1BFVL

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
DIELTQSPPSLPVSLGDQVSISCRSSQSLVSNNRRNYLHWYLQKPGQSPKLVIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVAAEDLGLYFCSQSSHVPLTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FV4155
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1997-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bfvL00
2GQHA 4PJGA 3QHFH 2NY5H 1JGUL 5LCVH 2MPAL 3E8UH 2I9LB 4M1DL 3VA2C 1YY8B 1C5DA 5F7WC 4C83A 1OPGL 4HGKC 2IG2L 7FABH 4CGTA 4P46B 2UWEA 3MV8D 1JNHB 1B0RB 1XGTB 1C7TA 2YMXH 5IIEA 1N8ZB 3ARBD 4KI5E 4Q2ZB 1UXSB 3CFBB 4B53A 1NC4B 3OV6A 1F4WH 3Q5OA 2NQCA 4XXDB 2R2BB 4WI4A 3GI9L 2R1WA 4BQ9A 1IEAB 5F93C 1MCCA 5DK0B 3MO1A 3WD5L 4AEIH 4KZEL 1P4IH 5BJTA 4PJHB 2EH8L 4L4VB 4YDJA 3WO4B 4PJDA 3DROB 1AXSA 4XPTL 5I74C 2R9HD 1TZHB 5D5MB 1FC1A 2QKIB 5TE4L 5J12C 3CSYA 3VWJB 5L7XH 2W9DH 1BQLH 1E6JL 3G6AB 3MREB 4MJID 5IESH 4UT9L 4HK3J 2ZG1A 2J8UB 1T04B 3KPMA 4Q0XL 1D5ZA 3KJ4B 4KHXL 4QGYA 1VPOH 4URTB 5E9DD 4I0PB 5FM5O 1FPTH 4LVHC 3EZJB 3WV0A 3CDGB 4TYUA 4FQ1L 1ZSDA 2N7BA 5EORH 1U8NB 3TYGL 4BELD 2CK0L 3T0EC 2OQJB 3GGWA 4R4FL 4Y2DB 4GRWF 3VGGA 2UYLA 1NFIA 2IF7A 1L7TH 2VDML 5HYIA 4ZFGL 3GIVA 1NCTA 3FFCE 1PKQA 4FFZL 4OV5A 1HIMH 2DB8A 3N1PC 4M6OH 2LQRA 3MLWH 3SY0A 3C09B 5KS9E 2YA2A 3UJIH 4LARL 2DQEH 3GJFH 3LMJH 4ONGH 4M48L 5DEGA 1CFNA 5DMGC 5A3ID 3FQUB 4L4TB 1S7QA 3D39D 3RZWA 1FZJB 4I2XE 3BPOB 2XG5A 1ZA3A 4N0UA 1KG0B 2CRZA 4HEPG 4I3RH 5C70A 1UJTA 5IMMA 4G7YL 5DUBA 4OLYH 5HYQB 3C6SB 4YO0B 4DJMA 4XMLL 5LBSH 3IAQA 1LNUA 3AU1A 5IKCA 1FZKB 3FB5A 1T20B 1VA9A 3ZE0E 1T1WA 3LY6A 1U8OB 4F2MB 1Q9WB 3CXHJ 4OTXH 2FL5B 4X6FA 2RB8A 4NP4H 3C6LD 3D3VA 2EDTA 3W39A 1IQWH 1URLA 3STLB 1YZZA 4DFIA 2IMMA 4JHAL 4JANB 3WSQH 4U1LA 3N1FC 3ES6A 1MCPH 3ULUH 1VFAA 3HE7A 4P23A 4PJCF 4ZFFB 1F3DH 5MHSE 2P44B 1MJUL 2DWDB 5INCB 4MAYB 5LVEA 3DMMB 3MNWB 1MCOL 1UC6A 1IZJA 1EH9A 2CIIA 1AD0A 2BJMH 5K33A 4HIIA 1EFXA 5F3HA 4IJ3B 3WO4C 5CHNA 5J89A 3L3GB 4OM1L 1RZ8A 5FB8B 5DUPH 3WS3B 4LLYB 3P9MB 2C4FT 5I19L 2F54E 5E4EB 1OGAD 1BVZA 3M07A 4P5KA 4XBEH 4JRWA 4K9EC 3KXFE 3PV6B 5D7JD 3KPOB 2FEDC 4I0PC 5DFWH 1NUGA 5B38A 3FB7A 1BD2D 2QADB 1R0AL 2NLJA 3O4LE 2VITA 5EFIB 1MI5D 3U9PL 1IQDA 1S5IL 4J3TA 1A6AA 3Q2CA 4EVNA 1NPUA 2VLRA 1SJHB 2OZ4L 2DLIA 3FB8A 5IK3A 3ARRA 4OZHB 2IQ9L 4I77L 2F5AH 4PLKC 3MV7A 1FSKC 5IOPB 4MD5B 1JHTA 3S35X 1QSED 3OKLA 43CAA 5E6ID 4FZEL 3RI5F 4QRRE 2R2EA 1T83C 2W1NA 5IMKB 5IT2L 5IQ9B 1IGJA 1CDBA 5ISZB 4JO1H 4XHJC 3EOAB 5HYJA 3BGFB 4QCIB 3RP1A 1WCBA 5IF0B 1FAKT 1E28A 3ROOB 4BH7A 1HHGB 3K2MC 5DRNB 3MYZA 5FYJE 4ALAH 3RWJA 5JTWA 3B6SB 3H3KA 3QNZB 4P59L 1I4FB 2FCBA 2OM5A 3O2WL 3QIBD 4XZUB 3UTSA 3HC0A 2RGSA 3O3DA 4P2CG 4KROC 2CGRL 5SX5K 1BLNB 5D9SB 4YDIH 4UUJA 5EIVA 4HSQA 5KG9B 2FBJH 3IVKB 3Q5YA 3AS1A 4UIKH 3STZB 4IHOB 5HHOE 2O61A 1WFOA 3LKPA 4IRJD 5HI4C 1D5BB 2BHZA 3GJFA 4MNGA 2X2YA 1ZVHA 4HK0B 4YHYC 1WWAX 1U8MB 5DVOA 3MUJA 3C60C 4H8WH 3X3FH 1HQ4A 1KOAA 2GY5A 5B22A 1UVQA 5FA4A 2VDQH 1CG9B 4TPRH 2BOCA 3SQBA 1T5WA 3VXMD 1FL6B 4KC3B 3IXAB 1VGEL 5KSBA 1QEWA 2FWOA 3EYOB 4WW2B 4XAWL 5B39A 2F58H 3T2OA 2OI9C 5IB5A 4TNWK 1SM3H 4ZNEE 5GS0D 4BH8B 2NY7L 4J3XA 2R0WL 5HSFA 3U1SL 2VR4A 3L6FB 3M45A 1ITBB 4F8TA 4PJHF 5GJTH 4HUXA 1HNFA 4N1EA 5D5MF 1BJ1H 2PXYD 4PJAE 1CTOA 4Q6IB 1FFPA 2DMBA 4X6EB 1ZHKB 4MQXD 4G6MH 1EJOL 4QRPD 3DETC 3P77B 2J8UF 2DQDH 2VISB 3T0VA 2XYCA 1N5YL 1A47A 4JJ5A 5D8JH 2XZZA 1L0XA 2R69H 1LQSR 3KYKL 1I8IA 1X5GA 5DJ0A 5CIPH 1K85A 3MRQB 4YPJA 1QPPA 1MFCL 2AERT 4BSVA 1AQDA 4RMSA 3SE3A 2W07A 5GGSY 4MDIA 1F4HA 1FDLH 5L2JA 3NTCL 5J6GA 4JY6A 5LQBL 4Y4HD 1XF2B 2A0LC 5IBTH 2F53D 5L8JB 3OKEB 2IH3B 4OCNC 4O9HL 4WCYH 1RZ7H 2LU3A 1RZFH 3R0NA 4HWZA 1MOEA 4YX2H 3V2AR 2EC8A 3MV8A 2X40A 2D7NA 5L6YL 3BN3B 3DURB 5DMKB 3EO0B 3O41B 4FXGA 3ARBA 4JZJC 3TN0B 1FNEB 1TJGH 4HJGA 4H1LH 4Y16A 5K9JL 5D6DC 3RGVD 3ZE1F 5TDPA 3JVGC 4UILL 1U8KA 3U36A 3IKKA 1D9KC 4NM4L 2R0ZL 5D2LE 1FZOB 1OTUC 3K8LA 4QXGH 4WDIA 3BFOA 5TH2B 2CQVA 4EKXA 3EGSA 3MBEB 3MRRB 3AUVA 4U3CA 3SGDI 5HVWA 3ELAT 2CD0A 1CGSH 2OX5A 5GXBB 3IDYB 3OTTA 1SEBA 3C5ZD 4V2CB 2P43B 4ZAKC 1RMFH 1FE8L 1RUKH 5BS0B 4MJIA 4NQXA 5ADPL 5DK2A 5EU6D 1G7IA 4EUPG 4X99A 2DQCL 2JB5H 1D5XB 4JLRA 3NFNA 2R1XA 4HKJA 4QYOA 3U4AA 4K8RD 3S3JA 3MZGB 1LK3L 3WKMH 4OI7A 3IU4L 2F5BH 4WW2C 3AB0B 1MPAL 4L8CB 1J1PL 3MOBH 3T4AA 3NAAH 3GSQA 4KRMB 2PUQT 4Z7UF 1QR1B 3V8CA 5DVMA 1XAUA 1CGWA 4HV8A 2IPTH 2EDNA 4L9DA 5HVHB 3MLPA 1BZ7A 3MJGX 2FB4L 5GRUH 1UQSB 3BH8A 2YD9A 3GSNH 3A67L 3FB6B 5C0NC 3KPRE 1EGJL 1MEXH 2CKBB 1OP5K 4DN3L 1AJ7H 1I8KA 3EO9L 4OI9A 3GSWA 3LB6D 5KOVC 4ERSH 4MCZB 4WWKD 4K7PL 2JJVA 3D39A 4GAYA 5IVXB 4OCXL 2GT9B 4HPYL 2FJFB 2YKLL 2GJ6D 3UAJC 5M95B 5GS0H 2YC1B 3SDAD 5EA0L 1V7MH 4JN1L 4JFXB 5C3TA 1RHFA 4OZHF 1T7VA 3S96B 3C6LA 3W11D 3UO1L 3E6HA 1ZA6B 2YPLD 3B4NA 2NTFA 5F1KC 2QSTA 3L95B 3OAUH 1QQDA 4LSPH 5DT1H 4WU5A 2B7DT 3RVTD 5L2KB 2E7HA 5EOQL 4YJZL 5CIPA 3HG1E 3NH7H 4JR9L 5B3JF 2GTZA 3UTPE 4M5YH 4QT5A 3DRQB 5F9WB 3KWWB 5C0BD 2BMKA 1OLLA 3DX7B 3TT3L 3F7RA 2YD3A 4BQ6A 2F8XC 1Z3GH 4N8VB 5H2BA 2BY3A 4PG9A 2VLME 1KPVB 2MQCA 4KRPB 1C1EH 5CKGA 1NAKL 1KELH 2OMBA 1OGAA 4OGXH 5E8PA 4OLXH 3TZVC 5FM8A 5HHQA 3O6FD 1J11A 3QG6B 3MLUH 1HCVA 2QHRH 3VXNA 1N2RA 3MNZA 1XGYL 4OSUH 2NY0D 3QYCA 35C8L 5D7JA 3GBNH 5C86A 5KVEL 4LSSH 2HFFB 3SDXE 1VGKA 3WFDH 4PBVC 4RGNE 5EOCH 2ERJC 4FQHA 1J8HE 3K8KA 1MI5A 1JHKL 4UINH 4KFZC 2X4PB 2X1XR 1XH3B 5MI0B 5GRZA 2APTA 15C8L 2XWBB 4EZMA 1DFBL 5KJRH 3CLFH 3DV4A 1X5YA 3ARSA 3NFSL 1LE5A 5E99H 2BVQA 3OKDA 1QSEA 4GQ9H 1RJLA 2XQBL 5E6IA 4PRAB 4N8CL 3U4BH 2E6PA 3H9SD 1J05B 4GSDL 4OLVL 1T1XB 3HI1A 5GRVK 4ETQA 4IEFB 3LN4B 3DX6A 3QDMD 5K59F 1G6RH 3MV9D 3KPSB 4K8RH 2PCPA 2JIXB 2X9YA 1JWSB 3U79A 4L8SC 1OSZB 4L3CB 4RBPK 3NZHH 4OCSH 3O9WC 5SWZB 4L29B 4NRZA 4U0RB 2ICEB 3RVVC 4HWEH 1C12B 1ZT4A 5L88H 1NJ9A 3LZFH 1CXLA 3MJ7A 5E5UB 3GSNA 4P2OC 2NW2A 1D5MB 3LH2H 1CXFA 4HCRH 4LQFH 4ZS7H 3VRJB 1GPOL 5C0FB 4HFWB 4KI5D 3QXUA 3V6BR 5CD3A 2EXYC 1P69B 3PL6D 4QY8A 4UOJA 5LG1A 1P4BH 1EO7A 1WITA 2D7PA 2AXGB 3V6OE 4PJEE 4PJ8C 1UM6H 2EE6A 1U3HD 2AJUL 4KK9D 3VXMA 4I18B 3JV4A 3RIAK 1NCCH 4NDMB 2P7TB 5ELIA 5GRXG 1AHWA 5EU4A 1QYGH 4EI6A 5KOMC 4PV9B 2C4FU 3PHQB 2APBA 1CICD 4OUOA 2ED8A 3LEVH 4GFTB 4MB4A 1N7ML 2J2ZA 3CLEH 3GRWH 1S7SA 4NCDA 1J0IA 3AM8C 3BD3A 4KRPC 1EAPA 4NNXB 3QWOA 2PXYA 3E3QC 2DLEA 3W9EB 2H6PB 4OD3H 4A2LA 4QRPA 5HGAB 1HXMA 3DV6B 4NKMB 4R2GB 5DUMH 4G7VL 3MV11 3VWKC 1J0JA 2DD8L 4KPHH 3QNXA 5TDNA 3LRHA 4D3CL 3VI3E 3LQZB 3FFCD 2VE6A 4G3YL 1PQZB 3T08A 1ED3A 4MJ5B 1J0HA 1SBBA 3BGAA 4JHWL 2VSDA 4YHKL 3AREC 4N68A 2LE9A 3D25A 4NQTA 3D9AL 4HG4K 4Y4HA 2F53A 2Y25A 3PGCA 1TTUA 3ARXA 2G60L 4XHQA 3ARQA 3HZMB 1RU9H 1MQ8A 1J8KA 4U7MA 5D1QC 1O7VA 2DQGH 4K3EL 1TETH 4UB0H 1FL3A 3MYJA 3O3AA 3O8XB 1NDMA 3I6GA 3AAZB 4O2EA 1OLZA 3FRUA 3CUPB 4PGCB 2ZUVA 5IVXF 4WTWA 1ZTXL 1DQQA 3PIQA 4U0RC 1I8LA 1KJMB 4DCQB 3PP4H 4HXBL 1CTNA 2FH6A 2XKSA 5CBAB 1EVUA 4PRDB 4K94C 3TBTA 3H7BB 1KTDA 3BZEB 5C0GB 2IAMC 3C5ZA 5MHSD 2CLVB 3LSOB 3L1OL 3B2UD 4MA7L 2ARJA 2AK4B 2VDLL 2X44D 3MLYH 5EU6A 1FJ1A 2MSPA 4KQ4H 4HIHA 5DQDL 3CVIH 1G6RA 3FN0H 4N5EC 5DJDB 4LCIL 1OTSD 3ECBA 2A9ML 4YK4C 2FX8H 5DJCB 4E41B 2CR6A 4GBXA 4D9LH 2XV6B 2B1AL 1I7UB 4FQJH 3BSZL 2HT4C 5M7QA 2YD1A 3WDHA 1U8HA 1UYWH 1RIHL 2PW1A 3QIUD 3CD4A 3VI4E 4MJ6B 3PWUB 2VABA 1HINL 1UJ3A 4O58H 2JJSA 1IEHA 2P8MB 3MRHA 1A21A 1H0DB 3G08A 2VAAB 1MIEH 2VLKE 3H9YA 2AP2A 3O4LD 4RWHA 2E6QA 4GW4B 3V7AG 3ZKND 5I0ZA 1ND0B 1AGFA 2XFXB 2IFFL 4KUZL 1TCMA 4WWKA 2AVGA 4PPTA 3U6RA 2G75B 2R23A 3EUUA 2EKSB 4IRSC 3W2DH 1H3TA 4XP6H 4NGHH 5JXEC 1S7VB 1F6AA 3S37L 3VXRB 2GJ6A 1NBVH 3PWPB 1EO8L 5CZXD 5C3LD 1DCLA 2P49B 4O5LH 5KW9L 3SDAA 4QRRD 2IADB 2FR4B 3GRWA 4R4BA 2WWKO 3I02A 4KJWD 1YJDH 4LEXL 1L6ZA 3F65A 3OR6A 2A74B 3FO9B 1WBXB 4OGAD 2YPLA 1M7DB 3NOIA 4BFGA 4ODBD 5A2KH 3CCHB 3UBXG 3I9GL 4E5XB 2CPCA 2XA8H 2H9GB 3O8XC 5MP6H 2DM2A 2AV7B 3TBYB 3GO1H 1VFMA 3I2CL 3HI6L 5FM5M 4LNRA 4OLZH 4QRSA 5GPRA 2HG5B 4EN3C 3SPVA 1CI5A 4EDWL 4P4KD 4U3HA 2LVCA 2XIDA 5E8NA 4LLWB 5HHOD 4UV4L 2NXYB 1INQA 1H3PH 1D7FA 5IR1B 4HS6A 4MS8C 5HHPA 5C0BA 5BRZB 3H3BC 5JPMA 4LSTL 3IS0X 4RMRA 3VFSB 1P9MC 4DN4H 1M7XA 1QRNB 1F3JB 2LFGA 1SBSL 4FQXD 5F89B 5JMRA 4WI5A 3MMEB 3HMWL 3NCYS 1MCKA 3CK0H 1F3DJ 4M62L 5GQBA 1W8OA 3BVNB 5EN2B 1JUFB 3TO2B 3OPZH 2A9NH 4DUVA 4PJ9B 4GMTH 2VLLA 5DD6B 3WYRA 1CFVH 4QHLB 2H1PL 1I85A 4W6YB 1T4KB 5DD0H 3G5XB 5CSGA 1I3UA 4L9LB 2HKFL 1OP3H 5FGCB 3F7VA 4HC1L 2JJUA 3V0WH 4ZSOB 4JDVB 4OGYH 1XGUB 1WZMA 5I71C 1JF6A 2VDRH 1RUQL 3WO3B 3IETA 4NC0B 1A6WL 3OZ9H 1A7OL 4G8FB 1I1YA 1JPGA 1KIPA 3DO7B 1DLHA 3VG9B 3H9SA 4J1UA 5ICYA 1EBAA 2WV3A 3LS5L 2KQMA 3EBAA 4CUCA 3QDMA 2W60A 1E6OH 3MV9A 3MLTB 4JQXC 1C8PA 1TMCB 4MDJB 1ERNA 4BYHA 3IKCA 5LWYH 3PE9A 1K8IB 4JFOA 2ATKB 1ZK9A 2C3VB 3NN8B 1B3JA 4X4XB 2RAMA 1QNZH 3TT1H 4S1RH 4WU7A 3KNBA 3MRPB 4CADA 3MRCA 4NNYA 5D93B 2H32H 3LKRB 4J8RB 1LK2A 1R5IA 5GSRA 3AXLB 1ZAGA 4NKIL 4G8EB 5F7UA 4QKXB 3CSBA 2QQNH 1BHGA 5C6TL 1D6EB 1E27B 3PL6A 4WI8A 3QXTA 4NHCL 4XP9H 3C8HA 1KGCD 1QO3B 3V5HA 4XPHL 4FXKA 5JORA 5D1ZC 3U4EA 2Y72A 4DVRL 1U3HA 4PY7A 4JO2H 3HRZB 3DJ9A 3CZFA 2DMCA 4IMLB 4S1SH 2BY0A 4MA1B 4Y4KC 3VFOA 2AQ1A 1T5XB 3C08L 4UDUA 1SMOA 3MR9A 1KNOA 1CICA 1KB5L 1ZHLA 3BZ4A 4HLZH 5IROA 4JKWA 4UZGA 5DJ6B 1MFEL 4OAWA 3EYUL 4NRYB 3HE6D 1ZLWK 1U91A 4GG6B 3EDFA 1BFVH 1JGDB 3PDOB 3I3BA 3KYOA 2OR9L 1JTOA 4X7TA 4YHLH 5D96C 4PJ7A 2FIKA 2Y7QA 1F5WA 5CUSL 4OQTL 4FOMA 4PTTA 2AKRA 1AGCB 4X5LA 3DVNB 4IOSD 5EO1A 1AC6A 4TUJA 2A6KB 3O3BB 4Y0GA 1QVOB 3OJMB 3MRKB 3FFCA 1M7IB 2ZCHL 1QBLL 3T65A 3KPRD 3QQ9C 4KZDL 4QTIL 1AGBA 3HA0A 1JYVA 4ZUWA 3PJSB 1BFOB 4M43L 1T66C 1YQVL 3QJFA 1DE4B 1FNGA 3QUXC 4PV8B 5ICXA 2VXTH 2WLZA 1RZGA 3KPLB 3FQTB 5C0EA 1N64H 1Q1JL 3S34H 1VEMA 3OAYK 5HYSB 4I2XA 2H2PD 1CFQA 1I1AA 3DYOA 2ADGB 4Y5XB 2NW3A 1ZEAH 5E2WL 5C6PB 3E2HC 5DJZB 4Z7NE 3L5WB 1INDL 2DL2A 2PYEB 3B2VL 3ARGC 5IW1B 1OM3H 3SCMB 1MIMH 1AXTH 5HDOA 1DUYA 3PGDA 3FQWB 5DO2D 4PS4H 5BW7C 3W5MA 3K46A 4FFVC 5FM4A 4NT6A 4WTXA 4LVEA 5CEXA 1AGDA 2LTQC 2CJUH 4UBDD 3NABH 4YUEL 3V4VL 3LVEA 1C5DB 4NQSA 2VAJA 1CL7L 3RJDA 2VWEC 3QDJD 5T5FH 4ZFZB 4FTVE 3HG1D 1CGTA 4HIJA 3UTPD 3SBWA 3UC0H 2A73A 5EU3A 4A6YH 3BDXA 2DJSA 5C08E 4OF0A 1YYLL 1H15B 2VLMD 1IGFH 3PQYA 3MO1B 3WFHA 3QCUL 4GT7A 5CZKA 1A3LH 1F02I 2OBGA 4Y1AB 3QIUA 1T80A 1KXTB 1TVHA 3T0XA 4FNLL 2H32A 2ZCKL 1C08A 4PJDB 4Z18A 3CVHH 1OY3B 1KC5L 5DTFA 5EZOL 3RWHB 4GMSH 1RZKH 5MEPA 3QWRD 5JA8B 1KJ2H 5F71A 4UV7H 3CSYB 5FO7A 3QR2A 4AH2A 4RGND 2DDQH 4DW2L 4P9HH 3HUJB 2OTPA 3STBA 3O4LA 2NYYC 1J8HD 1D5ZB 3QH3A 2O5ZH 1G7QA 1VCAA 1U8LB 4WUKH 5L8LB 1CU4L 1QFUH 2ZJSL 2XZAL 4X7SH 1MFAL 1CLYL 3RNKA 2QQKL 3ILQD 1SJEA 3DVGA 3F58L 1NFIB 4WHYG 3U0PB 4ENED 5K9KA 4QRRA 5GZNC 4WUUD 5E4IA 3CDYA 1WAAE 3H3PL 5FHAH 3CPLA 4OV5B 3MA7B 1OAUL 1EEUA 4Y5VC 2G5BA 1S7WA 1YEJH 5JIPA 1HNGA 2YUZA 2ZUSA 2I60L 1S7RA 1LEGA 5FUOL 4ZUTB 5MEOA 4HUNB 1PEWA 4K23L 5DEGB 2Z91B 4YQXL 1S7QB 3PGFH 3QT2A 4PB0L 4R0LC 5FYKL 1NGPH 4R7DB 4N0UB 4F15C 4X6CA 3MNVA 2VDPH 4P4KA 5C0RL 5DUBB 4PRID 3CU7A 5HHOA 5CEZL 1FGVL 1YEGH 2RFXB 3KS0J 3O3EA 1KXQE 4Y89A 2DQTH 1LNUB 3AU1B 3LD8C 1QFWH 3FB5B 1MQKH 5HGGS 1MCJA 4RGOH 5DDHA 2CRMA 5LKNA 1OAQH 2VKXA 4Z7VA 1J12A 2DYPD 3V7AE 2DL9A 4X6FB 2X7LB 2WZPD 1QBMH 3QB7C 5CKAA 1NUNB 3D3VB 1LO3L 4FQXA 3W39B 4TTGA 1IZKA 2DBLH 3JTSA 3WNMA 5KVFH 3HE7B 4P23B 5I1KH 3L5XL 2QL1A 5F1NA 1VADA 4ZNEA 4U1JA 1ZS8A 4DEPC 4M8QB 5T3ZD 2UZYB 1CCZA 3G9VA 3SJVE 1GGIL 2GI7A 1XF3B 1AD0B 3SOBL 5E08L 2GJZA 4HIIB 2F9BT 1A6VL 4PJAA 4UU9B 3W0WE 3PP3H 3LDBB 2WIMA 5IB1B 5F3BA 1RZ8B 1X5HA 3N1MC 5JO5A 1CQKA 3BKYL 2X4RA 5IW3A 4GXVL 4P5KB 4Q9RH 4GG6F 4BZ2H 3IJYA 4PJFA 5C71A 1IAIL 3QO0A 4RA0C 4BKLB 2ZWLT 4CBPA 3CNKA 4A6YA 4JY4A 1WIUA 2VC2L 1KIUA 2ADFL 1UA6H 4IBLT 4I1NB 1FVCB 1QSVA 4B0MM 4EVNB 1V7NH 2ZP0T 2VLRB 3FB8B 5E94A 3MRLA 5IK3B 5IVNA 4PRNB 1RJZA 4HUWA 3CVHA 3FT4B 1JHTB 4LSVH 3CAFA 1KJ2A 4PJ5E 1T0NA 4LGSB 3UJTL 2H41A 4PJIA 2R2EB 4R4NC 4Y19E 4TN9A 1JGEA 3BKCH 4DGYL 1HOCB 1AP2A 2FZ3B 4OCMC 1XGRB 1ULVA 3SGEI 4XPBL 3QEQE 3TP4A 3PWNB 3LN9A 4BH7B 5CP3H 5F21B 4DTGL 1INEH 4H88H 5KAQG 2R2CA 5ERWB 3HC0B 1G84A 3O3DB 4O2CA 3ALWA 1TVDA 4L5FH 2P47B 4U1NA 4XPGL 2JCCF 5FHBL 3SKOB 3V7MA 5FCUL 3SE9H 5IMLA 3ZHKA 5ITBL 2KH2B 3IRPX 4OT1L 3HE6A 2O61B 3LKPB 5JHLL 3NIGF 1CF8L 4NN7C 4NCC2 1JVKA 1KPRB 1A7RH 4YDKL 3HE7C 2R4RL 3TH2T 2VDKH 4B7LA 5KSAD 1YMME 4CVZA 4AM0B 2D7TL 1K2DB 5FA4B 4LOUC 2BOCB 2EIEA 1T5WB 2NY4C 3MBXL 4LRNH 3KPQB 4QXUH 2P8PA 1QEWB 2FWOB 4HBCL 1CFTB 2P5WE 5GRJH 3UZEA 5F9JA 5IB5B 4JFFB 2GCYB 3KPRA 4LPTA 2NY5C 5KVDH 4K3JH 2IPUK 3ULVC 1S9XA 2VLKD 2IANB 2ICCA 3IJHA 4HUXB 4TTDC 4PJDF 2NY5L 1HN1A 3KPNB 4O51A 5LCVL 4WI2A 4M9OA 3OMZA 3ULVL 2CUHA 4BQBA 4HIEB 4P0DA 4G80A 4WHTB 4CMMB 4PIRF 2FATH 3HUJF 3C8DA 3F7QA 4LCYA 5HGBB 3IFPB 2V5YA 1FG2A 4JJ5B 3SDCC 4QOKE 5T3ZH 3D0LA 1I8IB 3HCVB 4Q6YA 4NHUA 2UZIL 2EICA 2NXZB 2AEPH 5SV4A 4OZIB 5T1KA 1AQDB 1M4KA 2PTUA 4JY5H 1BX2B 4PGDB 4MDIB 2E6JA 4Y2OA 3T2NH 5GGRA 1HSAA 2I26N 4NKOB 4B5EA 3GK8H 3OKMA 1MWAL 5GSVB 3I3DA 3VFVA 1RFDL 4ISVA 4YDVB 3BOVA 3QDJA 3ZDXF 4HWZB 2W9DL 3VD9A 3HG1A 3MV8B 3NVQA 5DMIH 1XZ0A 3BHBB 5IESL 4IS6A 3QUZB 1SHMA 2CIKA 3QQ3A 4HJGB 3KG5A 4Q9BA 3CMOH 3TEUA 4X0KB 4GRLD 2WWMD 3L3HA 1U8KB 5EORL 1JNNH 4LBEB 3TPKA 4WDIB 4P5TA 4JG0H 3C5JB 3TPUA 1YNKH 5I8KH 5JW3L 2I5YH 3HZYB 1UEMA 2EEBA 2KDGA 2X89D 4MJ4A 2ZSVA 4OCLC 2YBRB 3QWRA 4OCYH 1SEBB 3F7YA 2YUWA 1OB1A 3WXVH 3MCKB 5HPMA 2FX9H 4QWWC 5DK2B 1NAMH 5C0JA 1G7IB 3FCTA 1J8HA 1ZWIA 4ZPTA 4JLRB 4EBQL 5IEKB 5C8JA 2R1XB 3BP5A 2IBGA 4QYOB 1KBGH 5E9DB 2AQ2A 5CGTA 5ILTL 1E4XI 1OTTD 1T6WA 3E3QE 5CP3A 4ONGL 2E7LA 1UXWB 4TOYH 3AS0A 3GM8A 4D94A 2ENSA 1W0VB 3OF6A 2BZDA 4OFYD 2V5TA 4LHUA 3QCTH 1OAZH 4RMUA 4XNMA 5JHDB 4Z8FH 3QRGH 4WUUA 2XZCH 3QSKB 1QUNA 4I3GA 2EIBA 5IP4A 1MNUL 1EHLL 3HC4H 1HSBB 3BPCA 3HNVH 1UKQA 4KDWA 4H26B 3MLVH 1A4KA 3ULUC 4NP4L 5FXCH 1BQHA 1I8KB 3ZHLA 4UTAH 1B9ZA 2RHEA 3ULUL 3FHQA 5DMGD 5LAXB 2IQAA 1GGBH 3OKKA 3D39B 1F58H 1G9NH 2ZOLA 4XCNB 3I50L 4NPYA 5BQ7A 4DGIH 4PRIA 1A9EA 2AJVH 3GEWB 4NUGH 2A38A 2WIIA 3MLRL 5F88B 3WE6A 3GSVB 4JN2A 4R26L 2R8SL 3VGAB 3C6LB 1ADQH 3P11L 2XNAB 2DM7A 5ACLA 2FEEI 3N50A 4KY1L 3NIDF 4XMKL 4YBLC 2HVKB 2NTFB 2GY7B 1FNSH 2R29L 4R7NA 3N0PB 4XBEL 1DR9A 5BCAA 3Q6GL 3LQAH 3ARBC 4ORGA 3VRIA 4JRXE 2X42A 1LMKA 1BBJB 4Y16C 2D4DA 3RHWF 2BVUA 2GTWA 2Z8RA 2R15A 1CLOH 4XWOD 4QT5B 4EUPH 2Y4SA 4LF3A 3VFTA 2ZSWB 1JGUH 2FHFA 2MPAH 3HNTH 5E8OA 4M1DH 3N85H 3NPSC 2R9HC 1A7BA 2DQJL 4LCUB 3FN9A 1OPGH 4PG9B 2IG2H 5H2BB 4U2ZA 5DHYB 3N9GL 3QZWG 1HHKA 5E8PB 2EEDA 2G2RA 3MRBA 3VXNB 3MNZB 3L3JA 2XKUA 1NANH 3VGBA 5F9AC 4H1LB 1VGKB 2BERA 3GI9H 1RJYA 1AR2A 4NZUH 1BD2B 1KPUB 1DVFD 3WD5H 5MEQA 1T22B 4KZEH 2FDBP 3UJJL 1MI5B 4ALAL 2EH8H 3D6GA 1RHHA 4HKBA 3RVXD 4XPTH 3O2VL 2EIZA 4DZBB 2APXA 1NC2D 1LE5B 5TE4H 3OKDB 5CLWA 3QJHA 4YDIL 1MCSA 1E6JH 1QSEB 3S5LB 4UT9H 4U2YA 2PO6D 3UCRA 4Q0XH 3LEXB 1PYWB 3TJHC 4HJ0C 1NAMA 4H8WC 4NCC1 3HI1B 1DSFL 4ETQB 4MD4A 5HGHB 1UM5L 1U8JB 3TYGH 2PCPB 1FFOA 4R4FH 5J7CC 3ZE2E 1XR8A 4D0BA 2EDFA 4MCYA 1GGCL 4XPAL 2VDMH 3QIBB 4ZFGH 1ORSA 3OXRA 4LKXB 3WDIA 1NJ9B 2XXCB 4OZIF 3GSNB 4FTVD 1DBBH 2NW2B 3BWAB 1YUHB 3VXOA 1J0KA 3MRMA 4CVWA 1DBJL 3C6LC 1U8IA 4LARH 4IRJB 3F12B 4QHNB 3EDDA 5GJTL 4M48H 1JZ3A 5CJQH 5JOEA 3SE4A 3GSXA 4HH8A 5C08D 3C60D 1DLFL 1MUJB 1NGXB 3B5GA 4MB3A 2HTKD 1C5CL 3BX7C 4G6ML 5JQHC 5KSAA 3ALXA 5IJKC 4G7YH 5C0IB 3MV01 3VXMB 5GGTL 2VL5A 1U93A 3WHXB 5FF6A 4KDTA 4Z7QF 5D8JL 4RWYH 4ZUSA 1AHWB 5IQ7L 1FVEB 32C2A 3VCLA 5E1HB 2V2XB 5T1MA 3RUGE 1B2WL 4NN6C 1TQCB 2VLKA 1S7SB 1GH7A 2VQ1A 1ADQA 3V6ZB 4JHAH 3BEWA 3OAZH 2VLJE 3GB7B 1H8NA 1TQBB 1BMGA 5D7JC 1MJUH 3DETD 4QRPB 1RZ7L 3D0VA 3PP3K 2I24N 4JKKA 2X4OB 3JV5A 4JHZA 4TSBL 2CKBL 1KTKE 4G42A 3P9LA 2BP3A 3S4SA 3QNXB 5TDNB 4HAFA 2ORBL 3BGMB 1TJGL 1QRKA 5D7KD 4EUPA 4JKMA 2BOBA 1KIQB 5DEFA 4OM1H 3VXQB 1ED3B 3PHSA 1S9YB 5I19H 3G5VB 3AC0A 3L3IB 1S7UA 4RA3A 1T03H 5E6IC 2XA3A 2F53B 3PGCB 4NQVB 1MHPL 3MACH 3UXFA 2PR4L 5IEHB 3S8WA 1E4KA 2HH0L 2Y23A 2O5XL 4JPIA 5ESQA 2LABA 1R0AH 2XTJB 4WJ5B 3I6GB 4KXZH 2EDRA 3VXSE 3U9PH 1S5IH 4N0CC 3FRUB 1J88A 3QEGH 1PGRB 3RGVB 4XX1E 4GRLA 4XP5L 1DQQB 3PIQB 1D9KD 1MCHA 1QLRA 2IQ9H 4I77H 4OIBA 4U1IA 5IM7A 1OTUD 5JOFA 1F90L 3FQNA 4BK5A 4N0FB 4FZEH 2EH7L 2X89A 5B38G 5IT2H 5GRUL 1S5HA 1KTDB 2H8PA 3C5ZB 3EYVB 4ZAKD 5IGXL 1CDUA 4EOWL 5BVJA 2ARJB 2COQA 1FJ1B 4GLRH 4HIHB 3SJVD 1YPZE 1AJ7L 1ZT1B 4GRMB 1WFTA 2GITB 4P59H 1JCKA 5M94B 2CO7B 2X5PA 1CE1H 1F8TL 2CGRH 2UY7A 4OZGE 4U6XA 2X4UA 3RKDD 5SX4H 4YHIA 1N3NA 1U8HB 4OFYA 3HLAB 1NSNL 1MH5A 2CSPA 1NMBL 1TQCC 3LKNA 1W0YT 3WIIH 2PXYC 2ADJA 1DQJA 5E24E 3ARPA 2VXQL 5BMFH 1JGVH 1NGWA 1KJVB 1AGFB 1VGEH 1V8HA 3OAUL 4WWKB 5DT1L 3GMPB 3UYPA 4XAWH 5INDA 1NGYA 2R0WH 4WO4C 3U1SH 5EO0A 1FL5A 4PJ5D 3ESUF 1PDKA 3UAJD 4L1DA 4Y19D 4MMZC 1MJ7L 4R4BB 4Z76B 5GS1A 1HWHB 2KQNA 3JZ7A 2EDOA 3WLBA 2Z93B 4Y4HC 3QEQD 3OR6B 1EJOH 3TF7C 1I7TA 2NX5A 5B39G 1YECH 5JR1L 3TBVB 2CRYA 5B8CA 3BI9X 4OGXL 1PY9A 1ETZA 3PNWB 1Y18A 2VTFA 2OL3H 5F7DA 1JYWA 3FRPA 4RIRB 3KYKH 4JHBA 3WEXA 4DKAA 3GBNL 1XGPA 2R4SH 3ZYOA 1F2QA 3NCEB 4LNRB 3WFDL 1MFCH 5JMOC 1T2JA 3F8UB 1JYNA 4R97C 5EULV 1I8LC 1F11B 2IEPA 3SKNA 5E8NB 4F3FA 1INQB 2PNDA 4ODXA 3B9KB 3I6LD 4M6NL 2VUYA 3NTCH 1BAFL 3OWEA 4JREB 5JPMB 1DBML 4M8VA 3REVA 3K2UL 5CWSA 4ELME 1CFSB 3AS2A 5E99L 4YWGL 3C5ZC 1HWGB 1YMMD 4XTRC 3U9UA 3ZDYE 3MGAA 3TZVD 4LFHD 5L6YH 3O6FB 3D69B 2NY0B 1B6UA 4K8RC 2P5WD 5K9JH 5IJVA 4UILH 4HIXL 4OFKA 5BZWA 2VLLB 2R0ZH 1DVFA 1G6RL 4GBXC 1ZGLM 4PREA 4K8RL 3KDMA 1CLCA 5EUKB 2WUBL 3P4MA 1G7MA 2FH8A 4PR5A 1JZ5A 1UJ3C 4RDQG 4HWEL 3WHE0 2E8YA 5L88L 1FE8H 1QSFB 2PO6A 3NACH 1I1YB 1JPGB 1DLHB 3LH2L 3TBWB 2DQCH 4LQFL 3H9SB 3HB3C 1AD9A 4AENB 1WBYA 4QOKD 3I6KA 3LB6C 1LK3H 1UWXK 1E4WL 3DXAD 4WWKC 2QR0A 4MQTB 2W60B 1NLBL 1MPAH 1J1PH 3IFLH 1KTLA 1CGYA 3LS4L 5FYKE 2B1HL 1AY1L 3C5SB 3WHE1 3WNNA 5GZOC 3J7HA 4BUGA 2FB4H 3ZKSD 3QHZL 3SDAC 3GSRB 4YZFF 2FO4A 3WDJA 5CEZE 5GGUB 3A67H 1LDPL 4H0GA 4WU7B 1QYGL 4OZ4A 2YXMA 4CADB 2MQ3A 4NNYB 1EGJH 1ZGLP 4P2OD 4FTVA 4NKDB 1R5IB 3UYOD 4DN3H 3CLEL 1X7QB 5C0AE 1IRAY 3EO9H 4Z7OE 4PJGE 4U6VL 4NUJB 4NO2B 4F80A 3RX5A 4OCWL 4K7PH 4P49A 5C08A 3C60A 3TYFA 3R1GL 2Z9TA 3TCLA 4GKNB 4OCXH 3RVTC 3V5HB 4FXKB 4HPYH 5F7NC 1H9VA 4LCWD 1U3HB 2YKLH 4PY7B 3CZFB 4NWTH 3ZDZF 1OP9A 5EA0H 3IDXL 3TV3L 2YD2A 2V7NB 3L7EA 3EO1A 1GZPB 4UDUB 2X09A 3KPPB 1IKNA 4PRBA 1CYGA 5FGRA 2Z0BA 3GMNA 1ZHLB 2FHCA 3BZ4B 3UO1H 3P3YA 4FQCH 4OAWB 5C0CD 3MXWL 3BP7A 4K3HA 1QD0A 1KEGH 1BECA 2I07A 4MXVF 4ZDHA 2I25N 1GL4B 1YN6B 4K2UL 4F7PA 5I2IB 1Q0YL 5ENWA 2OL3A 1RU9L 1FHGA 4PTTB 5IBLD 1X4ZA 2AKRB 1ACYH 4UB0L 4JR9H 3VWKD 4LDLB 5C09E 5EO1B 1TZIA 1PX4A 3EFFA 2SEBA 43C9B 1AQKL 1I85C 4HG4J 4I48A 3INUL 3TJEL 5EC1A 1TXKA 1VENA 1PG7L 3FFCB 3GMRA 3T65B 5EBLB 4DUWA 1S9VA 4PLOB 3PP4L 5KS9B 2LAAA 4PY8I 1AXIB 3MRDA 3QEUB 5F1IB 3X3GL 1RZGB 2HFGH 1BQSA 1R3HB 1XGYH 1GXEA 35C8H 1L7IH 4I2XB 2DN7A 5KVEH 1CFQB 4JRYB 4NM8L 4NFDA 2V5SA 1PKQE 4HEME 3ZO0A 1FG9C 4WEBL 1NGQH 4KQ4L 4YHOL 4JZJA 3TC9A 4Z0BL 1SYVA 15C8H 1GZQB 1YNTA 2FX8L 3U46A 2DIAA 4D9LL 3SDYH 2BVEA 3QFDB 4PY8J 3BKJL 4I3SL 4N8CH 4NQDE 2EO9A 4U49A 1AGDB 1ZVSA 4GSDH 1FNLA 4OLVH 4O58L 4KI5C 4K71C 1GHFL 4ZAKA 2XWJA 4NOFA 4NQSB 5EU5A 3PL6C 2J8OA 3L5IA 2MWCA 3SJVA 5I76B 1QOKA 1A3QA 5D5ME 1WWBX 1U3HC 4CU7A 3VE0A 4KK9C 5EU3B 3RI5K 2BHYA 4HUVA 5DJAA 3W2DL 4JE4B 2HT4D 1A6TB 1RPQA 4KTEH 3IDIB 4L8DA 2F54B 1RV6X 5TQ0L 4IIQA 2FGWL 1CICC 1EGJA 1TVHB 1YEKL 2WMPA 1YJDC 1GPOH 3ZTNL 1C08B 4PLNC 1G6VK 3BXNA 4HKXA 5DTFB 3KXFB 5CBEB 1Z5LB 5MEPB 1NEUA 3D2UB 2Q3ZA 5FO7B 2HT2D 1Y6KR 1GOGA 4AH2B 1PSKL 3ZKXB 1MFNA 3IXTA 3ULVE 5HDBE 1TLKA 3O4LB 3L3KA 2AJUH 1IILE 1G7QB 3GHBL 4YXHL 4PRPB 4IRSD 3RNKB 4J23A 2Q8BL 1PD6A 3EFDH 3FMGL 4QRUB 1T6VN 4OLZL 4U7SA 3T1FB 3DVGB 4PJ5A 1HKFA 1N7MH 3SGJA 5K9KB 1OWWA 4FP8L 1JZ6A 4QRRB 4Y19A 4OLWH 4F9PA 2EDEA 3RWCA 1Q9OB 5FO9A 5KVGL 2Z35A 4CNIB 3QEQA 1XCTA 3MLXL 4JVUA 4M1CC 5IB2B 2G5BB 3MODL 1VFUA 4W4OA 4DKEL 4DN4L 5F6IB 5TGBA 5DD5L 3N06B 4X7CC 2BRQA 2WQRA 4HS3A 1LEGB 3MV7E 3W9DA 2UZXB 1I1AC 3GJEA 2BX5A 1CD9B 4CMHC 4G7VH 5DMJB 5MEOB 2FEEL 2DD8H 1LO0L 4FN0A 1T89A 5FO8B 4OFVA 4D3CH 3IFOB 4O00A 2DLGA 1IGYA 2BDNL 2DM3A 4EN3D 5HYJE 3OPZL 4G3YH 3RPIB 3MNVB 2HT3D 3BH9B 4ONHA 3QUML 4M9PA 4JHWH 5HHOB 3LQMA 4YHKH 1UH4A 2MKLC 5DEZA 4M93B 3H0TA 5C0DA 2CLZA 5ALBH 3TIDA 2OCFD 1KIRA 1WK0A 5DDHB 4JZOB 2G60H 3V0WL 5H35B 2VNCA 2VZ1A 4Z7UE 4OJFH 5EIIB 4JG1H 5JW5B 1YMMA 2EZ0C 2VDRL 4K3EH 4M7ZB 3TZVA 3B2UC 3DRTA 1ZANH 1T2QL 2KKQA 4TVPD 1B6DA 1R3KA 2N4IA 3W82A 5AG8A 4XCYB 5ANMA 2P5WA 5F1NB 2ESVB 1VADB 4Z0XA 4U1JB 5F1SA 1ZS8B 1ZTXH 1OTSC 4YGVA 4XNYL 1H3WM 4QXTA 5AZEL 3F7PC 4HXBH 5KBNC 5LWYL 4NO0D 3QIUC 4M3JA 2OR7A 3I84A 2P48B 1A2YA 3O6LL 4S1RL 5E7FA 4WFFE 1G9MC 1GIGL 5JO5B 4MA7H 3DBXA 3RNQA 2VDLH 4PJBE 5DQDH 2BSTA 2X4RB 3KYAA 4OI8A 4WHYH 1G9ML 2QQNL 3IJYB 4MAUL 4QOKA 3ZKNC 3QO0B 1XCQB 4LCIH 3DXAA 2A9MH 5DRWA 5C2BH 3DX9A 3V0VA 2B1AH 3ULUE 3MRGA 4A6YB 2Q6WA 5CAYB 1CD0A 3OKNA 2YWYA 1RIHH 4LDEB 4GAFB 5CZXC 2VZSA 3FQRA 1HINH 4QXWA 4S1SL 1HEZB 3V95A 3SDDD 2EE2A 1RJZB 4HUWB 3CVHB 1TPXB 3L5HA 4P2OA 3GMQA 4KJWC 1OD7A 5KS9F 3TLRA 4H5SB 3LKSA 1ZXQA 3KJ6H 2PYFB 1T0NB 5IBUG 2HA1A 3ARFD 4OGAC 4EDXA 3BE1H 4MA3A 4UT6L 2CLRB 2IFFH 4KUZH 1KCVL 3F5WB 2BVOA 3GIZL 8FABA 1JPFB 2VQUA 2C1PA 2IPKB 5D2LB 1MRFL 4S0SD 4LCWA 3S37H 1TZGL 4NKQB 1EO8H 4AY0A 1F13A 4P4KC 3VD4A 2XPGA 4LSQH 3F6LA 1RK0B 4KVCL 4Y4KD 5KW9H 3H7LA 3ZE0F 1KULA 2EDHA 1FO0B 3WN5C 4O2CB 4YIQA 3LOWA 3GSOB 5IMLB 2EYRB 3VFMA 3AM8A 5C0CA 5DXWA 3HE6B 4JM2B 4FQXC 1RZJL 4I13B 1YY9D 4PLJC 2R1YB 3TWCH 5LXGH 1NBYB 5I1AA 2AJZA 1FFNB 3I2CH 1DQLH 4LMQI 4X98A 3HI6H 4WFHD 3K80A 4PP2B 2HJFA 2IBZY 4AQ1B 3O2DL 3KR3L 4EDWH 3HMXL 4MJIE 4RCAA 4ZFOL 5IVZB 4UV4H 4JJHA 5T1LD 3RA7L 1UACL 2ZOKA 5ID1A 1RZIB 1YC7A 4NQCE 5F9JB 1AGEA 3QQ9D 3KPRB 3MLZL 3MFFB 1MIML 1AXTL 4FQLL 4KJPD 4JFDA 1BGXL 4BFIB 1S9XB 3QUXD 1SBSH 3VXPB 3ARTA 1I9RH 3CFDA 1ACZA 3HMWH 4O51B 4NFCA 4G43B 1OWRM 1HH9B 2HJLA 4BK4A 2EYSA 4OD1H 4JVWA 4NQUA 3Q48A 4R90L 4XCCL 4TVPH 3QUKA 4LPWA 2K7PA 4LLMB 3UMTA 3ARUA 2RR3A 2HKFH 1FG2B 3H6JA 3ARGD 4RAUB 2UUDH 1CD8A 2Y5EA 4RGMB 4X6DE 4HC1H 1ZHNA 4ODTL 4YR6A 2OJEB 2FLRT 4MB5A 1RUQH 1IGFL 4FFVD 3JV6A 5JOPE 3KYMB 1A6WH 2BVPB 3S36H 1RZKC 3JUYA 5GGRB 1HSAB 5IVOA 3ZYZA 5D72H 2JK5A 5IHZA 3LS5H 4GMSL 1RZKL 4MNHA 3ILPA 1MF2L 4ISVB 4G6FB 5CGYD 5DD1H 4LU5L 5SWSD 2O5ZL 3V4UL 3IDNB 3QQ3B 4KQ3H 2B4CH 5EZLB 5IG7A 5I73B 1U92A 4C4KO 1QFUL 4QTHB 2D7QA 2HJKA 4O4YL 5E2TH 5IMOA 5I75B 3L3HB 3G5YB 4MSWA 5T1DL 4YPGA 1U6AL 1JHLL 3MX0A 2J1KA 1Q94B 3WL9B 3TPUB 1A3RL 3Q1SL 2J6EL 2IALA 4M61A 2F19H 3HE6C 2DQUL 3KLDA 5C6TH 3F6IA 2HLFC 2ZSVB 1P7KA 4UNUA 2FJGA 5FHAL 3SDXB 3QUYA 4NHCH 4RGNB 3QG7L 5HPMB 1Z9SA 2NYYD 4R96A 2BNRE 4DVRH 1J8HB 4Z77A 5KSUB 4JGMA 4ZPTB 2YS4A 5FKAA 1OGAE 1NBQA 1WT5A 2Y1VA 3TIEA 1MSPA 1WBZA 4IRSA 3PHOA 2JJTA 4ZYKA 4P2RA 3H8NA 4TUKH 3HPLA 1S7TB 3OXSA 4AIXA 1KB5H 5E1AB 4N9GA 2VDPL 3H2WA 2P42B 4JKLA 5TDOA 4X4YA 4XNMB 6FABL 3MJ9L 2V5MA 1MFEH 2WBJB 3EYUH 5DF0A 1AC0A 3DX8A 2ICWI 5GZND 1G1YA 1QFWL 3QIWB 4GAGL 1XIWD 2OR9H 1O0VA 3BPCB 3FT2B 2XN9B 4P5MA 2FECI 4P2QA 1QBML 4OQTH 1YC8A 1U42A 2VIRB 5FYKD 1UGNA 5DD3H 2DBLL 1H5BA 3V0AC 3MRIA 3OJDA 5EO9A 1DN0A 5KVFL 2IQAB 4OZFH 4JKPL 3E6FA 3OKKB 5FA3B 5CEZD 3GUTA 1YDPA 4LAQL 2IGFL 2ZCHH 4EN3A 1QBLH 4KZDH 3H9HA 4U1HB 2YK1L 4U1MB 2D9CA 1Z2KA 4M43H 5C0AD 3FOLB 2ICWJ 1HK6A 1D3CA 1P2CB 1EEZB 1OQXA 1WZ1L 1Q1JH 3LHPL 2DYPB 4BA8A 5AD0B 4GS7B 4S1QL 5E00B 3WUWA 3KYNB 3HAEG 3EDEA 4PJEB 5E2WH 2RQ8A 5JDSA 2W65B 1XEDA 4NRXB 3ARVA 4KDVA 2Y5TB 1GCFA 4R7NB 4Q9RL 1INDH 1EPFA 2QQQA 4Q9CA 1DEEA 3B2VH 4ORGB 3LIZL 2D7MA 4G5ZH 5D2LF 5IB3A 1JN6A 1I75A 2YOCA 4NNPL 5I1EL 4P5TC 4NO0A 1CWVA 5I17A 4YXKL 1V7NL 3LV3A 1HZHH 4YUEH 2FJHB 5D7IA 2OK0L 1CL7H 5JA9A 1J1OH 4OIAA 5GJSL 3RPKA 4LSVL 3GKWH 5C09D 4HPOL 4E42A 4JM2F 4YGAB 2G2RB 4LLVA 5AWNH 2FSEA 1EIBA 3L3JB 1WSST 2Z31D 5K9QG 4PUBH 1MELA 3G6JA 1P1ZA 3UYRL 1FVDA 2E7LC 4I5BA 5E5MA 2XZQL 1RJYB 1YYLH 3B8SA 4Z5RB 3ILQC 1PAMA 3QCUH 4NIKB 4NYLA 5E95B 3X12A 4B50A 1TIUA 1TNNA 2WINB 5FDWB 1RHHB 3U82B 4ENEC 1NCUA 5JNYB 1EZVX 2EIZB 5EZOH 1KC5H 3EYQD 3O0RL 5CSZB 3SDDA 2A6JA 1UM4L 5T5NG 2W0PA 2W92A 5K9OA 2OSLA 3R06B 3SE9L 3HPJB 3ARFA 2G9HB 3G5ZA 4IMKA 4R4ND 4J3OC 4UQ3A 5HHNB 1VKXA 3NA9H 1DQML 1RK1A 5F7KC 5EG6C 4P46D 1CU4H 2ZJSH 4MD4B 4MX7A 1MFAH 1CLYH 2BSSA 1EBPA 2QQKH 3ET9F 3KLSA 1FFOB 5BOZG 1XR8B 4D0BB 4MCYB 3H9ZA 4NQDD 2O93L 5DJ2A 3IDJA 1IGIH 1ORSB 5GRJL 1UB5B 2Q86A 1OAUH 4OF8A 1BM3H 4V1DE 2EE3A 3VA6A 1FV1A 4JB9L 3MRMB 3V5DA 5AAWA 3TFKD 1YPZA 4RQQA 4J7RA 4OQTA 1AO7B 4K23H 5J9PB 2UVEA 3VWJD 4YQXH 1QKZL 4AZ8A 3MXVL 1BZ9A 4DVBA 5J0BA 4PB0H 4NWUH 2C3HA 4OZGA 5EZIL 5FYKH 4OZFA 3HZKB 4UIMB 3V6FA 2YWZA 1HHIB 4NZRH 5KSAB 5FYLL 5JPNA 4LOUD 1T7XA 2NY4D 5EU6E 5CEZH 1FGVH 1R5WA 2EXWC 5CD5D 2VL5B 5T1LA 4BSWA 4X6BA 2PETA 2ZUYA 3LPWA 4M6ML 5JDJA 1EFXD 5T3ZL 4ZUSB 1P7QB 4X80H 3HS0A 4Y2DD 2AXFB 5FV2A 32C2B 1NGZA 1VERA 3HZVA 3VCLB 3FHAA 2AEPL 5T1MB 5ITFA 3ULVD 2IWGA 2VLKB 1LO3H 2AQ3A 3QUXA 4HUKB 1R3JB 5DWUH 5DHXB 5DHVH 3FAXA 3T2NL 1DANT 3L5XH 2YRZA 5LGHL 3SDXF 1Z6JT 3U30B 3D0VB 1BOGB 3VH8A 2APVA 1CXHA 4G42B 1GGIH 2GSGA 2HLAA 4YDLB 3SDCD 3PDDA 3ARGA 3SOBH 5E08H 2B8OT 1A6VH 4EUPB 4LDOB 1F2XK 4FQQA 2ZKHL 1A8JH 1FZMB 1OHQA 3IF1B 1JNNL 2GJ6E 5I8KL 5I1IH 5TFSL 3RVUC 4QGTA 1IAIH 1Z9MA 3JSSA 4J12A 1WF5A 5FUZL 3DOSA 5FKPA 4JPIB 4HX1B 5ESQB 3BO8B 4JFYB 2JJWA 2D03H 1DDHA 2FX9L 3LRGA 3HTLX 3IS1X 3FN3A 1MAML 5SWSA 5GGVY 1NAML 4RZCA 4LSRH 4GW1B 2ADFH 1AR1C 2YPLE 1FYTE 1H3UA 1ZOXA 1PW3A 4FQ2L 1DUZB 1U2CA 3CFCL 4WI9A 3P2TA 4MAYD 4ELMA 5DI8A 5KN5B 3FOMB 4U1IB 2B5IC 2B39A 1FFRA 5JOFB 5KTEL 1OAZL 3UJTH 3FQNB 5I74B 1P6AB 5ID0A 3QRGL 2XZCL 4YXLL 4DGYH 1KT2A 1S5HB 5J12B 5C0BE 1QSZA 5A2IH 4JFQA 4XPBH 4QWWD 3SE4C 4PJEF 1W2KT 1EEYA 5ESVA 4WY7L 5CLTA 3RKPA 2E9IA 1K3IA 1G9NC 3EAKA 4DTGH 1T3FA 3UPRA 3HR5A 5I16A 4LVHB 1GGBL 1I7RA 4YE4L 1KLFA 4KDTC 4Y4FC 4U6XB 5FHBH 4XPGH 4WFFD 1ZLUK 2C1OB 4YHIB 1N3NB 3FTGB 5ITBH 2AW2A 1MH5B 1KEML 4JAMB 3U0WH 3BPLC 5JHLH 3MRJA 1CF8H 4NBZB 3LKNB 4U1SA 3W81A 1GAFL 1XIWA 2I9TA 5FGSA 5C07E 4YDKH 5EUOF 2ADJB 1DQJB 5DC9B 1B0GA 4LKCA 4X8JB 4LHJB 4U1KB 2MHAA 1XT5A 3LQAC 2Z92A 1NGWB 4PJCA 1KJ3H 5FECB 5L0QC 3MBXH 1FNSL 1I1RA 3RWGA 4HBCH 4YDLC 3P30L 3ZT5A 3KPTA 4S2SA 5INDB 5AG9A 1EO5A 2A6DA 2Q8AL 3MUY1 3RU8L 1IAOB 3MV9E 2OTWB 5C0AA 3QXWA 1JRHI 4AIZB 1YEDA 4OIIL 4PYHA 5GS1B 1DJSA 2ITDB 3HNTL 5DHVA 2WW8A 3D85B 3QI9A 3ULVH 2DLFH 3N85L 1EV2E 4XRCA 3QULA 4KUCD 5LGJA 2NNAA 1E4KC 4XNZC 3SGKA 4HKZB 3BYYA 5B8CB 4LPYA 3TBSA 3VMPA 3I3EA 1ETZB 3MUHL 2FO1A 2AXHA 4BFEA 2H26A 2CDEA 4Y16D 3WEXB 4EJ1C 4QHUB 2UZIH 5I1JH 4GRLC 2WWMC 3NMEA 3UEZA 4NZUL 1N59B 2VMFA 1LO5B 4I0KA 2BSED 3EW3B 1VB9A 3X11A 1MLBB 3RZCC 5CWSB 1MWAH 2J5LC 1A6ZA 1RFDH 1CD1A 2W0FA 4PG2C 3QNYA 4MQ7A 3U9UB 2BCKB 4O2FA 5C09A 1KCSH 1K5NA 3NGBC 4ZSOE 3VU2A 1ORQA 3MROA 2AJ3A 2H2SC 2Z31A 2CDGA 4NQCD 1F4XL 1OTTC 3CFJA 2X70A 5BZWB 4PJ7E 1HILA 4PREB 1JF1A 1MVUA 2OXGA 3VI4F 1EAJA 2OP4H 4H20L 1W72L 1LO4L 3P4MB 4J6RL 5JW3H 4PR5B 3L9RA 1KSRA 1FH5L 1M05A 1NC2B 3U0TB 1FSKB 1LD9B 4HS8L 1LP9F 1DL7L 1DBBL 1PY4A 2HFTA 4TQEH 3PWVA 1LEIB 1YY8A 3TJHD 3VFGL 4HJ0D 4EBQH 3EYSL 1WIOA 1U2HA 5ILTH 4ORZC 1WBYB 3SO3C 3I6KB 1FP5A 1EDQA 4P46A 1KACB 5CJQL 1JNHA 1B0RA 1ZLVH 1MY7A 1N8ZA 1WWWX 5JOPD 1UXSA 5DJYA 3ROLB 1NC4A 4NQDA 3QFJE 3DHMA 1TITA 4KROB 2FO4B 5DK0A 4RWYL 2C3WA 2DI9A 1RIUL 5HY9A 1MNUH 2AAVA 1EHLH 1GVIA 5GS1C 1A1NA 4FTVB 2QQLL 3B5HA 4CAGA 3RWDA 3MBED 3DROA 2NR6C 1TZHA 5D5MA 5HHVL 3OB0K 3MGTA 5B8CC 4YHYB 5FOJA 3VWJA 4V2BA 3MREA 4AQOA 4K7PX 5C08B 3TYFB 3C60B 4LHUG 1T04A 3TCLB 3I50H 4NJ9L 2P8LB 4KK8D 4NFBA 5BV7C 4D9QE 4XWOC 3MLRH 5FYKU 3CDGA 2VN4A 1A6UL 2OI9B 3VDBA 1U8NA 1NCNA 2Q1EA 4R26H 2OQJA 1BQHG 4UDTA 4Y2DA 1TJHL 2DRUA 5BV7L 2R8SH 4PRBB 4FABL 4WI6A 3CH1B 1K6QL 3GMNB 2X1QA 1OQOA 3P11H 2R0LH 2BNRD 4AK1A 4KY1H 3PQYE 1TVBB 3DARA 4F9LC 4IRZL 4XMKH 2UV3A 3BP7B 4YLQT 2R29H 2I07B 3NCCB 4S0TD 1T03L 4ZDHB 4ELKB 3Q6GH 3N1GC 1S9WB 3MACL 1N26A 1XF4B 4UOW0 3R8BB 5IFAL 2HP4A 3KHOA 1DVFC 3EFFB 3FQUA 1JNLL 4Z7WE 3SDCA 1KG0A 3QEGL 3RVXC 5EZJA 1NCWL 3EDJA 3GBLA 5HYQA 2DQJH 3PWLA 2VZTA 2FD6L 1FZKA 3LKQA 1MWAA 1T20A 3P0GB 3N9GH 1U8OA 4ZXBD 1QLFA 4F2MA 4ZTOL 2PO6C 2JCCE 1MJ8L 4UOW1 5E0QA 3STLA 2ITCA 3P0YL 1BIIB 1IJ9A 4B41A 1R3IH 1JZ7A 1TCRB 2AJXL 1MAKA 4JZJB 4XI5D 4HMCA 3UJJH 4ZFFA 4N0CD 2K1MA 5I18H 4GKZB 4JZNA 2V2TA 1SYVB 3O2VH 4MAYA 5AUMB 4OB5H 3MNWA 2D4FA 1YNTB 1D9KB 4Z7UA 1CE1L 3U46B 4OCRH 2YD5A 2ZCLH 4X6CE 4U05A 4W6XB 3L3GA 2BXZA 5FB8A 3WS3A 3P9MA 1DSFH 4ZAKB 1VESA 2XWJB 4Z9KB 5EU5B 4MYWB 4Z7VE 3WIIL 3BYTA 1UM5H 5BMFL 2HTKC 3SJVB 4MZ3A 1JGVL 1GGCH 3KPOA 2YSSB 5ICZB 2CDFA 4XPAH 4ZUUB 5HVFB 3QPXL 1CIDA 3W0WB 4HUVB 3JWOL 1GSMA 4WRLA 2BNQB 3IDGB 1C16A 3UBXB 3BD5A 4HXAL 5I8EB 4JDTL 4JFEE 4OM0L 4ZUVB 1IC1A 1IKNC 4PJBA 3RIFF 2D0GA 3UZVB 1DBJH 2YXFA 4K07A 2F74A 1DANU 3BXNB 3MJ8B 4KU1A 1YQ2A 4JO3L 1B88A 4MD5A 4GKSA 1CXKA 1DLFH 3UTOA 1X3DA 4GUPB 4XVJL 1C5CH 3T04D 1WLHA 5IMKA 5IQ9A 1YECL 1CVRA 5BZDA 5GGTH 4ODHL 4QCIA 2RCSL 2OL3L 5IF0A 1MHCA 4PJFE 5GIRA 3ZDXE 2HRLA 1L6XA 1JNJA 5E70A 4TVSa 1HHGA 2JIXD 4LP5A 3CGTA 4RFOL 5DRNA 5IQ7H 2R4SL 4JGJA 4WO4D 4ZO9A 4PJ5B 1B2WH 1UZ6E 1I4FA 3BPNC 3DGGB 4XZUA 5DR5L 3CX2A 1ONQB 3BJLA 5CJ5A 3T3PE 4Y19B 3RY6A 4PGEB 4W81A 5KG9A 5FO9B 3RBSA 1FGNH 2Z35B 4WEUD 3QEQB 3STZA 4IHOA 2DTSA 2CK2A 4EQ3A 1MREH 4QRTA 1BPVA 4U7KA 3M17B 4TSBH 2CKBH 4Z7NF 3RAJL 2F8VA 4HK0A 3UTQB 1U8MA 4OBRA 2ORBH 4PJIE 4KKLC 1IGYB 5ECJE 5IFJB 2JELL 4V1DD 1CG9A 5I0DA 1KGCE 1FL6A 4U3XA 3EYOA 3QXAB 4UQ2B 1G1CA 3H0TB 4PGBA 3U7YL 3TIDB 4DQOH 1KIRB 2BNUA 2DKUA 4Z95L 2W91A 1MHPH 1DZBA 3WJJA 1X9QA 1JL8A 2PR4H 2R39A 2HH0H 2O5XH 4XTRD 1YMMB 3S4SG 3G04B 2QEJA 3T0WA 3TZVB 3NACL 3PXJA 4Q6IA 2A83B 5D7SL 3CFEA 4X6EA 1ZHKA 1YEFL 5AAMA 3CSPA 3LN5B 4NQCA 5E6ZA 3P77A 2EDBA 4XP5H 2VISA 4YGVB 1BQUA 2XI9A 5GISH 4QXTB 4R2GD 4GBXD 2GJJA 2ERJB 3IFLL 3BKML 1KLGA 3RKDC 4AEEA 1F90H 2DIBA 2M8XA 4IIQC 2V9RA 3MRQA 5DSCA 2EH7H 5HTSA 1M71B 4XCEA 4AT6A 5BOPA 5IGXH 4EOWH 3BUYB 1J1XL 4ZOCA 2N1KA 2WP3T 2BSTB 1XF2A 5TPWL 4XNUL 3HB3D 2AI0H 3MRNB 3OKEA 2IH3A 4QOKB 5DRXA 4X6DA 3M1BA 4S11A 4YBQD 1BFSA 1F8TH 1JIBA 3DURA 3MRGB 3NIDE 4K7FB 2Q7YB 1I3VA 3TN0A 1ES0B 5I1DA 4Q7DA 3OKNB 4L8SB 1UWGL 3O9WB 1NSNH 4NWTL 3FQRB 3SGJC 5GZOD 4YHML 1NMBH 1XGQA 4X7FC 1WAAF 1NBZB 3KS0H 2OJZL 4XBPB 3RWEB 1FZOA 3V5KB 4F9PC 3OKOB 4P2OB 1MJJA 1A02N 3LKSB 2VXQH 3MBEA 2GFBA 2KL6A 4W4OC 5DVNA 4EDXB 4FQCL 1FYTD 3QO1B 1GC1C 4CDHA 1KEGL 3VMNA 5BO1L 1EUTA 2BVOB 8FABB 4XP4L 1T89C 5GGTA 2HVJA 1GC1L 1D5XA 5IJKA 4PJ8B 3QDJE 3HR6A 3S37X 1ACYL 4HK3N 1QLEL 1OL0A 1IKFL 1MJ7H 4L8CA 4YIQB 3PABB 1QR1A 1OAXH 3PF2A 1VSCA 3S3SA 4ZD3H 1CGXA 2DBJA 3ZMRA 5MERA 2YEZB 2ZUTA 2BNRA 1JWUB 1P4LB 4CVXA 5JR1H 3FB6A 3I75A 5IWLC 2HFGL 4QHKI 2P4AB 2CKBA 1K4CA 1L7IL 1DBAH 4U4BA 4WNQA 2J7LA 2FYYB 2HWZL 4X5XB 3VWKB 1MCWW 4KHTL 1KCLA 4MCZA 1NGQL 4KRLB 3AS3A 5IVXA 3ETBF 4M6NH 5C07D 4WW2F 1BAFH 4AEFA 1DBMH 4J2XA 2FJFA 3K2UH 3PWPD 3TNNB 3RHWK 3SDYL 4YWGH 2YC1A 4M7LH 4I8DA 3AREB 3GBML 4YC2C 4MHHG 1T1ZB 3FRPG 3SKMA 4BJLA 5ACZB 4LPCA 5DMYA 4ZXBA 4JFXA 4UT7L 5A2LH 5D2NE 4C56B 2HJLB 4WUUE 3S96A 5I6XB 2EYSB 1B0WA 4RAHA 2WLYA 4JO4H 4OZIE 1HH6B 5D1QB 1ZA6A 5EC2A 2H3NB 4HIXH 5D7LE 3L95A 3NIFF 2YR3A 4F7EB 4RFNC 2IFGA 1IT9L 4ODWA 1IGML 2WUBH 3F62A 1JZ2A 1ZHNB 3GJFK 3SKUD 3IFNL 2NXYD 5H37G 4KTEL 3JV6B 4OF6A 4PRIE 4WGVB 5E6YA 3DX7A 5I1HL 3DUSB 1WEJL 3BZFA 4G9FE 4N8VA 1H3VA 2JK5B 2WUCL 2IAMB 5IHZB 4JEGB 4JRXB 1SY6L 1E4WH 1QRND 4ZPVB 3ILPB 1EJ6A 1NLBH 1JI2A 3LKOB 3T4YA 5HDLA 3QG6A 2W0KA 1IC5H 3SGEH 1IFHH 1BWWA 3LS4H 2B1HH 1AY1H 5F9OL 1F42A 2M1KA 5FYLE 5ACMA 5IG7B 4HZLA 4YK4B 3QHZH 1HHHA 1I7ZA 2DWEB 2HJKB 1B4JH 1LDPH 2EDJA 3QAZC 4U33A 4MSWB 4F8QA 1OSPH 1HHJB 3EFDL 1OVZA 2C9AA 5T3ZE 2X4PA 2FX7L 1XH3A 1XF5B 4AMKL 4U6VH 5CFHA 4OLWL 4OCWH 5B3NA 2FJGB 1A9BA 3RTQC 3BAEH 4EI5C 3R1GH 2P5EE 5JHDE 4KKAD 4Z77B 2AV1A 3MRFA 5IBLC 1U3JA 1T1XA 1LILA 4FQIL 1NCDL 3ARDD 3TIEB 5J11C 4ODUA 3LN4A 4IRSB 2FRGP 3IDXH 3PHOB 3TV3H 2JIXA 1JWSA 5FFLA 3HPLB 4WO4A 3C2AH 3P40A 4JFPA 4N9GB 4W6WB 5TDOB 5F44A 2W9LA 2J88L 2ICEA 3DX8B 3MXWH 1G7JA 4ONFL 1C12A 5ALBL 4XH2B 2IC2A 3LAFA 1U0QA 1FFQA 2QV2A 4K2UH 1REIA 1D5MA 1Q0YH 3MUGA 4M1CD 5I6XC 1N6UA 1UT9A 4OJFL 3ALPA 3VRJA 4JG1L 1I1AD 3ZTJG 5I66A 5J1AB 3QFJD 1ZANL 2E3VA 4DKFL 3OJDB 5EO9B 1AQKH 1DN0B 1IC7H 3E6FB 4OLEA 3INUH 3TJEH 1YDPB 1TJIL 1PG7H 1ZVYA 2AXGA 3ZT7A 4EN3B 2AGJL 2VR5A 4V1DA 3H9HB 1HXYA 1QFPA 5CS7A 2VL4A 3B5TA 3QRFM 2W38A 4Y8DC 1OGTA 3X3GH 4PV9A 4PTUA 1IBGL 5DGQA 3PHQA 3CFKB 5D6CB 2GYSA 2EZ0D 4NM8H 3DYPA 4NNXA 4WEBH 4YHOH 3U7WL 4D9QD 3K4DA 3W9EA 4CL7A 2H6PA 4Y8AA 4Z0BH 1DEEB 1I8MB 2Q76A 5GGSA 5HGAA 4NKMA 5C2BL 2X10A 3QDHA 3QQ4B 3RUGB 5HJ3B 3PQYD 3WFEH 3BKJH 4I3SH 4X9HA 3LQZA 3DSNA 3L3OB 5J13C 4QHMA 4QNPE 2VLJB 1MRDL 4ODSL 1GHFH 5I71B 1AIFA 3TA3C 5BXFA 2HT2C 3QUYC 3KJ6L 4CDGC 4E42B 1A7PL 2VXSH 3EHBD 4LLVB 3HZMA 3BE1L 1UKTA 1WT5C 2GK0A 5E2VH 4I5BB 1T7YA 2JJTC 3QDGE 1JPSH 5TQ0H 2FGWH 2PYED 4P57B 4YEFA 4DKDC 3CUPA 4PGCA 1U58B 1YEKH 4N0YH 4LSQL 3ZTNH 3DI2B 1HQRA 5A16A 3SDDB 3EYFB 3BN9C 4PRDA 4GXUN 5CINL 4S10A 1BBDH 1PSKH 2AJYL 2VDOH 1WZLA 3NZ8B 4L3EE 3G6DH 4MVBC 3FQXB 1FYTA 2X4SA 5ETUA 5C0GA 4KTDL 1KF9B 3VXSB 2CXGA 4P99A 3ULSA 3GHBH 4UQ3B 2CLVA 4D9RE 4YXHH 5I15H 4HZAA 4WVRA 1H5BC 3TWCL 2MOVA 5LXGL 2AK4A 4IDLA 4QF1B 4XVUD 1MCDA 1CQYA 2BSSB 5D1ZB 1DQLL 2Q8BH 3FMGH 3HAEH 5DJDA 1RIVL 3J8F7 4ZODA 4FP8H 2HT3C 4Y4KB 1KB5B 1U95A 2NY6D 3EJYC 5DJ2B 4KJYB 1I7UA 3JTTB 2QLVB 2DF3A 3L7FB 5KVGH 1XR9B 4Y1AD 3MLXH 4P4RA 4YHPB 3O4OC 3MODH 4UNTA 1FV1B 4DKEH 3PWUA 5DD5H 5F9DC 4XBGA 1YPZB 3FONA 4RQQB 5EBWB 1EHXA 1MLCB 3LPGA 2P8MA 1OF2B 1CN4A 1I9RL 4PLJD 5C1MB 1LO0H 4ZMAT 1H0DA 1R24B 5D96B 4OD1L 2VAAA 4DVBB 4OZGB 4HMEA 2BDNH 3NFPB 4KK5C 3V6FB 2VRAA 4G6AD 4JFED 4TVPL 3CDFA 3QUMH 4NQEE 3DHJA 1RUPL 1R5WB 1JZ8A 5T1LB 2HTLD 4X6BB 5C07A 1S7VA 3WIFA 3VFPB 3PWPA 3UBXI 1NGZB 4LEOA 1JWMB 5JIIA 4Y5YA 1PZUB 1G7HA 5ITFB 1JMZA 2IADA 2LU7A 2FR4A 1L0QA 3QUXB 5HGDB 2ADIA 1LWRA 3S36L 5KSVA 1QR4A 2A6IA 1T2QH 2Q20A 1OAYH 1NH6A 4TSAL 5D72L 1OW0A 2A74A 3T1WA 1JV5A 3FO9A 1WBXA 1X5IA 5L9DL 1M7DA 1AKJD 3QXDB 4XNYH 5AZEH 3CCHA 3E2HB 5DD1L 1EEQA 2B4CC 4QLRA 2H9GA 2PTTA 5SX5H 2AV7A 2HRPH 4I4WB 1LE9B 2GSGB 1Q0XL 1R3LA 3BQUC 3ARGB 4KQ3L 2B4CL 3R8QA 3QP3A 3ZSTA 2HG5A 3KVQA 2MKWA 4GKOA 4ONOA 5AEAA 3HKFA 3AY4A 4FQQB 4LFHG 5E2TL 3V9FA 4LLWA 2OTUB 6CGTA 3O6LH 3SDDC 3GMLB 5FK9A 5IFHH 1GIGH 5IR1A 2B0SH 5DJXB 3QA3B 2NZ9C 1K4DB 2LTQB 3ARFC 1Y0LA 1G9MH 2XY2A 4MAUH 2F19L 5GHWH 3VFSA 4IMKC 3OR7B 2YRLA 1FBIL 1QRNA 4OD2B 1F3JA 4LASH 3B9DA 5F89A 3RJQB 3MMEA 1DDHB 1YNLH 3ZE2F 4F57L 1GGUA 4RZCB 3RRQA 3W5NA 9CGTA 3DVFA 4MXVE 2NX5E 3BVNA 5DYOA 5CEYA 4X9BA 1NFDE 4F7TB 1JUFA 3TO2A 8CGTA 4DGVH 2A77L 4LMQE 1KB9K 4ELMB 4OKVA 3G5XA 4TUKL 4L9LA 1IMHC 4FFWD 4WFEE 4LNVA 3B8YA 4GO6B 1CLZL 1DQDL 4ZSOA 5JIHA 4JDVA 2HLFD 1KFAH 1XGUA 4UT6H 1IC4L 4YBHA 3VFUA 1KCVH 1YY9C 1RUAL 3GIZH 3BESR 4L3AA 1CXEA 3DO7A 4XC3L 1H8SA 4XVSH 3UDWA 1MRFH 4HH9B 2AS5M 1UB6B 5ESVB 3IGAA 1TZGH 3TVMD 5EDXA 3ARDA 5DD3L 3VRLE 4GXUM 4MA8L 4KVCH 5H8DA 3HAEA 3HR5B 3UPRB 3Q5TA 1EMTH 1C5BH 3OHXA 3CMGA 3CX5K 1I7RB 4HWUA 3MLTA 1M6OA 4MWFA 2VR9A 3RUGF 1K8IA 5CCKL 2ATKA 2X4TB 4N0RA 3VXUE 4U1GB 3NN8A 4KJPC 5KANG 3WJLC 4LLQA 1NLDL 4U1SB 1RZJH 1T21A 1UWEH 3MRPA 1XIWB 4X5WB 1V3KA 4J8RA 2ZUQC 4Y5VB 3KLAA 5KAQF 4Z78B 1IVLA 1B0GB 4LKCB 3O2DH 3KR3H 2MHAB 3HMXH 1E27A 3L3DA 3QEHA 2Z92B 2ZZUT 3AFLA 3QFJA 1R5VA 2IJ0C 3RA7H 3QUMA 1QO3A 1UACH 2IH1B 4R0LB 3T09A 3QZWB 4F15B 3MLZH 4G5ZL 3P9WB 2A6DB 4FQLH 1BGXH 5T1KD 3LD8B 4PJGB 1YEDB 4RRPA 1A22B 1VFOA 2HN7A 4NO3A 1G0DA 1FYHB 3X17A 1HZHL 5F7EL 4P9ML 3WXWL 5DJ6A 4C83B 4DK6A 4NRYA 3QULB 4XRCB 3FKUS 1BJ8A 4R90H 1Q9KA 4GAJL 4XCCH 4F7CA 1J1OL 2XG4A 3PV7A 5CGYC 3MA9H 1BVLA 2UWEB 4GG6A 1K3ZA 5EPMA 3T3ME 3GKWL 1FQ9C 3PDOA 1IEBA 5IIEB 5AWNL 5A1AA 2BY1A 3VGHA 1UENA 4M5ZH 4DEPB 3WUZA 1AGCA 4PUBL 2X05A 4ODTH 4WI3A 4HWBL 3DVNA 1X4YA 1RURL 2R1WB 4H0HB 4BM7A 4D0DA 2N56A 1QVOA 4P5TD 4OQ1A 5BJTB 1OP5H 1M7IA 4HGWA 5GS2D 4YDJB 5C9JA 5J57B 4IDJL 1AXSB 2ARWA 2GIYA 2PKDA 4ZOBA 3PJSA 3HI5L 4DUXA 2IAND 1MF2H 2W0FB 3ZL4L 3QNYB 4LU5H 4MQ7B 3QISA 5L8KB 1YPZF 5C09B 1ZLSH 4NJAL 3FQTA 3KPMB 1JTPA 4Z7WA 5HYSA 3V4UH 1ORQB 2WP3O 3NCYP 3NA9L 2ADGA 4BFBD 4HT1L 2C5DC 1QSFE 4OZGF 2NY2C 3CFJB 4O4YH 1GOHA 1KN4L 5T1DH 1ZSDB 2DKSA 5DJZA 3OF6D 1HILB 1JHLH 1U6AH 1AE6L 3GKZA 3L5WA 1PFCA 3GGWB 4RMVA 2PYEA 2UYLB 5IW1A 1A3RH 3Q1SH 4UTBL 2J6EH 4LHUD 3SCMA 4JPWH 4U1GC 3EOTL 3IB4A 3L9RB 4JPVL 2JCCA 2DQUH 1M05B 1IGIL 1TFHA 3RY5A 3FQWA 3JWNC 2K9UA 1N0XL 5D7KE 1XIWC 3BISA 3GIVB 5D7LD 1PKQB 2M26A 5FUCE 1BM3L 1CE6A 3H42L 3QG7H 5F8RC 3SY0B 3MLSL 2DQHL 3PWVB 1U3YA 4GG8A 2AEQH 4DFHA 4KVNH 3O6MH 3S88L 4LAJH 2HAZA 5E2UL 1CFNB 1BP3B 4ZFZA 5IHUH 1H3XA 5FAAA 3B9EA 2KPNA 4NWUL 5TE6L 1ZA3B 3QUZD 3CXDL 5IMMB 4NZRL 3RX8A 5DJYB 3ME0A 6FABH 3X14A 4NQDB 3MJ9H 5GGQL 5AYQA 3VXTA 5A40E 5DZNA 4G9FD 3WN5A 5IKCB 4GAGH 1H15A 1T1WB 5HY9B 4X80L 4Y1AA 1A1NB 3QI9C 2MQ0A 3RWDB 2MFNA 2XACC 3P73A 3RWHA 4NN7B 1QFHA 5DWUL 3SGKC 3MGTB 1UZ8A 2YPVL 3O2DA 3HMXA 4U1LB 3ES6B 4JM4L 5FYLD 1N6QL 1VFAB 4JKPH 4ZFOA 2Y6SC 3SQOL 3WBDA 3HUJA 4APQD 4LAQH 2IGFH 1BIHA 4JFEA 3BEVA 1U8LA 2YK1H 2GSIA 2NY4B 1WFUA 2EXWD 1LDSA 1CK0H 5JXAL 2CIIB 1MVFA 1EFXB 5F3HB 4ELMF 1WZ1H 3DO3A 4UDTB 2MTPA 3LHPH 4XCFH 3UZQA 5CHNB 2P5ED 5JHDD 3U0PA 4S1QH 5D1XD 1IAIM 2R56L 3ZDYF 5AYUL 4PD4K 3DSFL 5I1IL 3MA7A 1G7LA 1W8NA 2EECA 2Z4QA 3PXHA 2GUOA 2DI7A 4RBPH 3LIZH 4M4RA 1AKJA 1I9IL 4MXQD 2Z31C 1HE7A 4M7KH 1NQBA 4ZUTA 5B38B 3FO2A 2D03L 4MNQE 3FB7B 4MLSA 2Z91A 1SJVA 1NUDA 5ALCH 2NLJB 4NNPH 4LSRL 5I1EH 3VD7A 2VITB 1MHHA 3SDCB 4R7DA 3WUWG 4YXKH 1IQDB 3C87A 2MCG1 1A6AB 4JRYE 5LJYH 2YA0A 5EZJB 5DLML 12E8L 3EYQC 3PWLB 2VZVA 2OK0H 2RFXA 2WWKT 3IRZA 5GS2H 3MV7B 5GJSH 3LKQB 1MWAB 3OKLB 43CAB 1G0YR 4HPOH 3AGVA 1QLFB 3X13A 3RVUD 2X7LA 3MZTA 1IGJB 1HYSD 5HYEA 5HYJB 3UYRH 1A14H 4P46C 2XZQH 2ITCB 5F6HI 4KK6D 4AEHL 1WCBB 1E28B 1OAKL 1AR1D 3WFBH 1FIGL 3RWJB 4S1DC 4JZNB 2V2TB 4X8XA 4BUHA 4M8QA 3UTSB 1MCIA 2CO6B 2APFA 2J6EA 3O0RH 1UM4H 4Z7UB 4TNVK 1XF3A 3O11A 4UUJB 2ZUXA 4Z7OF 4PJGF 3N1QC 4UU9A 5B21A 3TFKC 3U0WL 4DAGH 3RWIA 5IB1A 3I6LE 1DQMH 3GJFB 2FGZA 4MNGB 3VWJC 5F6HJ 3ZZ1A 4CKVX 3I85A 4LCCA 2AJSL 1HQ4B 2UWEF 3TVMA 4LLDA 3KJ4C 1UVQB 3SKJL 1KJ3L 4KRNA 2CDFB 2A1WL 4BKLA 5EU7E 5IV2A 5CD5C 5KSBB 5B39B 3MJ9A 4Y4FD 5ANME 1C16B 4K9EL 4NZJA 1SQ2N 4X4ZA 4PJXE 2UY6A 4ZTPL 4Y2DC 1FVCA 4PJBB 4JB9H 4XX1G 4PRPE 4MD0A 4PRHE 4PRNA 2EDQA 3BP6A 2F74B 1DTUA 4HHAA 3RDTD 1QKZH 1PZ5A 3FT4A 3MXVH 5HD8D 3CFIC 2DLFL 4GKSB 1FFPB 1OP3K 5EZIH 3C09C 3QDGD 5FYLH 5EBMA 4LPVA 1HOCA 3RL2A 2FZ3A 1XGRA 5BZDB 4M6MH 1MHCB 3PWNA 5GIRB 2RJMA 5DGRA 3BPOC 5DJ0B 1QTYT 3DXAE 2V17L 5I1JL 4L3ED 1XFPA 4JCLA 4BSVB 5EH1A 3T8XA 4X7DC 5ERWA 1ZV5A 4RMTA 1NKOA 4D9RD 1FC2D 1HI6A 4OZFG 5L2JB 3SKOA 5J6GB 4JY6B 5LGHH 5FIEA 3GI8L 3D87B 4YBLB 1FORH 1KENL 2E9WA 3OG6B 4QRTB 1KPRA 2XY1A 2KZWA 1KCSL 1YEEL 3EZ8A 4FXGB 3ARBB 4POZC 4Y16B 2JE8A 4AM0A 3WS6A 1K2DA 4MAYC 5TDPB 2ZKHH 3DMMC 2L4OA 3O45A 2B20A 3U36B 3KPQA 2DM4A 4LCWE 3WNKA 4PGBB 1CFTA 2OP4L 2ESVE 4JFFA 5JUEH 3HFML 1X5ZA 2GCYA 4IJ3C 3EGSB 1CDHA 2BNUB 5TFSH 4OUUA 2DLHA 3NPSB 3RZCD 4OF5A 3VH8G 3OJVC 2BK8A 5FUZH 2IANA 1VFBA 1QA9A 1QBBA 4MJIB 5E4EC 4JDZA 1JMXA 4NQXB 3KPNA 4WTZA 3JV0A 4NQED 1MAMH 1U8PA 3CC5A 1NCAH 4TQEL 4KV5E 4X99B 5C0CE 3AMLA 3CFEB 1EHNA 3NFNB 4HIEA 4HKJB 2H2SD 4Y88A 4WHTA 4CMMA 4FQ2H 4NQCB 3CFCH 3IDMA 5HGBA 3IFPA 4P3CL 1OARH 4XP1H 2QADC 4DOHB 3T4AB 1JTTA 1LEKA 1T2XA 1CXIA 3GSQB 1KLGB 3MCG1 5KTEH 2E7MA 2CUIA 3HCVA 4HV8B 5D2NA 5DSCB 2C3XA 4ZO6A 1BZ7B 4TUOA 4YXLH 4XCEB 4AT6B 4OZIA 3BH8B 2EC9U 3DNKA 1ITCA 2XKNA 5D7LA 1BX2A 1RULL 4PGDA 3ULVF 1G7PA 5HDBF 4AJ0A 2CKNA 1GOFA 4NKOA 4WY7H 1QBAA 5GGVL 4JFDE 4FQPA 5GSVA 4POYA 3GSWB 2QBWA 5DRXB 2BRRL 4X6DB 4YDVA 3M1BB 3BGFC 2Z8WC 4U6TA 4YE4H 3BHBA 4GAYB 2XTJD 1A6PA 2GEEA 4R3SA 3QUZA 1Z9OA 5I1DB 2MJWA 4M7JL 3EIFA 2KUTA 3AMKA 1JFQL 2IMNA 1KEMH 4X0KA 1XGQB 4G9FA 1GAFH 4LBEA 1JJUA 2BHUA 3RY6C 3C5JA 2PW2A 1MJJB 1NMCB 2ZUUA 2GFBB 1T0MA 3VG0H 3HZYA 2R0LL 3E6HB 2NR6D 4M1GL 2NX5D 1CL7I 2YBRA 4R6UA 4YNYA 2DTML 3RGHA 3MCKA 1QQDB 2GAZA 4WU5B 4YFDB 4APQA 1IGCL 2HVJB 3P30H 5IEKA 2Q8AH 4WFED 5E9DA 5C6WH 3RU8H 4G9DA 5CIPB 3FT3A 1KCRL 1UXWA 2GTZB 4OIIH 1W0VA 2BMKB 1EXUA 2P5EA 5MERB 5JHDA 5D1XA 4RMWA 4NN6B 5EIQA 1WTLA 3WJJC 2BNRB 2JB6A 4F33A 4CVXB 3RL1A 2J4WL 1OGAB 4RX4D 3I75B 5HHQB 2P45B 1HSBA 2O5YL 4KJQD 4Q6IC 1CR9L 1N2RB 4H26A 1FN4A 5D7JB 1F45A 1K4CB 4XNQA 4WNQB 2DIJA 3VXUD 1R3IL 5LAXA 4FQHB 4JPKL 1X5LA 3MCLL 4XCNA 5I18L 5KSBF 5HDQL 1FCGA