD9A 5B2JA 3X1VB 2Y2QA 3H0RC 5GSUB 5B0ZD 1P3GB 1ULYA 3TU4C 4ZBJB 3O62C 1P3AA 3UT9B 1P3BB 3R45A 5AVBC 5AV8D 3AZFA 1T3UA 5AV9D 3UTBA 3REIA 4Z66C 3A1KA 5B24C 2NZDC 5B31A 3REKD 3C1BD 1N1JB 3REJD 3AV2B 2JCHA 2ZY2A 3WAAB 4UPKA 1P3PC 1EQZA 1WWIA 5GT3C 1HQ3D 5B0YD 4J8VC 5AV8B 3MNND 3W99A 1P34B 3AZFB 5DNMA 1JFIB 4Z5TB 3VH6A 1KX4B 4KGCD 2YFWB 5AV5C 3VH6T 3AZLA 3C1BA 4YS3B 1TZYD 5DNMB 1JFIA 4R8PD 1P3OC 1P3KB 1KX5A 1P3FC 5CPJC 2BG1A 3LELB 1ZLAB 2NQBC 5BS7C 4H9PB 4XZQB 3AZGB 3AZNB 5CPID 5B1MB 5B2JD 4J8XD 1P3FB 2ZY3A 5GSUC 5FUGB 3UTBC 1R4VA 3H0LC 3LJAD 4WNNA 4WU8B 2YFVA 3AV1B 5AV5D 3C1CB 4X23D 1P34A 2XD1A 3C1BB 3AZHD 2L5AA 5CPKD 1P3LD 3A6NA 3X1VA 1M18D 3AZGA 3AZKD 3MVDD 5CP6B 3C1CC 2LY8A 2G5IC 2Y2OA 3X1VD 3X1UB 5B2IC 3MVDB 3AN2D 1P3IA 5E5AC 3LJAA 5AV9C 1P3AB 3REHC 4H9NB 3W96A 4E45A 1U35C 5KDMA 3VH6W 3X1SD 3KXBA 4J8XA 3B6GC 5B33D 3EPHA 3KUYD 3REIB 3LJAB 2BYMB 4YS3C 3W97A 3AZKC 5BS7A 1M18C 5F99C 3X1UA 1HTAA 5B1MD 4YM6A 2ZM5A 3LELC 1ZLAC 4R8PA 3AZHC 5CPKC 3VH5A 2NQBB 3AZLB 3B0DB 1F1EA 5B33B 3X1SB 5GT3B 1BH9A 4M6BA 4G92C 1M18B 3W96B 4KGCA 1KX4A 1TZYB 5DNMD 3AFAA 2F8NG 2IO5C 3B0DC 3W99D 5BNVA 5DNND 5B2IA 3X1TB 3NQJB 1KX4D 3KSYA 4Z5TD 2CWEA 4KGCB 3AZJD 5JRGA 3IP4C 1P3KC 1ID3C 4Z2MG 4CSRB 3X1VC 3MGSC 5F99A 3REID 1P3LB 4XUJA 4X23B 3AV2D 1P3AD 5B0ZA 3LZ0D 3REHB 2YFWA 5B0YC 5B2JB 4J8XB 4ZUXA 3MGSB 1P3LC 1KX5C 1BH9B 2XD5A 3AZND 4X23C 1KU5A 5JRGB 2W8SA 3LJAC 1BH8B 5BO0A 1P3GD 1TAFB 3MNNB 3AZIC 4WU9C 5B0YB 1P3KD 5CPIC 5B32C 3MGQA 5BO0B 4Z5TC 5BT1D 4KUDB 2Y2LA 3TU4D 4NE5A 5AVCA 3EPJA 3EPKA 3NQUA 3REJB 4ZUXB 3MGSA 5B0ZC 1TZYC 1P34D 4X23A 2YFVB 1HQ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT9 D;  1P3B D;  4XZQ D;  2F8N B;  4ZUX D;  4UUZ A;  3X1T D;  3LZ0 A;  3TU4 B;  4J8W C;  4KUD D;  1AOI C;  5AVB A;  3REK B;  4R8P B;  1F66 A;  3MGR C;  1M19 C;  3AV2 A;  4Z66 A;  3LZ1 B;  5AVC C;  3WTP A;  5JA4 A;  3AZE B;  3VH5 W;  4NFT A;  3X1S C;  1TZY A;  1AOI B;  3B6G D;  3AZL D;  3REK C;  5JRG D;  3AZJ A;  2ARO C;  4NE3 A;  5AVC B;  4WZS B;  5E5A D;  4DRB A;  4Z5T A;  5AV8 C;  4UUZ B;  5B2I D;  5AY8 D;  1P3I B;  3MNN A;  3WKJ C;  3WAA D;  5B0Y A;  3AFA D;  3AZM B;  1EQZ B;  1M1A C;  1ID3 B;  5B32 B;  3UTA D;  5AV6 C;  4J8V A;  3AZJ B;  5G49 A;  5B31 D;  3WKJ B;  5GT0 C;  5GT3 A;  3WAA C;  3AZM C;  5B1M A;  5AV9 A;  3UTB D;  3WTP B;  3REL A;  5GXQ C;  5AV8 A;  3AZG C;  1B6W A;  4G91 B;  1P3P B;  5B1L B;  3W97 D;  3W98 C;  3W99 B;  4J8X C;  5FUG A;  5AV6 B;  3AZJ C;  5F99 B;  4LD9 B;  3X1S A;  3KXB D;  3AZH B;  5CPK B;  3W99 C;  5CPJ D;  4QLC B;  2CV5 B;  3MGR B;  3A6N C;  3AYW B;  1M19 B;  3AN2 A;  3LZ1 C;  4J8W D;  2HIO C;  1AOI A;  4HGA B;  5B40 B;  4XUJ C;  4WNN B;  4WU8 A;  3MVD A;  3X1T C;  4KGC C;  1KX3 A;  3LEL D;  1ZLA D;  1M18 A;  4J8V B;  5C3I C;  1P3F A;  4KHA B;  4JJN A;  1P34 C;  2FJ7 C;  3MGP A;  3AZF C;  2FJ7 B;  3A6N D;  1HQ3 C;  5B32 G;  3AZH A;  5CPK A;  4YS3 D;  2NQB A;  5B31 G;  2BYK B;  3REL C;  5C3I B;  1S32 B;  5BT1 C;  3C1B C;  1M1A B;  3MGQ C;  5CPI A;  3WA9 A;  3AZI D;  3AZK B;  1BFM A;  4WU9 D;  1P3G C;  3NQU B;  5KDM B;  4JJN D;  4ZBJ C;  3O62 B;  3O62 D;  1KX3 D;  3AZN C;  5B32 A;  3MGP C;  1KX5 D;  3C1C D;  5AV5 B;  3MGQ B;  4WU8 D;  1WWS A;  3UTA C;  5B24 B;  1M1A D;  4DRA A;  1S32 D;  5AV9 B;  1H3O B;  2IO5 B;  5B31 B;  3MGP B;  3WKJ D;  1KX3 C;  1Q9C A;  5B24 A;  2HUE C;  5AY8 C;  5BNX B;  4J8U A;  3REI C;  5GSU D;  5B0Z B;  3A6N B;  3REH A;  1HQ3 A;  3AYW C;  1F66 C;  2ARO D;  1EQZ D;  3AZE A;  3AFA B;  2RVQ C;  5BNX A;  4J8U B;  5GT0 B;  1KX4 C;  4XUJ B;  4QLC A;  3REL D;  3MGR A;  1M19 A;  5DNN C;  3REJ A;  5AVB B;  3REK A;  1F66 B;  3AV1 C;  2FJ7 A;  5GXQ B;  3W98 B;  4WV4 B;  5B1L C;  3MGR D;  4AWL B;  1M19 D;  3AZF D;  1A7W A;  4QLC D;  1P3M C;  2PYO B;  3UTA A;  3B6G B;  3VH5 T;  3AZE D;  1P3O A;  4LD9 D;  3WAA A;  4EO5 B;  5B1M C;  2HIO D;  4J8U D;  4Z2M H;  5AY8 A;  3X1U C;  3MNN C;  3AV1 A;  1P3M D;  3WKJ A;  2HIO B;  3UTB B;  1S32 A;  3B0C W;  1M1A A;  3KUY C;  3AZM A;  4EO5 C;  3KXB C;  3B6G A;  2CV5 A;  5B32 D;  1U35 D;  2NZD D;  2RVQ D;  3KWQ B;  4Z66 D;  4NE6 A;  5GXQ D;  3W98 D;  3AN2 C;  1F66 D;  2F8N A;  5AVB D;  3AZI A;  4KUD A;  4E44 A;  2HUE B;  5AY8 B;  5B2I B;  3MVD C;  5B1L A;  5GT0 D;  3X1T A;  1ID3 A;  3LZ0 C;  2F8N H;  4Z66 B;  3LZ1 A;  3UT9 A;  1P3B A;  1B67 A;  2F8N K;  1U35 B;  4J8U C;  5G49 B;  3AV2 C;  4WU8 C;  5CP6 A;  5GXQ A;  3W98 A;  3MGP D;  3AZE C;  3MGS D;  3KWQ A;  3LZ0 B;  3LEL A;  3TU4 A;  1ZLA A;  4H9Q A;  4QLC C;  5B2J C;  5AV6 A;  5B40 A;  3MGQ D;  2ARO B;  5JRG C;  4J8W A;  1P3K A;  3V9R B;  3AZL C;  1P3G A;  3B6F A;  3WA9 B;  4WU9 B;  5CPJ A;  3AZN A;  5DNM C;  2PYO D;  3B0B A;  3V9R A;  4H9R A;  1P3O B;  4R8P C;  3AYW D;  1P3O D;  2BYK A;  4H9S A;  5JA4 B;  4YM6 B;  4KUD C;  2JSS A;  5DNN B;  3WA9 C;  1KX5 B;  1BH8 A;  5BNV B;  3REL B;  1P3P A;  4XUJ D;  1S32 C;  4KHA A;  4JJN B;  5F99 D;  2FJ7 D;  3WTP C;  5GT3 D;  4YM6 C;  3B6F B;  3AZI B;  4CAY B;  4J8V D;  3WTP E;  1P3P D;  4H9N A;  5B33 C;  4JJN C;  4G92 B;  2ARO A;  3AYW A;  5GSU A;  3REH D;  5DNN A;  3REJ C;  2PYO A;  3B6F C;  3UTA B;  5B24 D;  2BYM A;  3B6F D;  3KUY B;  5E5A A;  1KX3 B;  4HGA C;  3KXB B;  5B40 D;  5AV6 D;  3NQJ A;  1TAF A;  3C1C A;  4J8W B;  3R45 B;  4YM6 D;  3X1U D;  3WTP D;  3AN2 B;  3O62 A;  3KWQ D;  1P3A C;  2NZD B;  4H9O A;  4WU9 A;  5CPJ B;  5CP6 D;  4CSR A;  4LD9 C;  4H9S C;  3WA9 D;  3KUY A;  5B33 A;  5CHL B;  3LZ1 D;  3W96 D;  1ID3 D;  2CV5 C;  4H9P A;  4XZQ A;  4AWL C;  1P3M B;  2PYO C;  5B1L D;  5GT0 A;  3W97 B;  3AV1 D;  4H9Q B;  1P3I D;  4YS3 A;  2NQB D;  2F8N D;  4H9R B;  1P3I C;  1P3F D;  1N1J A;  4CAY A;  5AVC D;  2NZD A;  3W96 C;  5CPI B;  1U35 A;  4H9O B;  1EQZ C;  3AZG D;  3AZK A;  3B0C T;  1H3O A;  2CV5 D;  3W97 C;  1AOI D;  3AZM D;  5CP6 C;  4ZUX C;  1P3L A;  5B31 C;  4XZQ C;  5AV5 A;  1P3M A;  3UT9 C;  1P3B C;  3KWQ C;  5E5A B;  2HIO A;  4G91 C;  5B40 C;  3AFA C;  4LD9 A;  5B2J A;  3X1V B;  5GSU B;  5B0Z D;  1P3G B;  1ULY A;  3TU4 C;  4ZBJ B;  3O62 C;  1P3A A;  3UT9 B;  1P3B B;  3R45 A;  5AVB C;  5AV8 D;  3AZF A;  5AV9 D;  3UTB A;  3REI A;  4Z66 C;  5B24 C;  2NZD C;  5B31 A;  3REK D;  3C1B D;  1N1J B;  3REJ D;  3AV2 B;  3WAA B;  1P3P C;  1EQZ A;  1WWI A;  5GT3 C;  1HQ3 D;  5B0Y D;  4J8V C;  5AV8 B;  3MNN D;  3W99 A;  1P34 B;  3AZF B;  5DNM A;  1JFI B;  4Z5T B;  3VH6 A;  1KX4 B;  4KGC D;  2YFW B;  5AV5 C;  3VH6 T;  3AZL A;  3C1B A;  4YS3 B;  1TZY D;  5DNM B;  1JFI A;  4R8P D;  1P3O C;  1P3K B;  1KX5 A;  1P3F C;  5CPJ C;  3LEL B;  1ZLA B;  2NQB C;  5BS7 C;  4H9P B;  4XZQ B;  3AZG B;  3AZN B;  5CPI D;  5B1M B;  5B2J D;  4J8X D;  1P3F B;  5GSU C;  5FUG B;  3UTB C;  1R4V A;  3LJA D;  4WNN A;  4WU8 B;  2YFV A;  3AV1 B;  5AV5 D;  3C1C B;  4X23 D;  1P34 A;  3C1B B;  3AZH D;  2L5A A;  5CPK D;  1P3L D;  3A6N A;  3X1V A;  1M18 D;  3AZG A;  3AZK D;  3MVD D;  5CP6 B;  3C1C C;  2LY8 A;  3X1V D;  3X1U B;  3MVD B;  5B2I C;  3AN2 D;  1P3I A;  5E5A C;  3LJA A;  5AV9 C;  1P3A B;  3REH C;  4H9N B;  3W96 A;  4E45 A;  1U35 C;  5KDM A;  3VH6 W;  3X1S D;  3KXB A;  4J8X A;  3B6G C;  5B33 D;  3KUY D;  3REI B;  3LJA B;  2BYM B;  4YS3 C;  3W97 A;  3AZK C;  5BS7 A;  1M18 C;  5F99 C;  1HTA A;  3X1U A;  5B1M D;  4YM6 A;  3LEL C;  1ZLA C;  4R8P A;  3AZH C;  5CPK C;  3VH5 A;  2NQB B;  3AZL B;  3B0D B;  1F1E A;  5B33 B;  3X1S B;  5GT3 B;  1BH9 A;  4M6B A;  4G92 C;  1M18 B;  3W96 B;  4KGC A;  1KX4 A;  1TZY B;  5DNM D;  3AFA A;  2F8N G;  2IO5 C;  3B0D C;  3W99 D;  5BNV A;  5DNN D;  5B2I A;  3X1T B;  3NQJ B;  1KX4 D;  3KSY A;  4Z5T D;  2CWE A;  4KGC B;  3AZJ D;  5JRG A;  1P3K C;  1ID3 C;  4Z2M G;  4CSR B;  3X1V C;  3MGS C;  5F99 A;  3REI D;  1P3L B;  4XUJ A;  4X23 B;  3AV2 D;  1P3A D;  5B0Z A;  3LZ0 D;  3REH B;  2YFW A;  5B0Y C;  5B2J B;  4J8X B;  4ZUX A;  3MGS B;  1P3L C;  1KX5 C;  1BH9 B;  3AZN D;  4X23 C;  1KU5 A;  5JRG B;  3LJA C;  1BH8 B;  5BO0 A;  1P3G D;  1TAF B;  3MNN B;  3AZI C;  4WU9 C;  5B0Y B;  1P3K D;  5CPI C;  5B32 C;  3MGQ A;  5BO0 B;  4Z5T C;  5BT1 D;  4KUD B;  3TU4 D;  4NE5 A;  5AVC A;  3REJ B;  3NQU A;  4ZUX B;  3MGS A;  5B0Z C;  1TZY C;  1P34 D;  4X23 A;  2YFV B;  1HQ3 B; 
#chains in the Genus database with same CATH topology
 1W2E A;  3UT9 D;  1P3B D;  2UWX A;  4XZQ D;  3H0M C;  2F8N B;  4ZUX D;  4UUZ A;  3X1T D;  3LZ0 A;  3TU4 B;  4J8W C;  4KUD D;  1AOI C;  5AVB A;  3REK B;  4R8P B;  1F66 A;  3MGR C;  1M19 C;  3AV2 A;  4Z66 A;  3LZ1 B;  5AVC C;  2J8P A;  3WTP A;  5JA4 A;  3AZE B;  3VH5 W;  4NFT A;  3X1S C;  1TZY A;  1AOI B;  3B6G D;  3AZL D;  3REK C;  5JRG D;  3AZJ A;  2ARO C;  4NE3 A;  2Y2P A;  5AVC B;  5E5A D;  4WZS B;  4DRB A;  4Z5T A;  5AV8 C;  4UUZ B;  5B2I D;  5AY8 D;  3KFU G;  1P3I B;  3MNN A;  3WKJ C;  3WAA D;  5B0Y A;  3AFA D;  3AZM B;  1EQZ B;  1M1A C;  1ID3 B;  5B32 B;  3UTA D;  5AV6 C;  4J8V A;  3AZJ B;  5G49 A;  5B31 D;  3WKJ B;  5GT0 C;  5GT3 A;  3WAA C;  3AZM C;  5B1M A;  5AV9 A;  3UTB D;  3WTP B;  3REL A;  5GXQ C;  5AV8 A;  3AZG C;  1B6W A;  4G91 B;  1P3P B;  5B1L B;  3W97 D;  3W98 C;  3W99 B;  4J8X C;  5FUG A;  2Y2M A;  5AV6 B;  3AZJ C;  5F99 B;  4LD9 B;  3X1S A;  3KXB D;  3AZH B;  5CPK B;  3W99 C;  5CPJ D;  4QLC B;  2CV5 B;  3MGR B;  3A6N C;  3AYW B;  1M19 B;  3AN2 A;  3LZ1 C;  4J8W D;  2HIO C;  1AOI A;  4HGA B;  5B40 B;  4XUJ C;  4WNN B;  4WU8 A;  3MVD A;  3X1T C;  4KGC C;  4DQY B;  1KX3 A;  3LEL D;  1ZLA D;  1M18 A;  2RIQ A;  4J8V B;  5C3I C;  1P3F A;  4KHA B;  4JJN A;  1P34 C;  2FJ7 C;  3MGP A;  3AZF C;  2FJ7 B;  3A6N D;  1HQ3 C;  5B32 G;  3AZH A;  5CPK A;  4YS3 D;  2NQB A;  5B31 G;  2BYK B;  3REL C;  5C3I B;  1S32 B;  5BT1 C;  3C1B C;  1M1A B;  3AL0 C;  3MGQ C;  5CPI A;  3WA9 A;  2G5H C;  3AZI D;  3AZK B;  1BFM A;  4WU9 D;  1P3G C;  3NQU B;  5KDM B;  4JJN D;  4ZBJ C;  3O62 B;  3O62 D;  1KX3 D;  3AZN C;  5B32 A;  3MGP C;  1KX5 D;  3C1C D;  5AV5 B;  3MGQ B;  4WU8 D;  1WWS A;  3UTA C;  5B24 B;  1M1A D;  4DRA A;  3F6T A;  1S32 D;  5AV9 B;  1H3O B;  2IO5 B;  5B31 B;  3MGP B;  3WKJ D;  1KX3 C;  1Q9C A;  5B24 A;  2HUE C;  5AY8 C;  5BNX B;  4J8U A;  3REI C;  5GSU D;  5B0Z B;  3A6N B;  3REH A;  1HQ3 A;  3AYW C;  1F66 C;  2ARO D;  1EQZ D;  3AZE A;  3AFA B;  2RVQ C;  2Y2N A;  5BNX A;  4J8U B;  5GT0 B;  1KX4 C;  4XUJ B;  4QLC A;  3REL D;  2ZY4 A;  3MGR A;  5DNN C;  3REJ A;  1M19 A;  5AVB B;  3REK A;  1F66 B;  3AV1 C;  2FJ7 A;  5GXQ B;  3W98 B;  4WV4 B;  5B1L C;  2Y2G A;  2VQR A;  3MGR D;  4AWL B;  1M19 D;  3AZF D;  1A7W A;  4QLC D;  1P3M C;  2PYO B;  3UTA A;  3B6G B;  2DF4 C;  3VH5 T;  3AZE D;  3A1I A;  1P3O A;  4LD9 D;  3WAA A;  4EO5 B;  5B1M C;  2HIO D;  4J8U D;  4Z2M H;  5AY8 A;  3X1U C;  3MNN C;  3AV1 A;  1P3M D;  3WKJ A;  2HIO B;  3UTB B;  1S32 A;  3B0C W;  1M1A A;  3KUY C;  3AZM A;  4EO5 C;  3KXB C;  3B6G A;  2CV5 A;  5B32 D;  1U35 D;  2NZD D;  2RVQ D;  3KWQ B;  4Z66 D;  4NE6 A;  5GXQ D;  3W98 D;  3AN2 C;  2Y2K A;  1F66 D;  2ZY5 A;  2F8N A;  5AVB D;  3AZI A;  4KUD A;  4E44 A;  2HUE B;  5AY8 B;  5B2I B;  3MVD C;  5B1L A;  5GT0 D;  3X1T A;  1ID3 A;  3LZ0 C;  2F8N H;  4Z66 B;  3LZ1 A;  3UT9 A;  1P3B A;  1B67 A;  2F8N K;  3EPL A;  1U35 B;  4J8U C;  2FFF B;  5G49 B;  3AV2 C;  4WU8 C;  5CP6 A;  5GXQ A;  3W98 A;  3MGP D;  3AZE C;  3MGS D;  3KWQ A;  3LZ0 B;  3LEL A;  3TU4 A;  1ZLA A;  4H9Q A;  4QLC C;  5B2J C;  5AV6 A;  5B40 A;  3MGQ D;  2ARO B;  5JRG C;  4J8W A;  1P3K A;  3V9R B;  3AZL C;  1P3G A;  3B6F A;  3WA9 B;  4WU9 B;  5CPJ A;  3AZN A;  5DNM C;  2PYO D;  3B0B A;  3V9R A;  4H9R A;  1P3O B;  4R8P C;  3AYW D;  1P3O D;  2BYK A;  4H9S A;  5JA4 B;  4YM6 B;  4WJ3 C;  4KUD C;  2JSS A;  5DNN B;  3WA9 C;  1KX5 B;  1BH8 A;  5BNV B;  3REL B;  1P3P A;  4XUJ D;  1S32 C;  4KHA A;  4JJN B;  5F99 D;  2FJ7 D;  3WTP C;  5GT3 D;  4YM6 C;  3B6F B;  3AZI B;  4CAY B;  4J8V D;  3WTP E;  1P3P D;  4H9N A;  5B33 C;  1PZR A;  4JJN C;  4G92 B;  2ARO A;  3AYW A;  5GSU A;  3REH D;  5DNN A;  3REJ C;  2PYO A;  3B6F C;  3UTA B;  5B24 D;  2BYM A;  2Y2H A;  3B6F D;  3KUY B;  5E5A A;  2Y2I A;  1KX3 B;  4HGA C;  2F2A C;  3KXB B;  5B40 D;  5AV6 D;  3NQJ A;  1TAF A;  3C1C A;  4J8W B;  3R45 B;  4YM6 D;  3X1U D;  3WTP D;  3AN2 B;  3O62 A;  3KWQ D;  1P3A C;  2NZD B;  4H9O A;  4WU9 A;  5CPJ B;  5CP6 D;  4CSR A;  4LD9 C;  4H9S C;  3WA9 D;  1Z2C B;  3KUY A;  5B33 A;  5CHL B;  3LZ1 D;  3W96 D;  1ID3 D;  2CV5 C;  4H9P A;  4XZQ A;  4AWL C;  1P3M B;  2PYO C;  5B1L D;  5GT0 A;  3P5J B;  3W97 B;  3AV1 D;  4H9Q B;  1P3I D;  4YS3 A;  2NQB D;  2F8N D;  3FDD A;  4H9R B;  1P3I C;  1P3F D;  1N1J A;  3EG5 B;  4CAY A;  5AVC D;  2NZD A;  3W96 C;  2Y2J A;  5CPI B;  1U35 A;  4H9O B;  1EQZ C;  3AZG D;  3AZK A;  3B0C T;  1H3O A;  2CV5 D;  3W97 C;  2DQN C;  1AOI D;  3AZM D;  5CP6 C;  4ZUX C;  1P3L A;  5B31 C;  4XZQ C;  5AV5 A;  1P3M A;  3UT9 C;  1P3B C;  2JE5 A;  3KWQ C;  5E5A B;  2HIO A;  4G91 C;  5B40 C;  3AFA C;  4LD9 A;  5B2J A;  3X1V B;  2Y2Q A;  3H0R C;  5GSU B;  5B0Z D;  1P3G B;  1ULY A;  3TU4 C;  4ZBJ B;  3O62 C;  1P3A A;  3UT9 B;  1P3B B;  3R45 A;  5AVB C;  5AV8 D;  3AZF A;  1T3U A;  5AV9 D;  3UTB A;  3REI A;  4Z66 C;  3A1K A;  5B24 C;  2NZD C;  5B31 A;  3REK D;  3C1B D;  1N1J B;  3REJ D;  3AV2 B;  2JCH A;  2ZY2 A;  3WAA B;  4UPK A;  1P3P C;  1EQZ A;  1WWI A;  5GT3 C;  1HQ3 D;  5B0Y D;  4J8V C;  5AV8 B;  3MNN D;  3W99 A;  1P34 B;  3AZF B;  5DNM A;  1JFI B;  4Z5T B;  3VH6 A;  1KX4 B;  4KGC D;  2YFW B;  5AV5 C;  3VH6 T;  3AZL A;  3C1B A;  4YS3 B;  1TZY D;  5DNM B;  1JFI A;  4R8P D;  1P3O C;  1P3K B;  1KX5 A;  1P3F C;  5CPJ C;  2BG1 A;  3LEL B;  1ZLA B;  2NQB C;  5BS7 C;  4H9P B;  4XZQ B;  3AZG B;  3AZN B;  5CPI D;  5B1M B;  5B2J D;  4J8X D;  1P3F B;  2ZY3 A;  5GSU C;  5FUG B;  3UTB C;  1R4V A;  3H0L C;  3LJA D;  4WNN A;  4WU8 B;  2YFV A;  3AV1 B;  5AV5 D;  3C1C B;  4X23 D;  1P34 A;  2XD1 A;  3C1B B;  3AZH D;  2L5A A;  5CPK D;  1P3L D;  3A6N A;  3X1V A;  1M18 D;  3AZG A;  3AZK D;  3MVD D;  5CP6 B;  3C1C C;  2LY8 A;  2G5I C;  2Y2O A;  3X1V D;  3X1U B;  5B2I C;  3MVD B;  3AN2 D;  1P3I A;  5E5A C;  3LJA A;  5AV9 C;  1P3A B;  3REH C;  4H9N B;  3W96 A;  4E45 A;  1U35 C;  5KDM A;  3VH6 W;  3X1S D;  3KXB A;  4J8X A;  3B6G C;  5B33 D;  3EPH A;  3KUY D;  3REI B;  3LJA B;  2BYM B;  4YS3 C;  3W97 A;  3AZK C;  5BS7 A;  1M18 C;  5F99 C;  3X1U A;  1HTA A;  5B1M D;  4YM6 A;  2ZM5 A;  3LEL C;  1ZLA C;  4R8P A;  3AZH C;  5CPK C;  3VH5 A;  2NQB B;  3AZL B;  3B0D B;  1F1E A;  5B33 B;  3X1S B;  5GT3 B;  1BH9 A;  4M6B A;  4G92 C;  1M18 B;  3W96 B;  4KGC A;  1KX4 A;  1TZY B;  5DNM D;  3AFA A;  2F8N G;  2IO5 C;  3B0D C;  3W99 D;  5BNV A;  5DNN D;  5B2I A;  3X1T B;  3NQJ B;  1KX4 D;  3KSY A;  4Z5T D;  2CWE A;  4KGC B;  3AZJ D;  5JRG A;  3IP4 C;  1P3K C;  1ID3 C;  4Z2M G;  4CSR B;  3X1V C;  3MGS C;  5F99 A;  3REI D;  1P3L B;  4XUJ A;  4X23 B;  3AV2 D;  1P3A D;  5B0Z A;  3LZ0 D;  3REH B;  2YFW A;  5B0Y C;  5B2J B;  4J8X B;  4ZUX A;  3MGS B;  1P3L C;  1KX5 C;  1BH9 B;  2XD5 A;  3AZN D;  4X23 C;  1KU5 A;  5JRG B;  2W8S A;  3LJA C;  1BH8 B;  5BO0 A;  1P3G D;  1TAF B;  3MNN B;  3AZI C;  4WU9 C;  5B0Y B;  1P3K D;  5CPI C;  5B32 C;  3MGQ A;  5BO0 B;  4Z5T C;  5BT1 D;  4KUD B;  2Y2L A;  3TU4 D;  4NE5 A;  5AVC A;  3EPJ A;  3EPK A;  3NQU A;  3REJ B;  4ZUX B;  3MGS A;  5B0Z C;  1TZY C;  1P34 D;  4X23 A;  2YFV B;  1HQ3 B; 
#chains in the Genus database with same CATH homology
 1W2E A;  3UT9 D;  1P3B D;  2UWX A;  4XZQ D;  3H0M C;  2F8N B;  4ZUX D;  4UUZ A;  3X1T D;  3LZ0 A;  3TU4 B;  4J8W C;  4KUD D;  1AOI C;  5AVB A;  3REK B;  4R8P B;  1F66 A;  3MGR C;  1M19 C;  3AV2 A;  4Z66 A;  3LZ1 B;  5AVC C;  2J8P A;  3WTP A;  5JA4 A;  3AZE B;  3VH5 W;  4NFT A;  3X1S C;  1TZY A;  1AOI B;  3B6G D;  3AZL D;  3REK C;  5JRG D;  3AZJ A;  2ARO C;  4NE3 A;  2Y2P A;  5AVC B;  5E5A D;  4WZS B;  4DRB A;  4Z5T A;  5AV8 C;  4UUZ B;  5B2I D;  5AY8 D;  3KFU G;  1P3I B;  3MNN A;  3WKJ C;  3WAA D;  5B0Y A;  3AFA D;  3AZM B;  1EQZ B;  1M1A C;  1ID3 B;  5B32 B;  3UTA D;  5AV6 C;  4J8V A;  3AZJ B;  5G49 A;  5B31 D;  3WKJ B;  5GT0 C;  5GT3 A;  3WAA C;  3AZM C;  5B1M A;  5AV9 A;  3UTB D;  3WTP B;  3REL A;  5GXQ C;  5AV8 A;  3AZG C;  1B6W A;  4G91 B;  1P3P B;  5B1L B;  3W97 D;  3W98 C;  3W99 B;  4J8X C;  5FUG A;  2Y2M A;  5AV6 B;  3AZJ C;  5F99 B;  4LD9 B;  3X1S A;  3KXB D;  3AZH B;  5CPK B;  3W99 C;  5CPJ D;  4QLC B;  2CV5 B;  3MGR B;  3A6N C;  3AYW B;  1M19 B;  3AN2 A;  3LZ1 C;  4J8W D;  2HIO C;  1AOI A;  4HGA B;  5B40 B;  4XUJ C;  4WNN B;  4WU8 A;  3MVD A;  3X1T C;  4KGC C;  4DQY B;  1KX3 A;  3LEL D;  1ZLA D;  1M18 A;  2RIQ A;  4J8V B;  5C3I C;  1P3F A;  4KHA B;  4JJN A;  1P34 C;  2FJ7 C;  3MGP A;  3AZF C;  2FJ7 B;  3A6N D;  1HQ3 C;  5B32 G;  3AZH A;  5CPK A;  4YS3 D;  2NQB A;  5B31 G;  2BYK B;  3REL C;  5C3I B;  1S32 B;  5BT1 C;  3C1B C;  1M1A B;  3AL0 C;  3MGQ C;  5CPI A;  3WA9 A;  2G5H C;  3AZI D;  3AZK B;  1BFM A;  4WU9 D;  1P3G C;  3NQU B;  5KDM B;  4JJN D;  4ZBJ C;  3O62 B;  3O62 D;  1KX3 D;  3AZN C;  5B32 A;  3MGP C;  1KX5 D;  3C1C D;  5AV5 B;  3MGQ B;  4WU8 D;  1WWS A;  3UTA C;  5B24 B;  1M1A D;  4DRA A;  3F6T A;  1S32 D;  5AV9 B;  1H3O B;  2IO5 B;  5B31 B;  3MGP B;  3WKJ D;  1KX3 C;  1Q9C A;  5B24 A;  2HUE C;  5AY8 C;  5BNX B;  4J8U A;  3REI C;  5GSU D;  5B0Z B;  3A6N B;  3REH A;  1HQ3 A;  3AYW C;  1F66 C;  2ARO D;  1EQZ D;  3AZE A;  3AFA B;  2RVQ C;  2Y2N A;  5BNX A;  4J8U B;  5GT0 B;  1KX4 C;  4XUJ B;  4QLC A;  3REL D;  2ZY4 A;  3MGR A;  5DNN C;  3REJ A;  1M19 A;  5AVB B;  3REK A;  1F66 B;  3AV1 C;  2FJ7 A;  5GXQ B;  3W98 B;  4WV4 B;  5B1L C;  2Y2G A;  2VQR A;  3MGR D;  4AWL B;  1M19 D;  3AZF D;  1A7W A;  4QLC D;  1P3M C;  2PYO B;  3UTA A;  3B6G B;  2DF4 C;  3VH5 T;  3AZE D;  3A1I A;  1P3O A;  4LD9 D;  3WAA A;  4EO5 B;  5B1M C;  2HIO D;  4J8U D;  4Z2M H;  5AY8 A;  3X1U C;  3MNN C;  3AV1 A;  1P3M D;  3WKJ A;  2HIO B;  3UTB B;  1S32 A;  3B0C W;  1M1A A;  3KUY C;  3AZM A;  4EO5 C;  3KXB C;  3B6G A;  2CV5 A;  5B32 D;  1U35 D;  2NZD D;  2RVQ D;  3KWQ B;  4Z66 D;  4NE6 A;  5GXQ D;  3W98 D;  3AN2 C;  2Y2K A;  1F66 D;  2ZY5 A;  2F8N A;  5AVB D;  3AZI A;  4KUD A;  4E44 A;  2HUE B;  5AY8 B;  5B2I B;  3MVD C;  5B1L A;  5GT0 D;  3X1T A;  1ID3 A;  3LZ0 C;  2F8N H;  4Z66 B;  3LZ1 A;  3UT9 A;  1P3B A;  1B67 A;  2F8N K;  3EPL A;  1U35 B;  4J8U C;  2FFF B;  5G49 B;  3AV2 C;  4WU8 C;  5CP6 A;  5GXQ A;  3W98 A;  3MGP D;  3AZE C;  3MGS D;  3KWQ A;  3LZ0 B;  3LEL A;  3TU4 A;  1ZLA A;  4H9Q A;  4QLC C;  5B2J C;  5AV6 A;  5B40 A;  3MGQ D;  2ARO B;  5JRG C;  4J8W A;  1P3K A;  3V9R B;  3AZL C;  1P3G A;  3B6F A;  3WA9 B;  4WU9 B;  5CPJ A;  3AZN A;  5DNM C;  2PYO D;  3B0B A;  3V9R A;  4H9R A;  1P3O B;  4R8P C;  3AYW D;  1P3O D;  2BYK A;  4H9S A;  5JA4 B;  4YM6 B;  4WJ3 C;  4KUD C;  2JSS A;  5DNN B;  3WA9 C;  1KX5 B;  1BH8 A;  5BNV B;  3REL B;  1P3P A;  4XUJ D;  1S32 C;  4KHA A;  4JJN B;  5F99 D;  2FJ7 D;  3WTP C;  5GT3 D;  4YM6 C;  3B6F B;  3AZI B;  4CAY B;  4J8V D;  3WTP E;  1P3P D;  4H9N A;  5B33 C;  1PZR A;  4JJN C;  4G92 B;  2ARO A;  3AYW A;  5GSU A;  3REH D;  5DNN A;  3REJ C;  2PYO A;  3B6F C;  3UTA B;  5B24 D;  2BYM A;  2Y2H A;  3B6F D;  3KUY B;  5E5A A;  2Y2I A;  1KX3 B;  4HGA C;  2F2A C;  3KXB B;  5B40 D;  5AV6 D;  3NQJ A;  1TAF A;  3C1C A;  4J8W B;  3R45 B;  4YM6 D;  3X1U D;  3WTP D;  3AN2 B;  3O62 A;  3KWQ D;  1P3A C;  2NZD B;  4H9O A;  4WU9 A;  5CPJ B;  5CP6 D;  4CSR A;  4LD9 C;  4H9S C;  3WA9 D;  1Z2C B;  3KUY A;  5B33 A;  5CHL B;  3LZ1 D;  3W96 D;  1ID3 D;  2CV5 C;  4H9P A;  4XZQ A;  4AWL C;  1P3M B;  2PYO C;  5B1L D;  5GT0 A;  3P5J B;  3W97 B;  3AV1 D;  4H9Q B;  1P3I D;  4YS3 A;  2NQB D;  2F8N D;  3FDD A;  4H9R B;  1P3I C;  1P3F D;  1N1J A;  3EG5 B;  4CAY A;  5AVC D;  2NZD A;  3W96 C;  2Y2J A;  5CPI B;  1U35 A;  4H9O B;  1EQZ C;  3AZG D;  3AZK A;  3B0C T;  1H3O A;  2CV5 D;  3W97 C;  2DQN C;  1AOI D;  3AZM D;  5CP6 C;  4ZUX C;  1P3L A;  5B31 C;  4XZQ C;  5AV5 A;  1P3M A;  3UT9 C;  1P3B C;  2JE5 A;  3KWQ C;  5E5A B;  2HIO A;  4G91 C;  5B40 C;  3AFA C;  4LD9 A;  5B2J A;  3X1V B;  2Y2Q A;  3H0R C;  5GSU B;  5B0Z D;  1P3G B;  1ULY A;  3TU4 C;  4ZBJ B;  3O62 C;  1P3A A;  3UT9 B;  1P3B B;  3R45 A;  5AVB C;  5AV8 D;  3AZF A;  1T3U A;  5AV9 D;  3UTB A;  3REI A;  4Z66 C;  3A1K A;  5B24 C;  2NZD C;  5B31 A;  3REK D;  3C1B D;  1N1J B;  3REJ D;  3AV2 B;  2JCH A;  2ZY2 A;  3WAA B;  4UPK A;  1P3P C;  1EQZ A;  1WWI A;  5GT3 C;  1HQ3 D;  5B0Y D;  4J8V C;  5AV8 B;  3MNN D;  3W99 A;  1P34 B;  3AZF B;  5DNM A;  1JFI B;  4Z5T B;  3VH6 A;  1KX4 B;  4KGC D;  2YFW B;  5AV5 C;  3VH6 T;  3AZL A;  3C1B A;  4YS3 B;  1TZY D;  5DNM B;  1JFI A;  4R8P D;  1P3O C;  1P3K B;  1KX5 A;  1P3F C;  5CPJ C;  2BG1 A;  3LEL B;  1ZLA B;  2NQB C;  5BS7 C;  4H9P B;  4XZQ B;  3AZG B;  3AZN B;  5CPI D;  5B1M B;  5B2J D;  4J8X D;  1P3F B;  2ZY3 A;  5GSU C;  5FUG B;  3UTB C;  1R4V A;  3H0L C;  3LJA D;  4WNN A;  4WU8 B;  2YFV A;  3AV1 B;  5AV5 D;  3C1C B;  4X23 D;  1P34 A;  2XD1 A;  3C1B B;  3AZH D;  2L5A A;  5CPK D;  1P3L D;  3A6N A;  3X1V A;  1M18 D;  3AZG A;  3AZK D;  3MVD D;  5CP6 B;  3C1C C;  2LY8 A;  2G5I C;  2Y2O A;  3X1V D;  3X1U B;  5B2I C;  3MVD B;  3AN2 D;  1P3I A;  5E5A C;  3LJA A;  5AV9 C;  1P3A B;  3REH C;  4H9N B;  3W96 A;  4E45 A;  1U35 C;  5KDM A;  3VH6 W;  3X1S D;  3KXB A;  4J8X A;  3B6G C;  5B33 D;  3EPH A;  3KUY D;  3REI B;  3LJA B;  2BYM B;  4YS3 C;  3W97 A;  3AZK C;  5BS7 A;  1M18 C;  5F99 C;  3X1U A;  1HTA A;  5B1M D;  4YM6 A;  2ZM5 A;  3LEL C;  1ZLA C;  4R8P A;  3AZH C;  5CPK C;  3VH5 A;  2NQB B;  3AZL B;  3B0D B;  1F1E A;  5B33 B;  3X1S B;  5GT3 B;  1BH9 A;  4M6B A;  4G92 C;  1M18 B;  3W96 B;  4KGC A;  1KX4 A;  1TZY B;  5DNM D;  3AFA A;  2F8N G;  2IO5 C;  3B0D C;  3W99 D;  5BNV A;  5DNN D;  5B2I A;  3X1T B;  3NQJ B;  1KX4 D;  3KSY A;  4Z5T D;  2CWE A;  4KGC B;  3AZJ D;  5JRG A;  3IP4 C;  1P3K C;  1ID3 C;  4Z2M G;  4CSR B;  3X1V C;  3MGS C;  5F99 A;  3REI D;  1P3L B;  4XUJ A;  4X23 B;  3AV2 D;  1P3A D;  5B0Z A;  3LZ0 D;  3REH B;  2YFW A;  5B0Y C;  5B2J B;  4J8X B;  4ZUX A;  3MGS B;  1P3L C;  1KX5 C;  1BH9 B;  2XD5 A;  3AZN D;  4X23 C;  1KU5 A;  5JRG B;  2W8S A;  3LJA C;  1BH8 B;  5BO0 A;  1P3G D;  1TAF B;  3MNN B;  3AZI C;  4WU9 C;  5B0Y B;  1P3K D;  5CPI C;  5B32 C;  3MGQ A;  5BO0 B;  4Z5T C;  5BT1 D;  4KUD B;  2Y2L A;  3TU4 D;  4NE5 A;  5AVC A;  3EPJ A;  3EPK A;  3NQU A;  3REJ B;  4ZUX B;  3MGS A;  5B0Z C;  1TZY C;  1P34 D;  4X23 A;  2YFV B;  1HQ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...