1BFVH

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
QVQLQESGGGLVNLGGSMTLSCVASGFTFNTYYMSWVRQTPEKTLELVAAINSDGEPIYYPDTLKGRVTISRDNAKKTLYLQMSSLNFEDTALYYCARLNYAVYGMDYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords FV4155
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 1997-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bfvH00
5KBNC 4KI5F 3AAZA 1H3XA 4KQ3H 1UJTA 3NACH 3SE3C 4ZO8A 5JPMB 1ZA3A 2I27N 4MLIA 4POZD 3HMXH 1MCOH 5GGVY 3QIUD 1BHGA 2Y5EA 3UXFA 1VADB 6CGTA 3MREB 3OXRA 4RX4D 1CDJA 3WO3B 2NY4C 4K7PH 3SKJH 3DSFH 5FA4B 5ID1B 4HXAH 1WK0A 1B0WA 2CMRL 4Y19B 4NO0D 4K07A 2Q7YA 2DQUL 1CXEA 4ZUWB 1Q0YL 2ZCLL 2JF1A 1AXIB 1QLEH 2VXTL 3RGHA 4L5FH 5IUSA 2V2XA 4MX7A 5E8PA 5T3ZL 4XWGH 2PXYD 5MEPB 2E27H 3ARBB 3KPRB 4GMSH 5DFVC 4TOYH 4BK4A 3HNTH 5HYSG 3CSYA 3GKWL 2BCKA 5L6YH 2HFFB 1JWUB 1NSNH 3NIGF 1AIFA 3NZHH 3QEHB 1ETZB 5DDHB 5K9KA 2HKHL 1BBDH 5DZNA 4RFNC 1AFVL 5GRVK 5E8NB 1TQBC 4EI5B 1AXSA 4FXKB 3WHXB 3C6LA 4S2SB 1QSFD 1UB6B 5C0ND 5GXBB 5F9WB 4XMKH 4OI7A 2VITB 1IBGL 3FQWB 1BJMA 3TN0D 3O8XA 3PNWB 2DJUA 2Y07H 5GIRA 2DN7A 5DGRA 4FP8H 3TZVC 3ARED 3DHJA 5F97E 1GGBL 2ESVA 5BV7H 1MCLA 3MLVL 1T80A 3MRNB 4IRJC 4AEFA 3G9AB 3U7WH 5D96C 1WEJL 4NOBA 2HT4C 5F8RC 5CSZA 4NKIH 2A83B 5F9AC 1P53A 2JKXA 4GKNA 4JKKA 4OLVH 2CO7B 3D9AH 2FJFA 2C4XA 4XTRD 3CVIL 4G8EA 4JAMA 3W9DA 1Z3GH 2BVOA 3O2WH 3IXTB 1BVLA 4UIMB 2DWEA 2OQJA 3RPKA 1YEKH 2UWEB 2X6MA 3WKML 2YS4A 4YH6A 1IAKA 4AQ1B 3L5WA 4EBQL 1A6WL 2MCG1 1XR8A 2C3GA 3MNZA 3DWTA 3CPLB 5DEGA 5DRZB 5I19H 1PD6A 3BPOC 2Q86A 2C4FU 3RX8A 4WW1A 3B5TA 2DTMH 4WEUD 3SDAC 4L9LA 4IMLB 1JI2A 4X6CB 4ZODA 5CD3B 1S7UA 4YDJB 3L3OA 3HAEG 4X6DE 2AEPL 2GJ6A 4G9FB 5GZNC 4JO2L 5I1JL 3UO1L 1DBMH 1Q72H 4WUUE 4WUUD 2YEZB 4E41D 3LKOA 3O2WL 3MJ9L 4MJ6B 5IFAL 4TTDD 1DVFA 2X4UB 4BELD 4QYOB 4PJFB 1OQOA 4OV6F 1UG9A 5DJ0B 1FFQA 1A2YB 1CGTA 1S7XB 1MVFA 4NKOB 2I60H 3LDBC 3PGDA 3PDDA 4FN0A 5A2KH 1JGLL 4LSVH 2EDJA 5T5FL 5C0CA 4HIJA 4HWBA 1KNOB 4UDTA 4WUUB 3ILQD 5MHSE 4D3CL 3JVGC 4JDVB 2FHFA 2CDFB 2XZAH 4BSVA 3W0WE 2IC2A 1JPTL 1ONQA 4FFYH 3RI5F 4DKFL 1FZOA 2J8UA 1XIWB 4S1RL 2HMID 3KR3L 3FN9A 4H25B 1QBBA 2AEWA 2ERJB 4G3YH 1AO7D 1SJVA 1T7WA 5ACMA 4HFWB 3WD5L 1BM3H 4Y2OA 4OCYH 4XNZB 4G9FE 2N4IA 1N64L 4HPOH 1BQHA 4KTEL 2A38A 3VXSA 1KJ3H 1YN6A 3Q0HA 4WFHD 2E8YA 2AJSH 5I17B 4M93C 4PJGF 2ZUWA 4OLEA 3PWPD 3QUXA 1P9MC 4PP2B 1XGUB 3KPOA 4WI9A 3WV0A 1I7ZB 2FH6A 1EJ6A 2VABB 1SEBB 4QCIA 1G7IA 1C12B 5C0AE 3KWWB 1YPZA 3DX9A 1VENA 4XNUL 2XOTA 4XAKD 4JPVL 3THML 4TQEL 5HJ3B 4MMZC 1BLNB 4OCWH 5T33L 1FVCB 3HZKB 4ZXBA 1WAAF 2MQ3A 3ARBA 2JJSC 3KPRA 5D1ZC 3HI6H 3G6DL 1JNLH 5B8CB 2CUIA 1UWEH 2ADIB 4I3RL 2R1YA 4Z7QE 4ELKB 3ALWA 3JWDC 3QEHA 5DDHA 3MV8B 1NANH 4XPBH 5B39G 4PJ9D 1C1EH 3HS0A 1Q0YH 3WFBH 1EFXB 1H5BC 5FUOL 4N0UB 4YHNB 4HKZB 3P9MB 4AMKL 5HYJA 5ABDE 4NZJA 4OLZH 3NIFE 1HHIB 1GL4B 1CDHA 1A6ZB 2W91A 2P5ED 3BGAA 4OZFA 4PJ5E 3C8HA 4ZOCA 1F42A 3LMJL 5SX4I 3OKOB 4K94L 4GKOA 4PJAF 4BQBA 3BSZL 1KPUA 4LIQE 1OD7A 5D7KE 3MRLA 3S36X 4PRHB 4EN3C 2D3VA 4JM2B 5EOTA 4JO4L 3C2AH 5IEKA 1MJJB 4K23L 3M1BA 2BVQB 5T1MA 2LAAA 4FFZL 4PGZA 4DN4H 2HKFL 1BVLB 2DICA 2X7LB 4X6EB 5F7YC 2WW8A 4NYLB 1F3DJ 2GSIA 1E4WH 1FVDB 3L5WB 2W0LA 3KLHC 4YJZL 1DSFL 4OF8A 4OLWL 1AO7A 1OP9A 2Z31B 3CFKA 3UJJH 4Y8DC 3WFEL 5EOQL 4YR6A 2R8SH 5C1MB 2D4DA 3V6ZA 5C0GB 4NRZA 4JDTL 5KSAB 1E4XH 2ICES 4HCRH 4KAQH 3WFCL 4ODTH 4TUOB 4EQ2A 1RJLA 1SJHA 1ZGLP 1O5DT 4XWOD 1ZGLB 4M7LH 1DBJH 2UWEF 3H8NA 3GM8A 2BSSB 4OZFH 2ZUTA 4TRPH 3FRUB 3SDAA 4LSSH 4FA8A 2D7PA 2IANE 5CJ8A 5D7LD 1CL7L 3VWJD 1DUYA 2OYPA 2A74B 1DE4B 1BWWA 2H26A 3F7PC 3N85L 3PJSA 1XAUA 1MAMH 4X80L 3HAEA 4WRLA 4PJ7A 5D4QA 5CKGA 1U8HB 2VXSL 2AJZB 1IC4L 1ES0B 3JWOH 3DUSB 2J8UB 2AP2A 3MSPA 3T65A 1HOCA 1QLFA 2AV7A 3JZ7A 2BOBB 1D5XB 1RK1A 2P8MB 5ISZB 2FCBA 1CFQA 3WNMA 1SVCP 3PHQB 1JWMA 3ARWA 4ETQB 2EDRA 2XA8L 4P3CL 4CMHC 1MRFH 5CZVL 3JV6A 4M4RA 5TDPA 4KKCC 2D7MA 4M62L 1NFIB 3PWVB 2HLAB 1CTOA 5HVHB 1MAML 4JVPA 1LQSR 4JFYA 1MJ7L 4LAQH 2G5BB 2VXSH 1ZLUH 5I17A 3KR3H 4RIRB 3PABA 3MLSL 3MLXH 1KJ2H 3T04D 1BFSA 4GS7C 1XGUA 3MNVB 4RGNB 1FN4B 4OQTH 3VMOA 1J7VR 3WD5H 1A7OH 3IU3B 5K33A 5DF0A 2IJ0C 4R96B 4Q6IA 4RMVA 5ADOL 3VG9B 3O8XD 3GMNA 2O5ZH 5SWZB 2CDEA 3GMLB 3MRQA 5GS2D 3RIAF 3D48R 4ZS6D 1U6AH 3WEXA 1OGTB 1W0VA 2V5RA 2X4SB 3C08L 4KKAC 5CWSA 1QFWL 4OFYD 4GXUN 3S4SG 2YD7A 5C08E 1A1NA 1OSZB 4XMPL 5DURD 3RWGA 2E9BA 1OLLA 2AJVH 4XCNA 3FKUS 3VD7A 5D7JB 1LEGB 2BNRB 4JLRA 4PJ5A 5F1KC 3WFDL 1PVHA 4XNQA 5F7MC 5CP7B 1MQKH 4XMKL 3IJHA 2C1PB 1LE9A 4TSAH 4MLSA 3WLWC 1RUMH 3LEVL 5DMYA 1E28A 2Y07L 4OBSA 5ECJE 4JFXB 4N0YL 3MLVH 4RMUA 4YDKL 1G0DA 1SHMA 3QUMH 5F44A 3MBEC 4NKIL 4EXKA 1PZ5B 3MUHL 4RDQG 3QNZB 1DQLL 5DRNB 5CBEA 3DIFA 1INEH 4M1CD 1UXSA 3MNWA 3LRHA 4K3JH 1QEWA 4MZ3A 1KCKA 1RZJC 4LFHD 3H9SD 4Y2DC 4YE4H 4Q2ZB 3IKCB 3J8F7 1PG7H 1H15A 3O6KL 1RUPH 4PJ9C 3VW3H 5F9JB 3AU1B 1MHPL 3LN5B 2VLJD 3BGMA 4P23C 1WZKA 4F58L 4YHIB 2HJLA 5TE7H 5J1AA 1CFNB 1P5VA 3BSZH 3MRCB 3SBWC 1WBYA 1Y6MR 4MJIB 1FVEB 5JQ6L 2WIIA 1A5FL 3QIWD 2CR6A 5D8JL 3UC0L 4XVUC 2DWDA 2F5AL 1G7HB 5JR1L 3WFHA 4KKCD 4PYHA 1QR1A 3RVWD 5AYUL 5HYEA 3V0VB 5FYJE 3TYGH 3BAEL 1VADA 3IDNA 1D9KD 1I3GH 1PEWA 4PJDF 1FDLL 4YDVB 3N1MC 1I3UA 1WAAE 1QTYT 5TF0A 2AKRA 3W2DH 1Z9LA 2WUBH 3QI9D 2R0ZH 2WM0A 3HR5A 3MGOB 4HHAA 2HTKC 4XNMB 2XWTB 4PG2C 3TVMB 2G75A 4F7EB 4MAYA 2QR0A 4JFQA 3HNVL 5HHPB 3CD4A 4UTBH 3MRIA 1AHWC 1TDQA 2VDNL 3GSNH 3K1KC 3MLZH 5AUMA 2IH1B 1P4LA 3QUZD 5LWYH 4XPGH 2FL5A 3ZKNC 3T0EB 2NCMA 4PJEE 4KDWA 5IB4B 1Z6JT 3NCBB 4AH2B 5KTEH 3MLYH 1DLHA 1BEYL 2R0ZL 4U05A 3RWHA 4XWOC 4PYGA 4D0DA 3U6RB 2F5BL 4K8RH 1T89C 5T1DH 1HE7A 3GBLA 4A6YA 2YWYA 2P1YA 5BZDB 3T3ME 3C6LB 4LPUA 3DVIA 5BVJA 5F3BA 1FAKT 4G7YL 5I2IA 2YUWA 3SO5A 3H9YA 1DN0B 3GSQB 2X4OB 2IAMA 3MRKB 1F4YL 3CH1B 1PFCA 3RVVD 3KXFE 5CD5C 4K3GA 1T0MB 4X0KA 3SKNA 3MNVA 4MZ2A 4NJ9H 1YYLL 1ITCA 5E1AB 3SE9H 5HYSB 4RZCA 5IR1A 4WI5A 3TPUA 1RULH 3QPXL 2FB4L 2HVKB 4P2OB 1RUQH 3TJEL 1G7PB 5SWZA 3GM0A 2MQCA 1IEAA 4LDEB 1BF8A 1KCSH 4HBQA 3GHBH 1EEZA 4L4JA 1RUAH 3LKSB 4PJDE 4ZUTB 1J05B 2BNUB 5E9DA 3TFKC 5KS9B 3FT2B 4PTUB 4QXUL 1I1AD 3EJZC 5C9JB 4NHCH 4U1SA 1T3FB 1YYLH 3V2AR 2BNRA 3U4BH 4HJJH 4JRXA 1IGJB 4R3SA 3H9ZA 1N3NA 1Q9OB 1HXYA 2E9WA 3CSPA 4XNQB 3UBXI 4ACPA 4DJMA 3VMPA 3VG9C 3LSOB 3R06B 3IDXH 1MFBL 4NC0B 1IM9A 4PREA 5C3LD 1Y6NR 2M1KA 3VG0L 4JG1L 1QYGH 4G8IB 5CIPA 4KUZL 1GCFA 2JCCF 2ITCB 4OD2A 3T2QA 2CSPA 5A43C 3TN0B 4ZNEA 4OZGA 3QI9C 1IZKA 4LNRB 1ZS8A 4I1NB 4RGOL 4M61A 5FGCE 2DQFA 4FOMA 2J3SA 5D6CB 4HIJB 2YPVL 3WE6B 2CMRH 4LASL 3QDGD 5B39A 4I0PC 4JFFD 3TA3C 4Z7WE 3T1FB 1I1RA 2J4WH 3RVWC 2ZCLH 2DQIL 3QUZC 1DLFH 2GT9B 5JHDB 4RFOL 4P2RB 4NQTA 4L5FL 5DZLA 4Y1AE 4JR9L 1XF2B 1QRND 4QWWD 3MRDA 5FKAA 5IKCA 4WV1C 1X5ZA 1HI6A 5D1QB 1LD9B 3EOTL 1JGUL 1CDUA 2F9BT 1NKOA 4ONFL 1UM5L 5HGHB 1D5MA 3C5SA 4EKXA 2VLRA 3QEQE 1GGYA 4JHAL 4GBXD 5DMJB 5IB3B 2A9NL 4L8CA 3BZ4A 3VFVB 5CEZH 3QNXB 3GMOA 3L5JA 5IIEB 1J5OH 5L88L 2ILLA 3ZDYF 2N7BA 2D9QB 1YNTB 2GAZB 1GC1C 2VDML 4M3JA 1P4IH 5TE7L 1NUNB 1OCWH 2DDQH 5CS7A 5CJOH 1XF3B 1YNLL 1EZVY 4LCIH 2W9EH 4J3UA 4BQ6A 3HKFA 1IEHA 1A4JB 4MA3A 4JHAH 5TPWL 1U8QB 5E5MA 4PJFF 5K9QI 3MUY1 1QSVA 2ICWJ 2BP3A 4R90H 2JJVA 3VGFA 3TESA 3DROB 2KUTA 4OF5A 4AH2A 1F45A 1F97A 2CLZA 3NFPB 4MD4B 3C5JB 1U8JB 3BPCA 3HFML 1FGNL 1IAMA 1Y18A 1HHHB 3MJGX 3MR9B 4NP4L 5IW1A 3T0WA 3QJFB 5JOPD 5JMRA 3QG6B 1U8IA 5E8NA 1EO5A 3TLRA 5SWSE 1JMXA 2I25N 5AYQA 3C87A 3L1OL 4UNTA 4FXKA 3U4EB 3UJIH 4S2SA 1MRDH 3IF1B 1Q0XL 3K4ZA 1ADQL 1OTUD 3EO0A 5JHDE 3QQ3A 4AY0A 1DBML 4NNPL 1X7QB 1GIGH 5KJRH 1IL1A 4QXWA 3N9GL 5I9QC 1XCQB 1EAJA 1CBVH 1IC7L 3RUGA 3V79C 3MJ7B 1A6VL 3MROB 4OZIE 3CUPB 1EXUA 4OI8A 2IPTL 3DTXA 3K8MA 1TZHA 2XN9D 5DJYA 1F4YH 3SGEI 3Q6FB 3EYSL 2VISA 5HDBE 1D5IL 4ZFOA 1EHLL 3BN9D 2AJUL 3QUXC 2LFGA 3L7FA 1RJCA 1NBVH 4RSVA 5IG7A 5EC1B 2R29L 4NO3A 5IMLA 3BESR 4LP5A 4XMPH 1M05A 2P8PA 4Z7WA 1B6DA 5C6TH 1NCAL 4B0MM 1IFHL 3TBTA 1NCDL 1G9ML 4KK9D 2H8PA 4U0RC 1HSAB 1T4KA 3RDTB 3CJJA 2B8OT 4JFED 2EEAA 4HAFA 1KN2L 2EDQA 4Q9QL 2HG5A 2V7HB 5EPMB 4E9LA 4N0CD 4UT6L 1BECA 2P5WE 3DMMA 3O9WA 2FHBA 1CXLA 1QNZL 3O3UN 1MFAL 1FO0A 5GRJL 3U83A 4XP1H 2VLKA 2WP3O 2CRIA 3QDJE 2HLFD 1UENA 4TQEH 2V7NA 4JQXA 3RA7L 5FO9B 3C9NA 5C07A 2XQYK 4PJDA 2VRAA 3JTTB 5CZXC 1U8PB 2YMXL 3KAAA 4OLYL 4XCFH 3VXRE 2NY1B 2OLDA 1IAOB 4TTDC 4JZJC 3VFPA 3DUUB 1YEJH 5JORB 1OAXH 2C3VA 4FFWD 3WL9A 3C5SB 2QSCL 1J86A 3PWVA 1TETL 4X8JA 4XX1E 3EUUA 4LHUD 5DJCB 1MFAH 4TPRH 1C1EL 1CICB 5F88B 1S3KH 4ZS7L 1BPVA 4IRJD 5I8EB 4FQQB 4ZOBA 3DMMD 1ZT1B 2BJML 4PJEB 5T3XD 4CVUA 1MJ8L 4XH2A 4HZLA 2JCCB 5IB1A 5L9DL 1R3KB 4J23A 3UTPD 3IDYB 5K59E 1HKFA 2F54B 1LEKB 4PGCA 1MEXH 5J7CC 2NY5L 4PRPD 4LMQI 2EH8H 4R96A 1HKLL 1AGFA 2PTVA 4NGHH 1IC5L 2IGFH 3EYFB 3L9RA 2QSCH 1G7IB 4A6YH 4G7VH 1S9VA 2DLTA 4JPWL 3ABZA 3QH3A 3WFZA 3PIQA 3I2CH 3SCMA 5I1IL 4M9PA 3FFCA 2EDBA 5D1QD 4RGMC 1NSNL 3BQUB 1BFTA 1TJGH 1YJDC 5K9JL 5DUPL 3WSQL 1CD8A 1TMCB 1SJXA 4Y19E 1AFVH 1UGNA 2NY1D 7FABH 3HC0A 3S96A 2XZQH 2IBBA 2DIBA 3KPQA 4XP5L 4PIRF 1AD0A 1XZ0B 1KEMH 3ZSTA 3HPJB 5ENWA 1WFTA 2RBLA 3CZFA 2VNCA 5CHNB 1CE1H 3FTGA 1Z5LA 3OXSB 1PQZB 4FQLH 4TVPD 4YX2H 3QNZA 5ITBL 4OB5L 1H3WM 2VLJE 4CUCA 1Q9KA 3HMWH 3AFLA 5FO7B 4F7MA 1KV3A 4B5EA 5EU4B 5EZOH 1KJMB 3GJFB 3L6FA 2HLFC 1BZ9A 4AM0A 2W0KA 4PJXA 3HG1A 4UZGA 1S7RA 4ZSOE 3CMGA 4P4RA 1NFDA 1TZGL 1M05B 5MENB 3FB6A 4XC1L 3UTQA 2ZSWB 4DQOL 2QQKH 4XT1C 5DHXB 2DWDB 4UOW0 4ODXB 1QR1B 1F6FB 2BHZA 3MRFA 1KIQA 5D1QC 4BKLA 2APWA 4AYFA 2NX5B 3MA7A 5KSUA 5IFJB 2XYCA 2I5YH 1CG9A 4PJHA 5FGRA 3O3AB 3VDCA 2BFVH 1KSRA 4KI1A 1UC6A 5IROA 4GW5A 3VD4A 2HG5B 1YMME 3PDOB 5JW4N 1T2QL 2LTQB 3HR5B 2H2PC 3L3HA 3D0VA 1CT8A 2EIEA 2JK5B 4BH8A 2XRAL 2YN3A 1KJ2L 1WISA 1NCAH 3FAWA 2BHUA 5HHPA 2YPVH 3NACL 2DQGH 4FQXA 4CNIA 1DUZB 3AM8A 2YUXA 1OF2A 1U9KA 2V2XB 3CFBB 3ULSA 5SWQB 4X5WB 3LD8B 3LHPL 1Q94B 5DRXB 2NY6B 1OP3K 4U6TA 1L0XA 1BD2E 3HE6C 4HUVB 3GSOA 1U2CA 5J1SC 1JTOA 1CYGA 2H32H 1S9XB 4A6YB 3K8KA 2O26U 5J89A 2R2HA 4ZTPH 1XGRA 1CLYL 4GT7A 5H35A 1EDQA 1P7KB 2E6QA 1VGKA 2P45B 4AENB 4I2XB 5GS1C 5I8EA 1XCTA 4ONGL 4TTGA 3P4OA 5C0AD 3SJVA 3QHZL 1QLRB 2H41A 2OP4H 4OZGE 4X4YA 3ULVL 4LKCB 1LO5B 4N8PA 3QEUA 3PWJA 3PP4L 3HUJE 4OCXL 1EEUA 5J6GB 2YBRA 1QVOB 5D1XB 2E9IA 3QB7C 3QUML 2OJEB 3NFSL 1EEYA 4K71C 4Q9BA 2H2PD 2R0KH 1ZWIA 4PV8A 4M5ZH 4NQCE 15C8H 5TF1L 2HH0H 1CXHA 1ULVA 3IDJA 1KCVL 3GJFH 4ORGB 3UBXG 2FSEA 3MA9L 4L3EE 5D70H 4L3ED 1ZTXH 4LQ1A 1LP9F 3KDMA 2X4SA 1PW3A 3QXAB 1HH9A 2D7TH 4MAYC 5C0GA 2EH8L 1HQ4B 2YD6A 3WFBL 4HKBA 2FEDC 4NQCB 3QG7H 1JZ7A 1UH4A 3JV4A 4NO5A 3QCVH 5SWZD 4C4KT 4H0GA 4J4PC 4XMLL 4KDTC 4M5ZL 4R4FL 1N8ZB 4S0TD 5DSCB 4NRYA 1KCVH 1Z5LB 3GSNA 1T03H 4ENED 3GHEH 3U9PH 5A2IH 4ODHH 4RFEA 3QIUC 3LCYA 1S7XA 4JM2D 4JO4H 3QXDA 2IAMD 5GGSA 3SDCA 4NQEA 4QGYA 3MBXL 4B7IA 4D8PB 4KK6D 1VPOL 2XNAB 5IFHH 4XXCC 1PY4A 3GJFA 3QP3A 1MLBB 5IBTH 1I8LA 3LV3A 5JXEC 4I5BA 5D9SA 4RGMB 1MH5A 3GI8H 1N7ML 4Z7VE 4YPJA 1JWMB 3KPMA 4GRWH 1MHEB 1ZHBB 5J0BA 1FNEA 4ERSL 1K8DB 1N5YH 3VXOB 3AMKA 4LCCB 5DHVH 3IDGB 1A1MA 3VFTA 3MV7E 2Y1VA 4GUPB 1UB6A 4PD4J 3WUWB 3MRCA 3STZB 3INUL 1KFAL 5D7IE 5B38A 1VB9A 1I4FA 2Y9RT 4M9OA 4MXWL 3H42H 1UCTA 1YA5A 5EZOL 2ZNWA 4MAYD 5C0EA 4IRZH 4MNGA 4KJWC 1EJOH 4LSSL 4PRIA 2Y6SD 1K2DB 5EBLA 4KY1H 4JY6A 4ODBD 3GEWB 5FHBL 3V6OC 1A1OA 3NVQA 2FRGP 3OKYA 4HWNA 1HSBB 1IT9L 4P3WA 5E70A 3T2NL 3D2UA 4JZJB 5HY9B 3V8OA 4MDIB 5I1DA 5C7XL 4M1CC 3HZMB 2ED7A 3U36A 3WUWG 3BO8B 5F7KC 4S11A 3V52L 3DBXA 4JFZH 4UT7H 3ULVF 4GAYA 1B9ZA 2EDNA 2YPLB 1NCTA 1OF2B 2HTLC 5HJ3A 1NMBL 3UTSB 3VA6A 3BOVA 4WTZA 3L3GA 3U0WL 3MNZB 5DRZA 5JMOC 4OLXL 3RWGB 2VDQL 4ZO6A 4MNHB 1F90L 1ZSDA 1JNJA 3NCMA 3LPFA 3LPWA 1Y18B 3BDYH 1KACB 1P4BH 4LLWA 4JM2F 2OZ4H 1D5BB 3RWJA 5IHBA 1BOYA 1ZHNA 2F74A 3G6JB 3E8UH 1U8IB 4D9RD 2NNAA 5D6DA 5GISL 4I13B 3U4EA 4IJ3C 2ICWB 5GPRA 3VFOA 3P2TA 4NM4L 1JNLL 2V9QA 5I2IB 3MLSH 2OL3A 3ZKND 3OJDB 2OTUB 5BXFA 2P43B 4ZMAT 1JN6B 3F8UB 5JNYA 3TO4C 4OZFB 1V7MH 1LE5A 5KS9E 5ADOH 1F90H 3ZKMC 2K3TA 2OX5A 1CLYH 1FGVH 2Z4QA 2W60A 1K4DB 1IMHC 4F7CA 4MCYA 2DL2A 2VDRL 3ZSSA 4PJCA 3WHE1 1FJ1B 3QFJD 5EC1A 5IJVA 5FYKE 3MLWH 1CFNA 3KPLA 4WCYH 3GSRB 1PLGL 4NYLA 4WGWB 3LKPB 3MV7A 3I6KA 4G6ML 5DJAA 1J1PL 2VC2L 2JCCE 4CBPA 3IU4H 4UQ2A 1KUMA 4H0HB 5KSVA 4D0BA 4YDVA 3VXMD 5DRWA 3AS2A 1E4WL 3G5XB 3LKRB 3TVMC 4YLQT 1UH2A 3FJTA 3IDUA 3O3DA 4HK0A 4Y2DD 1DFBH 2YSSA 4JKWA 5E4IA 5DVOA 2ZWLT 3BEWB 4YBLB 2EDXA 3O45B 5TQ0H 1WTGT 3MUGA 3QXDB 1A7RH 4LNRA 4RMTA 4YE4L 4JE4B 3SO3C 4HMEA 1HHGA 4EQ3A 3C8DA 4JG0H 5LBSH 1RUPL 3VW3L 1U8KB 4K7FA 1VEPA 4YHYB 5FXCH 1WFOA 2J8OA 2MCPH 3JWOC 4N5ED 4Y5XA 3EYVB 5INCB 3EYOA 5HTSA 1OAUH 3MRGA 5I18H 3HNSL 2R2BA 1YPZF 3N85H 4LCCA 5D8JH 1B2WL 3BD3A 1ETZA 4CADA 3DX6A 4HUKB 3GJFK 1YN7B 4P2QB 4QRPB 1CQYA 2VN7A 2VMFA 2J6EA 2MQ0A 5DFTA 1LO4L 5HGGS 1CVRA 3VWJA 3DRQA 3WKMH 2EDLA 5C86A 5CEXB 1BMGA 5D1ZA 2V17H 3UDWA 4NQED 3HZYB 2MCPL 1WWCA 3GZKA 5I19L 4JM2A 4L8BA 4P2OA 2R1WA 3OJMB 2A9MH 2GITB 3DGGA 3O9WC 2H32A 4JZOA 1U8MB 4LLUA 3HUJA 3I6LE 4YPGA 5GGQL 4HIXL 2GTZA 4QRUA 5ICYA 1K8IB 4LIQL 4EIZC 4ODWA 2J8UF 2X4PA 3TBWB 5E00A 2M2DA 1U8LB 1S5HB 5HGDB 1BBJA 2Z93A 1U8NB 5DUBB 4PR5A 3RJQB 1NBZA 2XKNA 3K74B 4IIQB 3D39E 3RVVC 2VTFA 2DQCH 3HC0B 5HDQH 1LMKA 5ACZA 2O5ZL 4YBHA 3QWQB 1OOAA 4KDVA 1A14L 2IALB 4WW1B 1QBMH 2Y6SC 1F2QA 2K9UA 5CEYB 1BD2A 1PKOA 4GBXC 1CWVA 4PGDA 3MV9A 4NN7B 4PUBH 2VXQL 4OZIB 1EGJL 4POUB 4HS6B 2OI9C 4HK3J 1YEEH 2OJZL 4NPYA 4BQ9A 3DV6B 3SDYH 5F1SA 5HPMA 4P5MA 3QULB 1FE8H 1JN6A 2JE8A 2VDQH 3ULUE 4JO1L 1T2JA 4MJ6A 2PTTA 1OGAA 2IADB 1FFRA 3OKDA 3OSKA 4L29A 2QADD 3BWAB 1Q9KB 5BQ7B 2IQ9L 3D18A 4Z7OE 1EGJA 5KS9F 5EO0A 1I7TB 3HUJF 4F7MB 2CK2A 5EU7E 1INDL 4LPYA 5H8DA 3W0WD 1QNZH 4FS0A 1GOHA 3V6OA 5F6HJ 4EI5D 3H0TA 2YPKB 5J3HC 2E9JA 1CE6A 3F65A 1CFQB 5SWZE 2XV6B 1ZT4A 5FUCE 1NLBH 4CAGA 1NL0L 4HPYL 5IJVB 4LRNH 1U8OA 3ARQA 1XIWA 3VWKB 4QXUH 1R6VA 3PXHA 3S5LA 1HXMB 2NY0D 1JPGA 4Z7NF 3EDEA 1DQLH 1PYWB 1TJIH 3TYFA 1IGML 1U91A 1OWWA 4KJYA 2LU4A 2F53D 2WINA 4PRNA 3UTZB 3TP4A 1B90A 4QRRB 4M1GL 2RFXB 4JPVH 3THMH 3JWDL 4YC2C 4KUZH 3GMOB 5DHYA 4L3AA 4JKMA 2R2EB 3ULUH 3V5HA 2CUMA 2HMIC 3N0PB 1HCFX 3QUZB 3VJ6B 3QUXD 4YIQA 4NSKA 4ZFZA 4WCYL 3ROLB 2WBJB 2NXZB 4WIQA 3VXNA 3MV9D 1N2RB 2XKSA 4LASH 1BD2D 4JZNB 1UACH 1RFDH 5CIPH 3WIFA 5LGJB 3OKLA 4TVPH 4E0RA 1OQXA 3TZVA 3D1MC 4Y7MA 4LHUB 2B0SH 2WWKT 5AUMB 1BJ1H 2BHYA 4KDTA 5FO8A 2H6PA 1OTUC 1MCOL 4X4XA 4WHTA 3ZE0E 4V1DB 3SGJC 1QOKA 5KAQG 1FP5A 5BRZB 1MHHB 3LMJH 2XICA 4I8DA 4P2RD 1LO3L 5IMMA 2Z9TA 5H35B 3CFEA 4ODSL 1NGPH 1X5AA 4G43A 2DI8A 1A3QA 4C56E 1FLRH 4FTVE 5JORA 3MRBA 3WL9B 1R3LB 4PJ8B 2FGWL 2ORBL 5FYJH 3U30B 3IJYA 4P2OD 5C0CE 2EE6A 3RWEA 4H5SB 1UXWA 1JHKH 3P9MA 4FFWC 1R5IA 2A73A 5D1ZD 1RZKL 1P1ZA 2WP3T 3TGXA 4LLYB 4WJ5A 3VI4E 3MRMB 3ARVA 3MFGB 1HINH 3BXNB 2X40A 2FECI 2I07B 1KB5A 2M8XA 1N26A 5L6YL 4M43L 3N06B 1MF2H 2R39A 5JO5B 4XRCA 1MWAB 4FTVD 1JHLL 4IRJB 4PV8B 3NFNA 1M71B 1T1WA 3QA3B 4GRLD 4HX1A 1SJEA 4HIEB 3BIBX 4QTHA 4G6JH 4NO3B 5GJTH 5IMLB 3KDMB 4P5TA 4QWWC 4F3FB 1HHJA 3R0NA 3FQNB 3LKSA 4PJAE 3B4NA 1JNHA 1G7LA 5MI0C 2NY0C 3QPXH 3QIBD 1RULL 1U92B 5GRZA 5HHOB 1WZ1H 4HKBB 3FO9B 5ACZB 5LQBL 2B1AL 1HYRC 1TZGH 4ZAKD 2QADC 4KHXL 2FD6H 4JRXB 2NZ9C 2VDKH 3R4DA 3VXRA 5DURB 3T8XA 5D93B 2PYFB 3G04A 2WLYA 1RU9L 3C09C 3FFCD 5A3ID 3BH9A 1SBSL 4KPHH 1F8TH 4U1GB 1TQCC 4LSTL 4LLMA 3MACH 4JQIL 5HHMD 4OF0A 1AO7E 5EOCJ 4C83B 3A6BL 2BFVL 3CZJA 1SYVB 5FGBC 2AQ1A 5GJTL 1TCRA 4Y4KC 5EUKA 5M7QA 1LWRA 3TN0A 2ZSVA 3PQYD 5DLML 2C3XA 2YD8A 1AGDA 5HDBF 5LQBH 2FD6L 3VFWA 4M62H 2DI7A 4TNVK 2EECA 5E8PB 1NBVL 5KVFH 1KT2A 1QFWI 5E6IA 4UTAL 5ETUB 2PO6B 4OCRH 5BS0A 3ARZA 1RAMA 1WTLA 1HXMA 3EFDL 1JWUA 3VXOA 2FEEL 4PJXB 1S9WB 3PWNB 1SM3H 1G7JA 4O2FA 3TYFB 1TCMA 5DJ2B 5BVJB 1HI6B 1C5DA 1GPOL 2DQDH 2IF7A 3IU4L 4QHKI 2V5YA 3GBML 4DKEL 4ZSOB 2OM5A 1DLFL 5TDPB 4U6XA 1JNNL 2VLME 4KQ3L 5I0DA 2Y5TA 3VFUA 4JGJA 4QHLB 4G42B 1SY6L 5EU6B 2APTA 3OKNB 3RL1B 4OF3A 3F7QA 5IIEA 3S98A 3PDOA 5GSRA 4G8GB 5F1IB 3OAZH 3O9WD 3EOAA 3VE0A 1YDPB 3OKLB 4P9ML 3WS3B 1V3MA 1YEDA 12E8L 4R2GD 2PYEB 2DYPB 1S7SA 1N6UA 3JWDH 4MX7B 4YUEL 3NFSH 2FJFB 3LEVH 3B8YA 4TSAL 5E5RB 3KLAB 4AZ8A 3MJ8B 4M6NH 1IM3B 2AEQL 1U3ZA 2HH0L 1NQBA 2OQJB 2E27L 5JOPE 4LLAA 5SWQA 1FBIH 2E8ZA 3NPSB 5FF6B 1UT9A 4V2BA 1A22B 1N3NB 5D6DC 4BZ2H 4QOKE 4CVZB 4HUVA 4HLJA 1INEL 3BKYH 1LEGA 4M48L 2JJSA 1F58H 1ACYH 4U3HA 5DVMA 1NCBH 5IVOA 4KHTH 4LCUB 1ZK9A 2ICEB 3AGVA 1JYNA 3WIHH 3VWKC 4WEBH 5BXFB 3F58L 3FQWA 5GGTH 1LE9B 4P9HC 2RAMA 3TO2A 4J7RA 3QUYB 1PQZA 2VXUH 2CKBL 4KKLD 2IQAA 5E8OA 2AEQH 4QXGL 3FB5A 1G9NL 3QAZB 3OR6B 5EBGA 4QRTA 3ZHDA 2LQRA 2YRZA 3PGDB 1PZ5A 3G5ZA 1RZ8A 3MYJA 3EFFA 3GJEB 4UINL 5AYUH 1I9EA 3UJIL 3U2SB 1JHKL 1TPXC 5D5MF 2X5PA 2QKIB 4JAMB 3TYGL 2XT1B 1FJ1A 3QDHA 4W4NA 4NBXB 4QTHB 3V9FA 5SWSA 3IETB 5EZIL 2BSRB 2DWEB 1Q9WA 1QG3A 4XAWL 1LK2A 5F7HA 2IBZY 3HC4H 1NDGB 5I1KL 4YHIA 3CXDL 4JKPL 4F9LA 5BV7B 1IVLA 4GRWB 3WIIH 4HS3B 4XI5C 1MCQA 4GXVL 3ZL4L 3SY0B 3VXRB 4NWTH 2VDNH 1ZVHA 5LWYL 4JFFB 1BZQK 3VXSB 5DQ9A 3D0LB 4JN1L 3D0VB 4R7DA 5GQBA 4AIOA 5DUML 3ILPB 2AXFB 2VAJA 4ORZC 1N8ZA 3NAAH 4HWZA 2W9DL 3WHE0 1DQJA 4ONOA 2IH3B 3K46A 2NX5D 4N9GB 4NKOA 1M7IB 3FQXA 1I8IB 1LO2H 3FL7A 3H9HB 2R8SL 4M6ML 1JGLH 2CKBB 3QRFM 2ZCHL 3ZYJA 3S88H 3QIUB 4X5WA 3ZDYE 1KPRB 4FZEH 3MOBL 2EEDA 5F7EH 2Y23A 3QZWA 5GSVB 5TJWK 3A6BH 2R2BB 5B8CA 3W39B 3PGCB 2BVYA 2A77H 1TJIL 1P84J 4U1MB 1L7IL 5F3HA 3RUGF 3V7AE 2DIAA 5GZND 3WN5C 3QISA 1FFOB 4CMMA 5L2KD 2FB4H 2YUZA 3UTOA 1PKQB 2OXHA 3QEGH 2P47B 3IJSB 5CJQH 5ALBL 5EU5A 3CIQA 5BJTB 4Y4KD 3VDAA 4DWHA 5IQ9B 3GHBL 1QSEB 1CD9B 1MCBA 5GHWL 1LO5A 1IL1B 3SJVD 4YXLH 1ZT1A 3X17A 1MIEH 4HZLB 5J06A 1A6UH 4Z7QF 2COQA 3BPLC 2YZ1A 3UTSE 2AV1A 4CW1A 3S36H 2DKMA 5GS0L 4O02H 4ZNEE 1OHQA 5A2FA 2DQHL 3KJ6L 1UWXK 5IEKB 3VG0H 5T1LB 5T3ZH 5I8OH 5HGDA 3HZKA 4OFKA 4ZXBB 1ZLSH 3RNQB 5I66A 4E41B 1IM3A 1BAFL 2YPLA 5L2KA 3QWRD 4Y5XC 2BRRL 2NY5H 4O4YL 4NJAL 5GHWH 1K85A 5E56A 3RU8L 4NQCA 5IVXB 1A6UL 1DANU 4U1SB 3I84A 4OQTL 1ZANL 1BBDL 2VQ1B 4TSCL 2EYSB 1BD2B 3BN9C 1I1AA 4PGBB 5CUSH 4A2MA 1UKTA 2GK0B 3VCLB 5JDSB 4PG9B 4I77H 3STLB 4KKBD 1YY9D 1A9EA 2XQYG 4KK6C 3H3KA 3SCMC 1DQTA 4TUOA 5C0BB 2R69L 4TSBH 1MVUB 1X4XA 2NY2C 2P42B 3TO2B 3LN4B 4U1NA 1KLGB 2FNBA 2JIXB 3C6SB 1AGEA 1OY3B 5HHXL 4MD5B 3WLBB 1KJ2A 3OAYK 3SDAB 4OQTA 1DZBA 4O4YH 1G6RB 2BXZA 4L29B 4DFIA 2LE9A 4QRTB 3MUJA 3U7WL 4C4KO 3PV6A 3RWFB 1N4XH 3RL2B 3CU1A 4OIIH 1Y6KR 3QDJB 5D6CA 3GJEA 4KKNA 3LZFH 2NXYC 5FFLA 3ORJA 2E7LA 2YPKA 4PJ7B 3VD3A 1RIUL 3ZYOA 2BK8A 3UZQA 4BK5A 3LV3B 5C2BL 4Z76A 5T1MB 2F8XC 1IAIL 4OFPA 4TULL 3V4VH 1NUGA 4Y8AA 4X9BA 4OKVA 4N0FA 2VDMH 2BOBA 1LK2B 1FRGH 3IDGA 1HH6A 4RRPA 2APXA 2PW1B 1I1FA 2ED9A 4F37K 2YRLA 2R56H 1UJ3C 4M6OH 3MV9E 4O2CB 2VLRB 4ZO7A 5J11B 3EAKA 3EGSB 2JCCA 5FYJD 3KPSD 5IF0B 4ODTL 2HJFB 3SBWA 3QUZA 3VJ6A 2X1OA 4QO1A 4LGPB 3O3AA 4R9HA 2AJ3A 1HSBA 3VXUE 5FA4A 3PABB 2QQKL 2XIDA 1UB5B 4Z78A 3SHSA 1EAPB 4H8WL 2G9HB 2PR4H 4NFCA 2O61B 3FZUD 4IRSD 2C3HA 3X14A 3QUMA 1SVZA 5IB2A 1DE4A 2DI9A 4NP4H 1PGRB 1I1YA 3NIFF 4OSUL 1P9MA 4PLKD 2J8UE 4KZEH 2GIYA 4QGTA 3VXUA 2DD8H 1IQDB 2OXGA 3DO7A 2F8VA 2EXYD 2ARJA 5GSVA 4UTAH 1MCJA 3REWA 3TJHD 5DK0A 4DTGH 1I75A 4XBEL 5DD0H 2F58L 3F7RA 4WUKL 1ZKAA 3DXAE 3I3BA 3C5JA 4JLRB 4NQSB 4OCYL 4RAUA 1TJHH 4XCCL 3DX8B 3RHWF 1NFIA 1G0XA 3MJ6A 3PHOB 4PRPA 2O5XL 25C8H 4RAHA 5D2NC 1KJVB 1KXTB 1EGJH 4Y88A 5EUOE 1VESA 3OX8B 3BGFB 3H9SA 1UVQA 3ARRA 2CIIA 4K7PX 3QQ3B 4LSRH 2VL4A 3JVGA 3KYMB 2VH5H 4K2UH 2Z35A 4LLDA 5D7JC 1A7PL 4JY5L 4HDIB 3HZYA 2F54E 2MNUA 3NCJL 1S7TA 4HXBL 12E8H 4IEFB 4YFLF 3HE6A 5ESAB 4QHNB 2LU7A 4I4WB 4XNUH 3DYMA 3RVUC 3FO1B 1BIIA 2IQ9H 1T5WA 1UKSA 1KENH 5EB9A 5DJYB 3L5XH 5DJZA 4GAGH 5HXMA 4ESKA 2O5XH 5C07D 4ORGA 1JK8B 1OLZA 2ATKB 4GQ9H 2D0FA 5LG1A 1IEBB 1UCBH 4Z9KB 2OZ4L 1S9YA 4EVNB 3T0DA 4O51A 1HH9B 3T2PA 4X4MA 1Q8MA 4U1IA 5DK3A 4L9LB 4PJ5B 4P46B 1H3GA 4PRBA 3SDCC 3VFRB 3DV4A 3B3IA 1A9EB 4K71B 5CP7A 5F9OH 3IFOB 3JV4B 3SDXA 2HWZH 2MMXA 4NO5B 3FHAA 1ZLSL 1NDMB 1TTGA 1I8MB 4MD5A 5D71L 4BH8B 1CFTA 5E03A 1AKJD 2YMXH 3O2VL 3OJVC 4NQDE 2OZ4A 2AKRB 2V7HA 3RVXD 1DEDA 1T7YA 4FQIH 3FMGH 5FYKH 2UUDK 3P0VL 1MHCB 1KCUL 3F7VA 2AJXL 4POYA 5D1XC 5DD6B 1T22A 2KZ1B 1H0DA 3EJYC 4RISH 5FAAA 1T1YA 2B1HL 1RMFL 4WFGD 1CU4H 1R0AL 2DLEA 3KGRA 5I1AB 1KPVA 4ZXBC 1FIEA 3FONB 2ITDA 3IDXL 4LPWA 3VXRD 5EZIH 4XNXL 2I9LA 2X89A 2V7NB 3TIEA 1VFBB 4AEHL 1GGCL 5D71H 3HC4L 4Q9RH 3KYOB 2PW1A 3D39B 4YAQB 3UJJL 3WFEH 2F8OA 2WNGA 3DUUA 4MXVF 3ZL4H 1T66D 1PYWA 3CLFL 4NQVA 2JELL 2P4AB 2XG4A 4PB9L 1W0WA 3AY4C 1HWGB 4RQQB 3D69A 2B1HH 3O4LA 2C1OA 3HAEH 5HGAA 4BZ1H 5FECB 4HLZH 3ZHKA 2HT3C 1DQQA 4Y4HD 3GBNH 4FQQA 1JYXA 3RIAK 1G7QB 4M1DL 1NLDL 3V0WL 2KPNA 4XNXH 1JUFA 5F9WC 1RZKH 3SE4A 3PHSA 4WFHE 4JR9H 1RJZA 3B2UC 1U8MA 3JV5A 2XWTA 3TVMA 2H9GA 4PS4L 1EHXA 4GW1B 5IB5B 2WBJA 3MUZ1 1I9IH 3CFJA 3MLTB 3D85B 5E00B 1FYTE 4UNUA 3B9VA 1CFSA 3DBXB 1Z9MA 1RVFL 4HJ0C 5JIKA 1D7FA 1D5ZA 4HF5L 1DDHA 1RZJL 4YDLB 4M7JL 3E6HA 4Z7UB 3BP4A 2IFFH 1I7RB 4U7MA 4WWKC 1J5OL 1L7IH 4FQCH 4X4XB 4F2MA 5EU6E 2YKLL 4OB5H 1T3FA 4WY7H 1TVBA 5FYLD 3BZFB 2HFFA 4APQB 2DLHA 1XR9B 5E2JA 4JFZL 1GGTA 4UT7L 4OZIA 1AIFB 2DDQL 3MXVH 5TH2B 3VGDA 4HUWA 1UKQA 2YK1L 2VE6A 1P84K 1H3PH 4PREB 4P48A 4NFBA 4NRYB 5D2NE 1QFPA 4PLOB 3VI3E 1XF5B 3ZTJH 5I76A 3RNKA 4U6YB 1H5BB 5DI8B 2UVEA 1NBYA 2DS4A 2W07A 35C8L 5DD0L 4ZNCD 1G6VK 1YPZE 1S5IH 3G5VA 1R3IH 2MHAB 4GQPH 4PRHA 3LY6A 1OD9A 4R0LB 3Q5OA 4OV5B 2FJHA 3E3QC 2OR9L 1KGCE 3MOAH 5FYKD 2D7QA 5JO5A 5KN5B 1I9RH 1MLBA 4ENEC 2NY7L 3TJEH 2P5EA 5DJZB 4FZ8H 4N8CL 1OTSD 4P5TC 3L6FB 5HYJD 2OTWA 2A6KB 4MXQD 2BNUA 1T2QH 1U2HA 2X09A 2DQCL 3VFSB 4ZD3L 3RTQC 4DEPB 4P23D 1YQVL 1X5GA 3L95B 1MY5A 1NGZA 4PJ9A 4OZIF 1IGFL 1W72H 2UZIH 1U3HC 3QDGA 4KXZH 4MHHG 4D0CA 4I18A 5AWNH 3QDJD 4F7PB 3R06A 3QCUL 1TVDA 4GW4B 1KIQB 3KJ4B 1L6XA 3OB0K 5I71B 3W0WA 5F7NC 4ZXBD 1XGTA 3B5HA 3WNNA 1QPPA 3QNXA 3ULVD 4CKVX 4JJ5A 3ZO0A 5C0FB 2C5DC 4YC2B 1FNSL 2IH3A 3DX7A 1OGAD 3GMQA 1JRHL 1HNGA 3D6GA 3LIZH 4IRSC 4ZD3H 2VO5A 4N5UA 3BEWA 4K9EC 4E0RB 1WT5C 1KYOK 4HK3N 4TUJB 1ZV5A 4GRMA 3TT1H 4KV5E 2CD0A 4X7SL 1XGQB 2HWZL 3CVHB 4D3CH 1A7QH 2EO9A 3VFWB 3QNYB 2HA1A 3U82B 3FOMB 1JPTH 4HIIB 4K7FB 4KTDL 4DKFH 1D5XA 1RK1B 2P8MA 1CD1A 5TQ0L 5E8EA 3RPIB 4X7TA 4JY4B 1MUJA 4BUHA 5FK9A 3RWJB 1NAMB 2KKQA 1EO8H 2EEBA 4G3YL 3MGAA 4UT6H 4GO6B 1R3LA 4PJ8A 1PKQA 4KTYA 4X83A 4DGVH 3CDCA 4GKZA 2OS7A 1L9NA 5IJKC 4BH7A 3TH4T 1ACYL 2R0KL 2ZUXA 2ZG2A 5GRJH 1NCBL 4IJ3B 8CGTA 3BZ4B 3BDBA 3KXFD 5SX4H 1XCTB 1FL5B 3OL2A 2FX8L 1B88A 2BXYA 5BRZE 1MFEH 1ZTXL 4Y19D 4Z95H 1YYML 1HYSC 5T1KA 2VXUL 3SN6N 1M7XA 4XRCB 1XCQA 1WUNT 4GRLC 3QUXB 5DFVD 5EO1A 5F7DB 2GFBA 3MOQA 1YEJL 3H3PL 3OAZK 3BH8B 4KZEL 4MJ5A 4G8EB 3VE0B 2MTPA 3RNQA 4WHCA 1CFSB 4XCYA 2B2XH 5E5MB 3T09A 3S5LG 2D2OA 1S3KL 4ZS7H 1NLDH 3V0WH 4G6AC 2EDEA 4WEMB 2FX8H 3SDXF 3K2UL 3TA3D 4N1HB 5KSAD 1IE5A 4R90L 3CSBA 2P8PB 1U8JA 3BPCB 5F1NA 3HB3D 2XTJB 3EJZD 4HIXH 1FLRL 3PQYB 5T1DL 1HQRB 1YEFH 4KK8C 3TBTB 2HRPH 4Y5YC 2IALA 4FQPA 5L8JB 5ANMA 1XF5A 2P7TB 1HK6A 4JHBA 1HHKB 3RHWK 3JV0A 1HINL 3KPPA 4LF3A 5LCVH 5EUKB 5I9QB 3NBNA 1HEZB 1D9KA 5C07E 4H1LB 3VXPB 2JTDA 1GIGL 4P3DA 2I24N 1MCDA 5DWUH 1OGAB 2IADA 3INUH 2D03H 5T3XL 5GGSB 3CXHJ 3KS0J 4MD0A 1CDYA 2BNQD 3N1QC 2BY3A 2YR3A 3ULUC 1WBZB 4XP5H 1EJOL 2VLJA 4KY1L 2YA2A 4Y1AD 3LN5A 4MSWB 3BN3B 5ICXB 2B1AH 5B4MD 5KG9A 4RDQF 1A3LH 1AI1H 4WFFD 2HRLA 1UADC 5D2LE 3C60D 4O9HH 4PJHE 5C7XH 4NKQB 4GUPA 5TQ2L 2VKWA 3BW9B 5EUOB 2AK4E 3V52H 5D7LB 2HJFA 3QDGE 3W0WB 3RY6C 2EC8A 4PJXF 3RL1A 4XI5D 5JXED 5DHYB 5ID0A 4MJIE 2AQ3A 3CGTA 3U46B 4M7KL 2W1NA 3QUMB 5I1HL 3HUJB 4QCIB 1QSFE 4ZFZB 2DBJA 3ILPA 5I74B 4NO0A 3DX9B 2PYEA 1A3LL 5AWNL 4PJFE 4LQFL 5FUZH 5IBUG 4X80H 5A16B 1S9VB 4XTRC 4NM4H 1NFDF 2DMBA 5DK2B 1M7DA 3C5ZC 5HI5D 3PIQB 3SCMB 5KZCB 4KKLC 1JGDB 5FO8B 4D9QE 1R5VB 4E42B 5F93C 2VLMD 3EOTH 3RX5A 5EIQA 4V1DA 3ZE0F 1ITBB 3MV11 4OLYH 4ZAKB 2QHRL 5E7FA 2XTLA 5FA3A 1X4YA 2ENYA 3KPQB 1P7QD 1ZHNB 3ZKQD 5CZXD 2IAMB 2FBJL 2UZXB 3TO4B 5F7WC 1N59B 3MLUH 3QPQC 3QULA 1QA9A 3I02B 3IFPB 4X99A 5ERWA 2FO4A 4EOWH 3OKDB 2G5BA 5E1AA 3P9LA 3OR6A 5T1KB 4HIHB 5JNYB 4LLYA 2IG2L 4XP6H 4H1LH 1OTTC 3ARGB 1WZLA 2FX7L 5E94B 2CLVB 3HE6B 5HSFA 1LE5B 4PLNC 1OL0A 5DZOA 3A6CH 4LCIL 5FO7A 3QRGH 4ZYKB 2FYYB 3P30H 4CW1B 1NEUA 1NC4A 4FG6D 5HD8D 1J10A 4Q6IB 1T1ZA 3SGKA 2EDHA 4WI4A 3S5LB 1Q9WB 4XBGB 3FFCB 4H8WC 3CAFA 4YK4B 4K3DL 4ONGH 4PTUA 1IEBA 3KS0H 2BSTB 43C9A 1GGUA 2Q7NA 5CWSB 3S35X 2ZP0T 5GGRB 3VFRA 4YNYB 1HQRA 4Z7VA 5DEGB 2RFXA 5EDXA 3P4MA 2N56A 2Q76B 4U6VL 1FFPA 3Q3GA 4X4ME 2WBKA 2IFGA 4OGXH 4UU9A 5IFJA 1HHKA 2ZZUT 2G5RA 4WHYH 1J8HD 3ULVC 2DQJH 4HWZB 4O58L 4XNYL 4Y19A 3BMVA 1NC2D 4W4OA 5EN2A 5MI0B 1NJ9A 4H1LA 2YSSB 3H3BC 2Q7YB 1SYVA 3T2OA 4BZYA 5FHAH 2A0LC 1LILA 1T22B 4FHBD 1H0DB 1ZOXA 3O45A 3RQ3A 1GGIH 1RD6A 3GO1H 2NYYC 3AXLB 2FWOA 1AKJB 4U3CA 4PJIB 4G9DA 5I1LA 1TVHB 3MTRA 4LSTH 1QP1A 3C6LC 3UYPA 1C5CH 4WHTB 3QCVL 3ULSB 1DL7L 1RJYA 2NR6D 5LCVL 1RZFL 3IKCA 3TNMA 1RIVH 4YAQA 2GHWB 1T03L 5HGHA 3BI9X 1CLCA 4LSVL 1TZIB 4JQXC 1S9XA 4H88H 2I26N 4NWTL 3D3VB 1DBBL 5T3XH 4ODXA 1REIA 4L3EA 4P4KB 2HFGH 4FTVB 4WW2B 4F9LC 4XXDB 1YN7A 3HR6A 4NHUA 1KIUA 5FECA 2NY2D 1AGBA 1PX3A 2IANA 2J88H 2BNRE 2C26A 2WIMA 4BJLA 2GTWB 3RBGA 4FQJH 5CKAA 2I5YL 1FYTD 3PDGA 3VWJB 4CVXB 3IDNB 4LKCA 4UI2A 2VYRE 1N7MH 3IU3A 1YECH 5FCSH 5JXAL 1MFCH 4MQXC 4HUUB 1A14H 3ROOB 4YK4C 2FIRT 5IB2B 2OJEA 2H1PL 1C7SA 2VXQH 5IHUH 4K9EL 1YDPA 4HIEA 5DXWA 4MAYB 1IKFL 3P4LA 4TVSa 4J3VA 3ZTJG 1RZIB 2EKSA 4AL8L 3MRIB 1G7MB 1L7TH 3FB8B 4EEEA 1T6WA 3MJ9A 1ZHKA 4PRHE 1IAKB 1JGDA 1WWBX 5I8KL 5HHOA 1UEMA 4JRWA 3FO9A 1J0KA 3ARBD 3KPRD 3BPNC 2BVEA 1NCCH 1T89A 3V4PL 3QCTH 2FJGB 4JFDB 4IIQA 1N0XL 4Q74A 3RGVC 1KC5L 2QQNL 4UV4L 4H26A 5CEZE 2V9TA 3T3PF 1WICA 5FA3B 5SV3A 3ESVF 2C1PA 4IOIA 4EDWH 1UM6H 3LKQA 4KUCD 2R1XB 1E27A 1CK0H 3HE7D 4PRHD 4PJFA 4I3RH 3CH1A 2VXVL 1G6RA 1FV1A 5GRYA 4JN2A 3U0WH 4U6HB 4KMLB 2X9WA 2OP4L 3QT2A 4OLXH 4ZO9A 1INQB 3QO0A 4JQVA 4R0LA 4F9PC 3QCTL 3QI9B 4J3SA 5HYIA 2IGFL 3PL6B 4NNXB 5BOZG 2Y36H 3WXVH 3DTXB 2FHCA 5ITFA 5DYOB 4Q2ZA 4O5LH 5C08D 5I8OL 3GFUA 5DMGD 5BOPA 4QHNA 1CLZL 5EO9B 3H0TB 2CKBH 3ULUD 5F9JA 1T5WB 1CE6B 15C8L 1ZT4B 2BVQA 4HS8L 1S9WA 3KHOA 3PWNA 4O2FB 1BX2B 3O6LH 2BSTA 43C9B 3AREC 3E6FB 3QR2A 5DUPH 3WSQH 3L95A 1OW0C 3BGFC 2MWCA 1WIUA 5HPOA 1UACL 5B3NA 1ZLWK 2P24B 4ZSOA 5FDWA 4TVPL 4ZTOH 4RMWA 3V0VA 4QRRA 2MSPA 2FR4B 2JELH 2EO1A 3FQRB 2DYPD 5ESQB 4Z7UE 5DA0B 3I3DA 1LP9A 4LLVB 2OL3H 4XAWH 4PP2A 5AZEL 2EZ0D 4WWKA 4P9HH 1CE1L 3BZDA 5B3JF 1WIOA 1CL7I 1C7TA 1XIWC 4MA8H 1I8MA 4YIQB 2BSSA 3CNKA 3TT3H 4YX2L 1XH3B 5JA9A 1JTTA 1GH7A 3H7BA 4RA0C 1DR9A 3AS3A 3F7VB 2R4SL 4HT1H 4G9DB 5I1LB 3KLAA 4TULH 3V4VL 2HTKD 1NGWB 3VXME 5ANME 4MS8C 3HAEB 4APQC 1RZ7L 5KVEL 3SE8L 1V7NH 4JY4A 2YXMA 1IAOA 3ZDXE 4NBYB 4LHUG 4MNHA 2AXJA 43CAA 4QRQB 4M7JH 2PCPB 3VRJA 3BRFA 1GGIL 3GO1L 2ICEA 1PG7W 4HC1H 4CMMB 3G6JA 1EZVX 4NHUB 3WNKA 3SCMD 3MRKA 1D5MB 1IC4H 3VDBA 2NZIA 2VAAB 2VB5A 3QFJB 3MXVL 1A6ZA 3LB6D 4MYWB 1RK0A 4RWYL 2YOCA 2OSLA 4JANA 4WNQA 3MLPA 3AREA 1AR1C 2OTUA 4G6JL 5I6XC 3UTTD 4LLDB 4YO0A 2UUDH 1A6WH 4WJ5B 3SQOL 2ATPA 5FHBH 1WSST 4Q0XL 1U95B 3C6LD 4I4WA 4WW2F 2B4CH 3DETC 4WI7A 3L9RB 3EJJX 3SGEH 3H7LA 4ISVA 2NW3A 5IESH 3MRJB 3GMNB 1C5BL 2CJUH 4NKMA 1W72A 3UMTA 4F7CB 3DJ9A 3ARYA 1SJEB 3KYNB 4JM2C 1P7QB 3L3GB 3W9DB 1RZGB 4PJ8C 4Y0GA 1AO7B 4OF6A 3WEXB 4W68A 4MCZA 2J8HA 4QTIL 4UIMA 1M6OA 1BFOB 1NGYA 3QUKA 1HIMH 2HTLD 1FGNH 2EDDA 4LEOB 2I9TB 5IVXA 4Y16C 3UBXB 1FNGA 1SJHB 1EX0A 3BEVB 3V6BR 25C8L 2VJXA 1U6AL 1F00I 2DB8A 3MLUL 4LMQE 3WYRA 2HJKA 2VLKD 3IKKA 1AHWA 2DQTL 3BH9B 5IESL 1TFHA 3L1OH 5CHNA 4RX4A 5I8KH 5LGHH 2E3VA 1XF1A 4F15C 1ZT7B 4X7EC 2AQ2A 2AJVL 5FOJA 3ILQC 3B9DA 3BMWA 3HI5H 3GK8L 2DQFB 5H37H 3A6OA 4P5KA 1L0QA 4UUJB 4LBEB 4PJAB 1S9KC 2WLZA 1QQDB 3LN9A 5I1CL 3CUPA 3BPOB 1GC1H 2VLJB 4F80A 3PXJA 3GMMB 3V5KB 2YA1A 5CD5D 2JB5L 3OTTA 4GQ9L 4MHHI 1CGUA 4U3XA 5TGBA 2DJSA 1RPQA 5DTFB 3RWIA 2AK4D 4KVNH 3LEXA 2EE2A 1WCBB 1T0PB 4LPXA 2CGRL 1RUKH 3MLWL 3RAJL 3L7FB 1X5HA 4NQVB 3D3VE 3GIVB 5MHSD 3TBVA 1W0WB 3S4SB 3T77B 3L7EB 4G6MH 2YA0A 3VXUD 3TCXA 1X5YA 4QRPA 5C2BH 3WDJA 1OPGH 1QSEA 4JFHE 3FQRA 1NUDA 1PG7L 4U1KA 1KN2H 3DRQB 3FN0H 3FMGL 3RUGE 4MXQC 3U9PL 1XGTB 3G6JE 5F7UA 4HKXA 5DS8B 3K8LA 5FV2A 4DVBA 5JQ6H 4WGVB 3RZCA 3E1F1 3ARFD 3KPOB 1OT1A 2F5AH 5CGTA 5B38G 3HRPA 3KPSA 4LAJH 1KTRL 4AJ0A 4J3XA 4XPTH 5C70A 1MCEA 4YHLL 4XX1G 2GTZB 4QRUB 4DGYL 4GRWF 5ICYB 1CICD 1SYSA 4WWKD 4PJGB 1B0GB 2E7BA 4HQQH 4X6BB 3SGDI 2X4PB 5KZCD 3O11B 4XVSH 5E08H 3BP4B 2Z93B 4E42A 4EBQH 2E6PA 4ZUUA 2CLZB 3QNYA 4H1LG 3RTQA 2XTJD 2UY7A 5D7JA 5T1LD 1VACB 5HYQA 5C07B 3UYRL 2OK0H 3VCLA 3IS0X 3EHBC 3STLA 5H2BB 5K9QG 1FCGA 3OF6A 4KK9C 1FIGL 1GOGA 4P2QA 1PBYA 3HS0B 4BZ1L 1NFDE 1FAIH 1T1XB 2QSTA 1EFXA 3UO1H 3AUVA 4NPYB 4DTGL 4N8VA 2NTFA 3F5WA 3P9LB 4I9WE 1KCRL 3MJ9H 3GI9L 1UJ3B 4QOKD 4WUKH 1URLA 5IMKB 1WQVT 1TXKA 3PWLA 4DW2H 1U95A 2CIIB 1CIUA 4OV5A 4WI3A 2KDGA 4PGCB 5CZKA 1LEKA 3MXWL 3Q5YA 3S3JA 1AY1L 2H2SC 4JFEB 2XACC 4NWUL 3ZDZE 4HF5H 1ZLUK 1H9VA 4OZHE 4HD9A 1U8LA 4S1RH 4XCEA 3HE7A 2Z92A 1FG2B 4G6KH 4LCWA 3MRRA 4Z7WB 3O6FD 1OB1B 4WO4D 3HZVB 3F6IA 3T0AA 1N0XH 2YPLD 3SPVB 1UZ6E 1ERNA 1UYWH 4NQXA 5KSBA 4EUPB 4HFUH 4Z7OF 1QRNA 2ADJA 5E2WL 4DK6A 1EMTL 4RNRA 2F19H 3QAZC 1C8PA 1F3DH 4Z7WF 1HXYB 3B3IB 1MAKA 3HHRB 2NXZC 2ZCHH 3S6CA 4E5XA 3HB3C 3JWOL 3QHTC 4JFFA 1KEML 4ZS6C 4MAUH 2YD1A 1ZGLA 3Q1SL 3FFDA 4MNQE 4R2GC 3SE3A 4I0KA 5INDB 4CDHA 4R4ND 1H3VA 5KAQF 3FTGB 1GZQA 2NY2B 4ELMB 4NKDB 1E6JH 3AMLA 2ZKHH 3SEPA 4LBEA 4PP1C 5ALBH 1MLCB 3BDXA 1TVHA 2Y4SA 4HH8A 4JGMA 3LVEA 4KHXH 3T4YA 3WE6A 1MREL 4GH7B 1QACA 3TZVB 4ODVH 4NM8L 3L3IB 3MZGB 1FPTL 4JPKL 4I3SL 1MI5B 3S9DB 4ODUA 4FQIL 5D7LE 1UFUA 5FK9B 4QY8B 4IMKC 1BVKA 3FQTA 1WCBA 1NL0H 1E4KC 2CUHA 4D0DB 4JFOA 1D6EB 1I8KA 1T6VN 4OD3L 3BPLB 2PETA 2XXMB 2MFNA 2ZUVA 4P2QE 2J4WL 1PX4A 2EYTA 3HI1B 1WBXA 3QQ9D 4PY7B 1FNAA 4X6CE 4PV9B 2A73B 5MEQB 1TPXB 2C1OB 2NX5A 4CVXA 1A64A 3PNWA 3T4AB 4MGXA 4RZCB 4PJHB 4MA8L 2CGRH 2L4OA 1BQHG 5ID0B 5DR5H 1EFXD 3DSFL 4TSCH 3FO1A 1DTUA 4LL9A 4JZNA 5HHNA 5GGVL 4XC3L 3QIWC 1QKZL 1NC2A 4GKNB 3C2SA 2ENSA 2M26A 3HA0A 5KANG 1SYSB 3OZ9L 3NMEA 3QO1B 1CF8H 1IKNC 4PRPE 5D7JD 2L0DA 2ADFH 1J05A 3O11A 4IIQC 3GKZA 3M07A 4MXVE 3P0YH 2GJZA 1OGTA 2K7QA 3W9EA 5C9JA 3VRIB 4NCC2 4GMSL 4YDKH 1U92A 1HZHL 4LKXB 3DV4B 5E24E 1I3RA 5SWSD 5HI5C 4MB3A 2PUQT 1GXEA 3CFEB 3NFPA 4MD4A 5BRZD 3NPSC 4RA3A 2NW2A 5KSBE 4J4PA 5D2NB 4ODSH 5GRWA 1E27B 2E7CA 2GJ6B 4ZPVB 3D85D 5C0BA 3B2VH 3C8KB 1J8KA 1VGKB 2ERJC 5DVNA 4YUEH 4F33B 5KVDL 5E4EB 4U2YA 4N90E 4OZHA 3KHQA 2VZ1A 4Q0XH 1INQA 1F02I 2JIXD 3HCVB 4D2NA 5BV7L 1HZHH 3O3EA 1JZ8A 4M43H 5JR1H 3VXMB 2CLVA 4BSWA 3WDHA 4M6OL 1A4KA 3MLRL 5DO2C 1JGVH 1G9NC 35C8H 3HG1B 4Z77B 1X5IA 1FG2A 1JPSL 1VGEL 4KJQD 4NO2A 3E2HC 5BS0B 4OKVB 2A6KA 5BVPH 2C4FT 4H8WH 1IC7H 2QV2A 1A7BA 1ZXQA 3BGMB 3L5IA 5F1OB 5IG7B 3D5OF 5J1AB 3NN8A 4Y16B 5CJXA 5GGSY 4FQ2L 5CJBA 1NBQA 2EH7L 5HGAB 5GGRA 4H88L 2FR4A 3MLZL 5E1HB 5HYJE 1BQHB 3EIFA 5DRWB 1ZAGA 3VH8B 2Q3AA 5BW7C 3PP3K 3ZZ1A 5LGHL 4UV7L 3B9EA 4GAJH 1SBSH 1NCNA 1AQDA 1AP2A 1CLOL 1YQVH 4M5YL 3DVFA 5CLWA 1JPSH 4LDLB 1AJ7H 1SQ2N 4ONHB 5DSCA 2J7LA 2PYED 3BFOA 5IFAH 3O3BB 1YJDL 5IEHB 2VSDA 1O7VA 3MCKB 4K94C 5D7IA 4JKPH 4MA3B 5DLMH 1MFCL 2QR0B 3KPSE 4JFQB 4TUKH 3T4YB 3V5DB 4ETYA 4BUGA 3HPLA 4QT5B 3VI4F 1VPOH 3CX2A 3L5HA 2FWOB 1IGIH 4MAUL 1IQDA 4HPYH 2EC9T 2ZPKH 4NQUA 3IFLL 4PB0H 4ZAKC 4LSRL 4JFDD 4GAJL 1QHOA 1H3TA 3PL6C 2VLRE 3REWB 4RFNB 5ELIA 1GHFL 2X10A 1IZJA 1U8PA 1GYAA 1AJ7L 3UTTE 3ETBF 4PFEA 4CVZA 2NR6C 3QG6A 1F4XH 3NCJH 4HXBH 5JTWA 2VR5A 4OUUB 4X6DA 5I76B 1MQKL 2W65A 4PY7A 3P4OB 4HKZA 3RFZC 4QHLA 5D7SL 3EO0B 4GAGL 5J9PB 3QDMA 4JRYA 3X13A 3GSVB 3X12A 4IRZL 1QLRA 5DD5H 1CK0L 2BNQA 4Y5VB 5L0QC 3S3PA 4ZUVB 4CU8A 1MCNA 2HVJB 3QEQB 3OGCA 3U4BL 4JZOB 3FO0H 5IR1B 4HDIA 1TZHB 3G5ZB 4S0SD 4YFLI 2NY4B 5EOTB 3MRJA 3ARUA 4KROC 4L4VE 4MJ5B 1QYGL 2QKIA 3ZKXC 4EN3A 5TFSL 4NNYB 5EBWA 1T5XB 2QHLA 3TA3B 1F11B 1VFAB 4NC1E 5B4MC 5E9DB 5I0ZA 1AXTL 3RGVA 4I18B 5ALCH 1RHHA 2RCSH 1UWEL 2Z31A 3CFKB 5FGCB 1KB5H 1SEQH 3QJHB 4G7VL 5IW6B 4M93B 4XPBL 4OZHF 4UU9B 5KSAA 3S3SA 5T3ZE 5F21B 4YWGH 4URTB 5T3ZD 5FGBA 4Z0XA 2X9XA 1FL3A 3I2CL 5F9DC 3RZWA 1CF8L 4ZFFB 3UZVB 3B6SB 4OCSL 1C16A 1XZ0A 3DX7B 1DBKH 4AMKH 5EZLA 4R97C 4Y4FC 5EN2B 2IQAB 5GRUH 4K3EH 1JFQL 1J0ZA 4AEHH 4OD2B 5AZEH 3GRWL 3HC3L 4XBPB 4JFPA 2D9CA 3A6CL 3D18B 4QRRD 4QXTA 4BFIB 3SDDB 3HNVH 3AXLA 1QLEL 4PB9H 1JHLH 3CLFH 1RURH 2A6IB 4NCDA 3I75B 3FQUA 4LSUL 3B9KC 3KXFA 4X7TB 4M1DH 5F70A 4FQLL 4P2RA 2J12B 3TIEB 2HKFH 1FC1A 3MRDB 2GUOB 5FKAB 1S7RB 5IKCB 4GMTH 4LARH 4MNQB 1ORSB 3ES6B 3JXAA 4HFUL 4OLWH 2WINB 4PRNB 2XN9B 4UT9H 3SY0A 3TZVD 1QHPA 5B38B 3LKPA 1CXIA 3N1PC 4FFVC 1K6QH 5C0EB 5JPMA 2CDGB 4Y5YA 3S34L 2FBOJ 4YZFF 3MACL 4JQIH 4L8CB 2VOTA 4JHWL 4DFHA 3IDMB 3OR7B 1DBJL 5A40E 2P8LB 3S37X 2VDLH 1DFBL 5EO1B 5IHLB 2AI0H 4RGND 1S7VA 1CT8B 2YKLH 3QEQD 2H9GB 5BW7A 5F89A 3VRLE 3T08A 3V5DA 4CJ1A 2BMKB 4YHOL 5FCUH 3P77A 1KXVC 1Q1JL 1VHPA 2F53A 1KPRA 2MKLC 2V5SA 3TC9A 5CBAB 1HHGB 2AXHA 1W0VB 4MA1B 1I9JH 3C60B 2CJUL 1U8QA 4GBXB 1Z2KA 4UIKH 4PRDB 4N0CC 1XIWD 5E2TL 2DQGL 5J8OA 1D5BA 3DXAD 2XTJE 4XCNB 4UQ3B 4X9IA 3RWCA 5I16A 4QRQA 1FZKA 1DN2A 4EI5A 3FCTA 4P23A 2WANA 3UPRA 4R4BA 1XGRB 1XMWA 3IJHB 4WTZG 4N9OB 5AAMA 5JHDD 3GSVA 5MENE 2YC1B 2NY1C 4YDIH 5DI8A 1KJ2B 3ECBB 5DD1H 3QEQA 2FO4B 3QO0B 4YXLL 2BRQA 1X7QA 5C0DB 5ADPL 2CIKB 2R2CA 4LVHB 1MCPL 1DBAH 5E5UB 3PWPA 3ARGA 5C0BE 4GSDL 1F4XL 5HI3C 5JW4Q 1WBZA 4P59H 1KJMA 5KN5A 1BZ9B 3VXSD 1AGCB 4EOWL 1NC4B 1G1YA 1TQBB 2BVOB 3ULVH 2DM2A 3JUZA 4WU7A 1G9EA 4KJQC 5L8LB 4N0FB 1W2KT 4M7LT 3LIZL 3LS4L 3BQUD 5FDWB 2Q86B 3FO0L 2RR3A 3RU8H 4EDWL 1I1AB 1TIUA 3QDGB 5KSUB 4YDJA 1T20A 3VGHA 1QBML 4CU7A 2LAGB 3EGSA 4I18C 2WMPA 1V3KA 2QBWA 1J87A 3NA9L 3X3FH 5KVDH 5JW3L 1P4IL 1WZMA 4QYOA 4CGTA 4B53A 5DJ0A 1AC0A 3IXAA 4JO1H 4MA7H 1M4KA 3ARPA 4MQXD 1S8DB 1NCUA 1NJ9B 3TVMD 1MLCA 1BVZA 2IMNA 1GJIA 5C0CB 2PKDA 1NGWA 4OCWL 4WUUA 5JHLH 4OM1H 5E9DE 4RMQA 3IGAB 3QWOA 4F9PA 8FABA 3TF7C 3O41B 2V5MA 3VXUB 3ULVE 5ESVB 2GJ6D 4Y4HA 1QQDA 4YEFA 1A7NH 5F9OL 1MJ8H 3GHEL 3T0EA 4W6YB 3UDWC 3SJVE 1YYMH 2SEBA 5I8CA 2VZUA 5FHAL 4Q7DA 1MFEL 3B9AA 4KZDL 3SKOA 5JW3H 4HWUA 2B5IB 1MHPH 2KL6A 2E6JA 3DX6B 4HFWA 2VDPH 1H3UA 3MBXH 4FQ2H 5BZDA 2AJXH 1C08B 2PNDA 2WV3A 3GUTB 5DD3L 1CDCA 4IDJH 1V5JA 2X89D 4K8RC 1RZFH 4X5LA 1I4FB 5DT1H 4Q6YA 4NNPH 1S7QB 1UVQB 4L4TA 5I74C 4Y2DA 2ADGA 1I7ZA 3K2UH 4HXAL 2Z35B 3NTCL 4LLUB 1YJDH 2VABA 2VIRB 4YBQC 5L7XL 4HKXB 5DS8A 2JLLA 3U4AA 3B9KD 1KLUB 1HILA 3FB7A 2IPTH 4ZUSA 3NIDF 1YPZB 3C2AL 5F7DA 1OAYL 1VFMA 3HLAB 4K23H 3QDMD 1U93A 1W72B 4JRYD 3LQAC 5JLZB 4OIBA 3QSKB 1J1OH 2F53B 5DVKA 1Z0MA 1MCWM 1QSFA 1AY1H 3W9EB 5IV2B 2Z0BA 2EC9U 4JO3L 4XPGL 1J0IA 3CC5A 4TOYL 2XQBL 4FMKA 4YNYA 1BOGA 4HH9A 3QXVA 1BZ7B 4M8QB 4JM4L 4NZUH 4JFDA 5KTEL 4JHZA 1VEOA 3MLYL 1AE6H 5HI3D 2HJKB 5H2BA 1MI5E 4EI6B 1AQKL 3AB0C 1Q1JH 4M7LL 1OAYH 3V8CA 2F19L 2X4TA 3P3YA 4PRAA 4IRSB 1HHIA 3WXWH 4YXKH 3NH7L 1I9JL 1CFVH 1A0QH 4H5SA 4Y89A 1CFTB 3GMPB 3H9SB 4Y4FD 5JXEA 2OL3B 4JO3H 1GGBH 2O5YH 4G8FA 1X9QA 3QZWG 4UUJA 1F6AA 2W38A 5GJSL 3SDCB 1EERB 1I7TA 1QFUL 3PWLB 3VRJB 5DA4A 4QNPE 5CGYC 4F37F 3M17B 4I3GA 3IT8D 1PDKA 1U3HB 3BKJH 3DXAB 4OAWB 3QQ4B 4DKAA 3RWIB 3U9UA 1KENL 3LEXB 4NO2B 4FABL 4RBPH 2VUOA 4LOUC 2W0FA 3GSUA 5D5MB 4P5TB 3S4SA 4F3FA 3EHBD 4Y16A 4BSJA 4KUCF 1D6VL 4PRIE 3UTZA 1F5WA 4XXDA 1OW0A 4P46A 3AAZB 1T20B 1R3IL 4TPRL 4LQFH 3HTLX 2VDKL 5ISZD 1N5AB 3IFNH 2ADJB 1CN4A 4JQVC 3D69B 4R0LC 3SDXB 2EIZB 4I2XE 2GY7B 4PTTA 2ZJSL 1YEHL 1TITA 1AQDB 1F8TL 3MLXL 3K80A 1A1OB 2PYFA 3G04B 4PY8I 3NCYP 3UPAA 3D2UD 1QBLH 1ZA6A 4MDJA 5E7BA 1MEXL 3O2VH 1OGAE 3O3BA 1MHCA 4PRID 4C59B 3FT3A 2QHRH 5T5NF 4EDXB 2I60L 3ARXA 4LHJB 1IAIM 2MOVA 4RGOH 2BVPA 4J8RB 3I85A 5T5FH 2K1MA 3D85A 5E0QA 1O0VA 2JB5H 5TDOA 4NQEE 2MPAL 4NZRH 5A16A 3BZEB 1ES0A 2ZOKB 5C92A 3ALPA 4KVNL 3ZT6A 1JGEB 2F53E 3M8OL 4WWID 5BRZA 2Q20A 3TV3H 5SX5K 4H26B 2KQNA 4U7KA 1IGCH 4KWUA 4QY8A 3D39A 2ZOLA 3I9GH 5C0JB 4CDGC 4JFDE 5FM5O 4MVBC 3EDJA 2XZQL 4NRXB 1R5WA 2DQDL 4RGNE 4Z8FL 4MB4A 4OM1L 4X4ZA 3TFKD 1OAKH 1FHGA 2WQRA 4HUWB 3REVB 5IQ9A 3PGFH 5T1KD 4AENA 3MCLH 2BNQB 4Y5VA 3KYKL 4RIRA 3QFDA 3WO4B 5J12B 4PV9A 3K4AA 3LH2H 3P73A 3SJVB 4BFBD 4HEPG 4M8VA 3OG4B 3EOBA 4QHUB 3ZDXF 4PJBF 5FB8B 4NT6A 3K4DA 2W60B 2HT3D 2QL1A 4ALAL 5J6GA 3DGGB 4P9MH 5EO9A 5C71A 5FCUL 5GS3A 4RWYH 5CJOL 1BJ8A 3JTSA 4ZYKA 4PJCB 4PJBB 1OARH 3EO1A 3O6FC 4JCLA 1KIRA 3C60C 2CKNA 4OCLC 1P2CA 4QF1A 4UDUB 3MLRH 3W82A 3B43A 5J6HB 3HZVA 2GYSA 4L8DB 3E6HB 1XGPA 1XR8B 4FP8L 3I6KB 3MJ8A 1KIPA 2B4CL 4E41E 2NXYB 3L3DA 5EZJA 1BFOA 3QUKB 2PF6A 1TJHL 5IOPB 2OTPA 4NQCD 1CQKA 4D0BB 2DKSA 2DLGA 2H8PB 2VE6B 1JF1B 3ARTA 3QWRA 1J8HE 3CVIH 3E2HB 3GI9H 4J3OC 2N1KA 3KYAA 4YDIL 1AHWB 4ZPVA 4TNVF 2HFEB 1QZ1A 1CR9L 1HIML 5EA0H 1CGYA 3R8QA 1K5NA 1W8NA 5LVEA 3RVXC 4RBPK 3G5VB 2R0WL 3ARDC 2L7JA 3QDJA 5KVMC 2ZG3A 2J6EL 2A6IA 2X1WL 5DEFB 3X11A 5C8JB 3U0PA 4L1HA 2P5EB 2Z8RA 4FXGA 3AC0A 4KQ4L 4LU5L 4HWBH 4BSWB 5E99H 1JPFB 2P5WA 4XGZA 3GMMA 5AEAA 3V5KA 4MQSB 1CS6A 4XB8A 4FZ8L 4MQ7B 5DHVA 2H3NA 3O2DL 1NEZB 4UBDC 3CCHA 1MH5B 3CK0L 5GS2H 1UYWL 2BSRA 4KMTH 1ZHBA 4WO4A 1KN4L 5IM7A 5FKPA 4LCWD 5JOFB 1INDH 1B0RB 1ND0B 4O00A 4EUPG 2VAAA 1G7HA 1MFDH 1X5FA 3BP7B 4P4KA 3BYYA 3L7EA 4JANB 4GW4A 3ZDZF 4AL8H 3BKJL 4PTTB 3U1SH 1NLBL 4FQXD 5EU6A 3NA9H 3O2DA 4KXZI 5D1ZB 2XFXB 3QHZH 1QRNE 1RI8A 3CFIC 3OKMA 1K2DA 1JMZA 3ZMRA 5C2UB 3CK0H 1FORH 1CL7H 3IYLW 1E6OH 4DCQB 4QOKA 4DZBB 1CGVA 4I9WD 3IVKA 3BIAX 1CU4L 3PV7A 5IEHA 1R0AH 4YGAB 5GISH 1RUAL 1I1CA 5HGBB 1P4LB 1UM6L 1I8IA 1VEMA 1V3JA 4GAYB 5GGUA 3KPRE 4GG6A 7CGTA 3LS5H 3QIWB 3BUYA 4HIIA 1M1SA 1BQLH 4HGWA 3OPZL 4YHZL 1CD1B 4D9QD 2KH2B 4LHQB 4F8TA 1LNUA 4L8SC 4XVJH 4GG8A 2Y36L 4HULB 4R4BB 4KJPD 4MB5A 2WBJD 1CIDA 2LV4A 3WXVL 4HQQL 3PHOA 4JG1H 1WVZA 2F54D 4Z7NE 2Y7QA 1N6VA 5BZWB 1GZPA 4R4FH 5DT1L 1ZT7A 1F6LL 3GBNL 3VFOB 1UXWB 4UAOB 1LGVA 3O6LL 2PTTB 4U2ZA 1YNKL 3OJDA 1W8OA 3G6DH 2LTQC 4GKSB 1P1ZB 1SMOA 4X6FA 2MJWA 4X7CC 3I9GL 1U36A 2P5EE 5GIRB 3RZCD 3DVNB 5L7XH 3VXPA 4Z7VF 4CJ0A 1QKZH 3EFFB 4C55A 3S36L 4O2EA 4LK4A 3OZ9H 3DMMC 1ZVYA 1YC7A 3U2SA 2A83A 2XKUA 2X70A 1GAFH 3PGFL 2DAVA 1EEZB 4N68A 1M71A 1T1WB 5IBTL 1ZEAH 5EU4A 4X6EA 2XWBB 3O6ML 1OM3H 4HX1B 2VUYA 3C08H 4NQDA 2XQBH 4F15B 4CN6A 2EDTA 1F3JA 5EZJB 3P11H 5F1NB 3DRTB 5J3HD 1UZ8A 4R3SB 3F12A 3CDFA 4LARL 3LSOA 2A6DA 4G6AD 1MNUH 3WJLA 7FABL 5D72L 3QJHA 5IW6A 4NZTH 4UQ2B 2R69H 4TSBL 4PG9A 5C6WH 4K55A 1CG9B 1CFVL 5CINH 1KTKE 5C08B 3STBA 3SE8H 2AXFA 1NGXA 5KVEH 2GJ6E 5F6IC 3GNMH 3PL6D 1C16B 5M95B 4N9GA 4JHWH 3VRLF 1EMTH 1Z9OA 4KFZC 3PG2A 4YEEA 4G5ZH 4WI2A 4OIIL 3F6LA 4LP4A 1OSPH 1KTLB 4NN6C 3IGAA 3QWOB 5JPNA 4LHUA 1X44A 3EDFA 1NGQL 4U49A 5C0RH 4Y4HB 1WJ3A 1P6AB 4TNWK 3S8WA 4L8SA 2ARWA 3CSYB 4GG6F 3C5ZD 4OGXL 5I15L 1MCIA 5CINL 5I6XB 3WN5A 3KXFB 5DJ6A 4Y5XB 3EYVA 5ETUA 3OV6A 1OAZL 5JW5B 3GSOB 2A9ML 4H25A 4GRWE 3C5ZA 5IHZB 2UZIL 2J6EH 4DQOH 2W65B 1MREH 2B7DT 5HHQA 4ODVL 3MFFB 3IFNL 3X3GH 3O4LB 2NY0B 1ADQH 2NX5E 4NN5C 4NDMA 4JRXE 5IMKA 1K3ZA 2CDGA 5DQJA 1G7QA 2IPKA 3I02A 3IFPA 4X99B 2OR7A 1JUFB 3MRNA 4P2CG 1DL7H 2E7HA 3W2DL 3MZTA 1GPOH 3DI2B 2WUBL 1F4WH 4JREC 5ICZA 4NO0B 5E2VH 4KRMB 4TUKL 4WU5A 1CD0A 4G8GA 4JFEA 1XF3A 3I6GB 5JLZA 3MPCA 5HHNB 2YHGA 4KRPC 4LLQB 2DTML 4I0PB 4CN1A 5F89B 1YEDB 2NMSA 3DGCR 3EZJB 2ID5A 4L3CA 4LCWB 3P77B 1G7LB 1IGYB 1JNHB 1FE8L 1I85C 1WLHA 3CDGB 4R7NA 4KI5D 5DR5L 1BBJB 1A1NB 3LOWA 4XXCA 2IPUG 4S1SH 5CLTA 5BV7C 2VQ1A 4ZAKA 1YZZA 1E6OL 1CDGA 5TH2A 1ED3B 3S97C 5IMOA 3QXTA 2Q76A 4FQHB 2FO1A 1JBJA 3DYPA 4HMCA 2ARJQ 4IRSA 2YEZA 1AGEB 2W59A 4PJIE 1MCRA 3LKOB 3RDTC 4OM0H 1J18A 3BHBA 3OKEB 4U1GC 5HPMB 1A2YA 4N8VG 1GZQB 3C09B 4G6FB 2CRYA 3OX8A 3RL2A 2MHAA 2GKIA 1F58L 3DIFB 5CEZD 5HVHC 2VN4A 2EE9A 3ARDD 3MROA 3KYMA 3FOLA 1YMMA 3I75A 4UV4H 2Y25A 3RP1A 4HV8A 4JG0L 5LBSL 1HNFA 2FYYA 4PJAA 3KNBB 1ONQB 3QRGL 4GS7B 3RA7H 1BVKB 1H15B 3FQTB 3ISWA 1OTTD 2VISB 1RIHH 2Q1EA 4EIGB 4XBGA 4ZOAA 1G9NH 1YNKH 2WUCH 2Z91A 1R3HB 1YY9C 5D5MA 4K3HA 1FSKB 2PXYB 1F4HA 4OCMC 1LVEA 1B2WH 1FVDA 3EW3B 3QPQD 4KZDH 1FSKC 2PXYC 3HI1A 2GW5A 4KI5C 5MEQA 1GAFL 2QQQA 4KC3B 2BJMH 2BZDA 3OKNA 5IWLA 4R2GB 5C08A 3F7YB 3BP5B 1JRHI 3O6MH 4Z5RA 4HG4K 1QO3B 2ZUQC 1ZA6B 2A1WL 4OQ1A 5L2KE 2O61A 5EBLB 5I1KH 2R0LL 2AVGA 3J7HA 1CVSC 1I7UB 4GLRH 4OZ4B 5CJXC 2OK0L 3V6FA 1KCUH 3U48A 1RURL 1DQJB 4X9GA 2BMKA 3QO1A 4HBCL 4GRMB 1G0YR 3UC0H 3WUZA 3RI5K 3MYZA 4JPWH 3MCKA 5D7IB 4LSUH 4IOFC 3CVHA 4BQCA 1UQSA 1T1YB 3WLWD 2CKBA 3IAQA 3H2WA 1ZHKB