1BFVL

Monoclonal antibody fragment fv4155 from e. coli
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
113
structure length
113
Chain Sequence
DIELTQSPPSLPVSLGDQVSISCRSSQSLVSNNRRNYLHWYLQKPGQSPKLVIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVAAEDLGLYFCSQSSHVPLTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody fragment Fv4155 bound to two closely related steroid hormones: the structural basis of fine specificity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords FV4155
total genus 26
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 1997-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bfvL00
1KLFA 4OZIB 2CMRL 4W68A 2OZ4A 3RWDA 2A9NH 4FMKA 2MHAB 3BX7C 4HZLB 3P9WB 3QZWG 5C2BH 5C0FB 4QTIL 4OZFB 3VXMB 3TLRA 1JPGA 3O0RH 1KTDB 4HT1H 1BM3L 3IU3B 4GG6A 3E6HA 1AY1L 2H9GB 5K93A 4AZ8A 1DQJA 2CIKA 4BZ2L 4P23A 3LMJH 1YYLL 4MQTB 3R8QA 1IQDA 4WO4A 1FIEA 1ZMYA 3CSYA 2YKLL 4UDTA 1ZVHA 1W72A 2R23B 4LVHB 4LRNL 3LD8B 4TULH 1MCJA 1X5IA 3LKNA 2CRMA 1BVLA 2FIRT 5CEYB 5D6DC 1A6UH 4C57C 5SWZD 1JYNA 4WWKB 3SDCC 4PJ8D 4A6YB 1P7HL 2C4FT 4NJ9L 1I9RL 4LIQH 3SE4A 2XRAH 3MRHB 1S7QA 1DUYB 1G0XA 1QO3A 2DYPD 3TBTA 1T20B 3BZ4B 3N1GC 4NZDA 3TA3D 1JGEA 4NQCD 3HG1B 2VR5A 2CLZB 3TFKD 4PRHE 4BZ1L 1D5IL 5IHUL 3GIVA 4KK9C 3PWNA 1MJ8H 4QTHA 3HNVH 1FC2D 5C0BB 3GM0A 1KEGH 3NCEB 3OXRB 3C6LB 3OKKB 1LD9A 2BVQA 1PZUB 4AQOA 1TFHA 1IKNA 2BNQE 5J12C 4QRRE 4YBQD 2E7BA 1FNFA 4KJPC 2EXWD 4PJEE 1EJOL 3L5HA 4HAGA 2GFBA 3VXRB 1OAXH 4FHBD 3NGBB 5J13C 2X4RB 1UJ3A 5J89A 3HKFA 4ZFFB 1TVDA 1UZ8A 3RY6A 4NGHL 4X7DC 5TDNB 1MJJA 3SPVB 3QUZC 4MMXC 1VFOA 3RHWF 5I71B 1LDSA 5CEZH 1PG7X 1AR1D 3K2UL 1A3RH 4OD2B 4S2SB 3ULSB 5BVJB 4NN5B 2X1XR 5IEHA 1N8ZA 1K3ZA 2O5XH 4HFUH 1DP0A 3MJ7A 4OTXL 4Y89A 2AJSL 5B4MD 4WEBL 4PRIE 4XHQA 4JDTL 2AJUH 3IDYB 5SX5H 4OZIA 3QHZH 2R0KH 4BSVB 4KTEH 4R2GD 1JNHB 1PKQE 5GZOC 3O8XA 3TEUA 2LV4A 4U6XA 1RJLA 1D9KC 4LSTL 2YA0A 1JRHI 3MX0A 3WIIH 1TJHL 4JANB 3VXUE 5FYLE 3IXTB 1E28B 3TO4A 5ANMB 3L95A 3IVKA 2I60H 1B0GB 1ZEAL 4CJ1A 1YEKH 4X6CE 5FO7B 3JV4B 3SGJA 4DKFH 1RZFH 5D8JH 1T7ZA 1YJDC 5DUMH 2Z9TA 1IBGL 3U2SB 1FVCA 3R8BB 4PJIA 1T7VA 2AK4A 3SOBH 4OZIE 4FQXC 3UYRH 4ZAKA 2VQ1A 3O2VH 4PUBH 3ZZ1A 5B21A 1JNJA 4YGVB 4ETQA 1DLHB 2JJTA 5C92A 1WF5A 5D96B 1PX3A 3V52H 3G5VB 5IT2H 1NC2A 1A7PH 2BY0A 4HUWB 5CJXC 4RA0C 4WWKC 3SDCB 2QR0A 2EH7L 4HUUB 1BM3H 2CK0H 1OW0A 4NRZB 4WHYH 4WTZG 5IROC 2VLKD 2NXYB 5C0GB 3D2UD 1MFEH 3DIFA 3V6FB 1A1OB 2AJVH 2D7QA 4PBWD 3P0YH 3SKMA 3VFGH 4BQ6A 3I6GA 1ZVSA 3P9MB 5KSVB 5ALBL 4Y5XA 3MBED 1OHQA 2Z4QA 3T8XB 2NW2B 4MB3A 1TITA 2EH8L 1J1OL 3QUXB 1IILE 1MWAA 1OQOA 5E9DA 3UTPE 1IAIH 6FABL 4PR5A 4XCYB 1Q94A 1YA5A 4IBLT 5AZEH 5EO1A 3CPLB 3U1SH 4IOFC 3RWEB 5HHMB 4NO2A 3NGBC 1KPRB 1AD9A 1B4JH 4JVWA 1RY7B 4HKBB 4D94A 1TVBB 1P84K 5D1QB 1IAIM 3ARZA 4YXKL 4PJXA 1A64A 5FUZH 1T1YB 2CRYA 1JN6B 2UVEA 4J3OC 2AV7B 3TO4D 3MREB 3NCJH 3A6OA 3BKCH 3O4LB 2BNRE 1IGFL 2VB5A 5DVLA 5D2NE 5TE7L 3IDYC 4JDTH 4HLJA 1HNGA 3HPJA 3VGHA 3K0WA 4RNRA 3GRWA 1QACA 2FYYB 4QHLA 1D9KB 4PGBB 5CKAA 2ATPA 2VC2H 2P1YA 2IALA 4JRWA 4TSAL 2XTJB 4AIZB 4OLEA 3S36L 3V5KB 3MZTA 2PNDA 4J12A 4CVXB 2R2BB 4M61A 4IMLB 3MUZ1 1TETH 2QSTA 3P40A 2EYSA 4ONHA 3ZL4L 1EEYB 1XCQA 4OCXL 4ELMB 1RZJL 4PJ9A 3BHBA 3SE8H 3REWA 3V7MA 1BLNA 1EFQA 1HSAB 1IC4H 4JQXC 4L8DA 3ARGC 4Y16B 3GKWL 35C8L 3GSOA 3CUPA 4YDLC 4XRCA 1VENA 4J1UA 1ZT4B 2R39A 2QSCH 3S4SB 2PO6B 1X7QB 5C0IB 5IOPA 4U1MB 3PWLA 4WIQA 3NN8B 3PDOB 3QDMA 1FFQA 4DVRH 3RIAF 3EZ8A 3S9DB 3QEQD 4I2XE 5HGAB 2DD8L 3QWRA 3FQUA 4JEGB 4C56D 4DKEL 1VGEH 3OZ9H 4EKXA 3LQMA 1FVEB 3WFCH 3ARVA 5CEXB 4HS6A 3B9KB 5JUEH 1KB9K 3F12B 4X6FB 2FH6A 3KGRA 5IJKC 1FCCA 1WT5C 2J2ZA 4HK0A 3WJLC 1G9NH 1RHHB 3D39A 4KGJA 2R1YB 2BMKA 3RPIA 3VWJD 2WK2A 5CD5C 4NBZB 2AXGB 4LEOB 1OY3B 1HXMB 1HHJB 4Y4KA 3DUHA 3RWCB 1E4XL 4AG4L 1JWMB 1IAIL 4YZFE 2ARJB 5GRVL 1ZGLM 1MLCB 2APBA 4TPRL 3TBVB 4F3FB 3WN5A 2FHBA 2HRPL 1CDUA 1YYMH 1IRAY 3H0TB 4KKAD 1SEBA 4XVTL 2VZ3A 3FQRA 4CNIA 4Q7DA 3QXDA 4FQPA 3ZSSA 2XXMB 2DS4A 2C1OB 2BNUB 3MNWA 4Q0XH 1KB5B 5HPOA 2UYLA 2XTJC 3IU4L 5BRZD 1AFVL 1RIHL 5HI3C 3QEQB 4M93C 4UIMB 1VEOA 4H20H 4EDWH 3HNTH 2WIMA 3MLXL 4Y1AD 5ESQB 3TNNB 5JXED 1JFQH 3O41A 2K7PA 1HCFX 3D48R 5DD1H 4ZOCA 1NQBA 5FCUH 5TPWH 4XMLL 3D3VA 4U1SA 5H35B 1F58H 4U6VL 2IQ9H 1L7TL 3Q3GB 5KSAC 5HTSA 4CW1B 3N1PC 3MACH 5EUKA 4JRYB 3OSKA 5EBWB 1BFOA 2V9QA 1T03L 4NO3B 3DROB 3ARGB 1WZKA 4Y16C 2A73B 3ZE0F 3KLSA 2B20A 4S1DC 5HDBF 1DBKH 2P44B 5IM7A 3PABB 4GSDL 3ABZA 4Q9RL 3QFJD 4P4KC 5GZND 3FB7A 1XGPB 1JGLH 1XEDA 1CE6A 1KYOK 3K46A 3CFCH 3DUSB 4OLZH 2W91A 3GZKA 2E6PA 5AUMA 2F8XC 1YMME 2GTWA 2A83A 1FFNA 2DJ4A 4N0YH 4OM0L 1LWRA 5HPMA 4KKCC 5DK2A 1NAMB 4AM0B 2V5MA 2P8LA 1F8TL 3W5NA 5F6IC 1U8IA 1G9ML 5IFAH 1IQDB 4WO4B 4EN3B 1J18A 1A0QH 4ZPVA 2ADGB 4YIQB 1NFIB 4OCLC 4M7JL 1F97A 5IF0B 1U42A 1PLGL 4LFHG 1NGQH 3P0GB 3N1FC 2I24N 3HZKA 2JCCF 1MOEA 3EJJX 5A40E 2IPKB 2NW3B 4NPYA 4ZUVA 1AQKL 3QEQE 3KR3L 2CKBL 3BQUB 4CU7A 4PY8I 1CGWA 1GZPA 2E8YA 1T04B 1QO3B 1SY6A 1U6AH 5JW4R 1VCAA 3QXDB 3WS3A 1OARL 1YN6B 2VISA 3KLHD 4G9FD 3WIIL 5C0IA 5IOPB 3ARFA 5FHAL 3WFDL 3F6LA 2G9HA 5F7DB 1H8NA 1LP9E 1T89A 5JLZA 1WVZA 2YZ1A 3D0LA 4NQXA 4TUOA 4U1JA 3TNMB 3QWOA 1FZMB 3P4NA 3PV6B 4NQED 4G6AD 2BY1A 2A6JB 5E08L 4OZGB 4RGMB 1IZKA 3H3KA 2IPTH 2XY1A 5DUBB 5JNYB 1FFPB 4PJ5A 1CD9B 2HLFC 2HN7B 1SM3L 1HINL 4U49A 5C0EA 5ITFA 3BMVA 1AGCB 5BOPA 1H9VA 2NY3D 5L2KE 5DRWA 5C0RL 3H2WA 2R0WH 3FT2A 3VXPA 5KS9B 2GEEA 3GMPB 2X4SB 1OAZL 2IAMC 3IU4H 4S2SA 3ULSA 1D5MB 1KJVB 5HDQL 3V0VA 4WUUA 4MSWB 1MCRA 4OUOA 3SCMD 4PBXA 1CLOL 4RRPA 2F5AH 4OAWB 2XOTA 2UWEA 3EYQC 3VXQB 4P4KB 4YDVA 4OGAD 3G6JE 4MNQA 1S9WA 2HFEA 1LO5A 5GS0H 1PAMA 1YMHB 2H2PD 1T80A 2EDBA 4AENA 1BF2A 4YDKL 5I1LB 1KBGH 3ROOB 1RVFL 4LVOB 5CJBA 1MPAL 2H2SC 5I17A 2YWZA 3G5YB 3RVTC 1UM6L 1HHIA 5ESQA 4CJ0A 2VLRE 5FM5O 2B39A 4TTDC 2L7JA 3NPSB 1G6RH 3VJ6A 2H1PL 1JZ6A 3OKMA 4EN3C 1IGTB 5D1ZB 5ISZD 3ARWA 4M62L 5D5MF 1ZS8A 4WGVB 4O9HH 1JHKL 4UINL 1WFNA 4XBGA 3HZKB 5I8CA 2BSTA 4JE4B 4DKDC 5IFJA 3BVNA 1N6VA 4JKMA 4ODSH 2X4TA 4O2FB 3GB7B 5EUKB 3CZFB 3S88L 3BKCL 3EOTL 1AXSB 1X5LA 3ULVF 3BQUC 4V2CB 4WEUD 4H0GA 1P7KA 1MCFA 3X3GH 4JR9H 2Q8BL 2ARWA 4UUJB 4PJIE 4K3JL 2Y1VA 4FQCH 5KN5B 3CH8A 3HC4L 5BS0B 3DSFL 5GS1C 3VFSA 2YPLB 3IAGC 1XIWD 5ESAB 4NQXB 4TUOB 4BSWA 3HUJF 1E4XH 4RMSA 5ACZB 4HBCL 2YD8A 4WFEE 3TA3B 1T5XB 3IJHA 3DGGB 2FEEI 4JO4L 3FRPG 5LAXA 3PQYE 4M7ZB 1PJ9A 4GKZB 3HLAA 3HHRB 1A6AA 1EAPB 2BVOA 4QRRD 5IQ9A 5I18L 4H1LA 1YUHA 4OF5A 3HC3L 3SE8L 1DBAL 5HHME 5BVPL 1G7LA 2IBZY 2HMID 2IADA 5CWSB 2N7AA 1RZ8A 3QEHB 4RISH 4MNQD 4GKNA 5JHDB 4G9FB 4OGYL 2YBRA 3V4UL 2BSSB 4K7FB 5ALCH 2VZTA 2IPTL 5EC2B 2IBGA 2JJUA 5D7JD 3R4DA 3B8YA 4LASL 3ARFB 4JCLA 5K9KB 1MJ7L 4R0LB 1NDGA 3UTOA 4PJ7B 1CDIA 3CIQA 4PRDA 1I8KA 4L4VA 4XHJD 2LQRA 3PWUA 4IS6A 1RJCA 3SDAA 1BGXL 2X9YA 2XACC 2DWDA 3QIUC 5C71A 4RA3A 5AYQA 4LVOC 3EYFA 3OJMB 2F15A 4P3CL 4EXKA 1TJIH 1H3XA 2HG5B 2WBJC 4QRPB 2ILLA 1X5KA 4NZJA 2EKSA 3R06A 4Q9CA 5IVNA 1J5OL 4JPIB 5FKAA 4GAYA 2PUQT 3EYSH 5I15L 4G9DA 4Z7WB 4ZNCD 5D1ZC 1BQSA 3G9VA 5JHDE 4Y4KD 5I1EH 1LNUB 5D72H 1O7SA 1HHJA 4GRLB 4J3TA 1MRDL 4KK5C 2EE3A 5F1KC 1CGTA 3HZVB 2BVYA 2E6JA 3QIWC 2NNAA 3I3DA 3OKDA 4WJ5B 4JRXA 3WD5H 1K6QL 3SCMB 2H41A 4Q6IA 1OAXL 4YDIL 5IB4A 5F3HA 3TBYB 4X4ZA 4ZFGH 4U0RC 4JQIH 4X5WA 1P9MC 3ZKSD 5TDOA 4KUZL 5A3IC 4NM8H 3QG7L 2NY2C 3MXWL 4FZ8H 4G8IA 4RFNC 1ITBB 3SDXA 3CJJA 4KKLD 1GGBH 1A1MA 1F42A 1U3ZA 4GW4B 3GMQA 4ODUA 4ZSOB 3SHSA 4MXWH 3RL1B 3BZFB 4M7ZC 1A9EB 1CD1B 2BY2A 4QGYA 5CZXD 3O9WA 1F4WL 3EJYC 5L0QC 4J3XA 4NQDB 3G5XB 1A6WH 3D3VB 1OPGH 1V05A 4PJDE 5KOMC 2ZSWB 3VXUB 1NAKL 2I60L 4U6YB 4X6CF 2W9EH 5T1LA 1I1AB 4D9QD 1F4YL 3DOSA 4KJWC 3VWJA 3FB6B 3U36B 3DETD 4LF3B 1X4ZA 1ZHLB 3MOQA 1AHWA 2HJKB 1EERB 2X1PA 3P73A 2P43B 3C6SA 4NIKB 1J8HE 4PRAB 4YDJA 3LB6D 4KRLB 1XIWB 2ADFH 4G8GA 3I75B 3C5JA 1LEKA 5DHVA 1G6RA 1I3VA 2ZP0T 4L9LB 4XH2B 1I85A 3GJEB 5TGBB 4HWNA 1J87A 5TE4H 1WWCA 4YNYB 4YHKL 1G9MH 3ARDC 3LN5B 4YHIA 4MDIB 2WBJB 2MKWA 3W11D 1EX0A 3VXSE 3S35L 3SQOH 3ARRA 3EGSB 2FB4H 1PLGH 1X4YA 2MJWA 4FTVD 4P2OB 5KW9H 5KANG 5FK9A 5ESVA 1MCQA 4NCC1 3VE0B 4PG9A 3O11A 4KHTL 3PDDA 4EI5D 2VO5A 1EAJA 1NBZA 2KQMA 4OD3L 4EVNA 2NR6D 2AXFA 3LKSB 4PJBB 3U0WH 4QLRA 1GZPB 1ULVA 2C1PB 1PGRB 1KJ2A 2Y06H 3AUVA 2EDYA 2G75B 1U8MA 3ARFD 2NY0B 1NDGB 1M05A 1A6TB 1MIEL 1T1WA 4W4NA 4AIZA 4P59L 2XFXA 4Y1AE 2P7TB 5IP4A 5E9DB 3S88H 4PV9B 4LCWB 2GJZB 5FM4A 1NEUA 3QI9C 4G7VL 2B5IB 4NQUA 3DSNA 2D7TL 3S3JA 4JN1L 1KXQE 3ZO0A 3RVXC 3BPCA 3OMZA 3PHQB 3MRFA 1NCCH 2APFA 1O5DT 3RA7H 3O4OB 4GO6B 2FECI 4GAYB 5C0BD 2E6QA 5L0QB 1TJHH 3WSQL 3FFCB 1CICA 3ARBA 3TESA 2NY1B 4RFOH 3JWOC 1B4RA 1SBSH 2EC9U 1V3JA 3QUMA 3MRRB 4FZ8L 4H8WC 4LIQE 4R2GB 5D70L 2EDTA 3ESUF 4FFYL 3GSXA 3JTTB 5GGTH 4G6JL 32C2A 4X6BB 2RHEA 4NKQB 2Q76A 4U1GC 4F8TA 3GDBA 3MV9D 3QUYD 5I18H 1OD9A 4KKBD 4JVUA 5E2JA 5DJ8B 2AJZA 4DTGL 1KEML 4Z6AT 4MQ7A 1ZT4A 2P48B 5DTFB 4YXLH 5ICZA 4L5FH 2YRLA 2PO6A 4NZRL 3WV0A 5GISL 1TXKA 4NNPH 2ATPB 5CILL 3GSNA 4RAHA 4P4RA 1E4KA 4Z5RA 2VDQH 2XKNA 4EOWL 1YDPB 5SV4A 4JFED 4X5XA 5E5MA 5HI4D 4L9LC 2UWEF 5E9DD 3V0WH 5E2UH 4YNYA 1DJSA 4XAKE 1Q72L 1U2HA 3GRWH 1LO4H 1RAMA 4MCYB 4OKVB 3QWQB 4I2XB 1NGXB 3BP6A 1UWGL 3V6OC 3BRGC 4HIXL 3ZKQD 3BW9A 1JPSL 3VXSB 4ODHL 4XP6L 4QRPE 2YUXA 4TVPE 1KCLA 1MHEA 3V52L 1PFCA 4RGNB 4P2OC 1ZS8B 4RMWA 5FUOL 1YEIH 3GBNL 3UTSD 4X7FC 5BVJA 3FRUA 1CZ8H 4BJLA 5IJVA 5JMOC 4A6YA 3WDJA 5JPNA 5I76B 5F1NA 3U1SL 3WN5B 1KCSL 4FQ2H 4IHOB 3VWKD 5LCVL 4BUHA 3MOBL 1T22A 1PEWA 3FB5A 2H26B 3QH3B 4ZYKA 1SJVA 4KI1A 4QRSB 5JIKA 3Q6GL 5DMIH 3C08L 1BQHG 4XC3H 3VRJB 4LHUG 3DUUA 3FO9B 3VFSB 3QO1A 1V8HA 5AWNL 3FCTA 3GMRA 3LH2L 5JQHC 1E28A 1XF2A 1P7QD 4G9FE 5TGBA 3NFPA 4AL8H 1UH3A 4JO4H 3FHQA 3UEZA 1REIA 5ID0A 5GGUB 4MAYA 1QSED 5HI5C 5IW6B 5IBTH 2FBOJ 1HYRC 3O4OC 5EDXA 4KPHL 5SWSE 3VJ6B 1KACB 1DLHA 4TTGA 5EBMB 3HNSL 3IFPB 4PRPA 4R2GC 3VDAA 4NRYA 1M71B 4U05A 5ISZA 1IGML 3IGAB 2ARJA 4G7VH 2PR4L 3T08A 3ZDZE 5CHNB 5DMKB 1XFPA 3O2DH 1NCCL 3O4LD 4M7LH 4JFYA 5E8NA 5IVZA 3F62A 1OWWA 5F7KC 3OXRA 4OLYL 3LS5H 2XPGB 4WY7L 3DUSA 3U6RB 4MVBC 3BDYL 5GSVA 3ULUE 3KPPA 3CZJA 3QAZC 5EO9A 2Z0BA 3QEQA 4LP5A 4UIMA 4QO1A 5FO8B 1RIHH 4MD5B 3QDJE 4C56A 1OTUC 5DEFA 4KK8D 3CFKA 1H3WM 5EU6D 2ZJSH 5DRXA 4XNUH 1UKSA 1XGYL 3THMH 2JIXA 2CKBB 1KV3A 5GHWH 5CILH 3EOAB 4JAMB 4RGNC 3QEGL 3SE3C 5CJQH 4XP9L 5FYKL 3VG9B 5EZIH 2F9BT 5L2KD 3MCG1 4MA8L 4A2MA 5HHQB 4ZUUB 2FD6H 2C3XA 4JFZH 3C60C 2F53E 1RZGA 4Z7NF 2HFGL 3QH3A 4ZYKB 1RJLB 2FX9L 2NTSP 4Z9KB 5ELIA 1K4CB 1QVOA 1S8DB 2O61A 5T5NG 2YRZA 4P2QD 4WCYL 5L8JB 2PO6D 2BP3A 3SDXB 1A1MB 3GBML 4C58B 4F15B 1A6VL 1FNGA 3SDAB 3BDBA 3D69B 1BBDL 3CVHB 3U0WL 2R2EA 2QBWA 1J11A 2XZAH 4P2CG 3RJDA 1OTTD 2R4RH 2DF3A 5C9JB 2V7NA 3DTXB 4YHPA 3NOIA 4NKMB 4MNQE 1MIEH 4I3RL 4B7LA 1MCOL 3UJJL 4DZBA 4M6OL 4NQCA 3FQNA 1JF1B 2QADD 3AREB 2F19L 3OAZH 5DRNA 3U7AA 3ZKMD 1RK0A 4N8VB 2B0SH 2FEDD 1QNZL 4WU7B 5TDPA 4BQBA 1T1XB 1CWVA 4AT6A 3WO4B 4UT7L 3V6FA 1I1YB 1YY9C 4FQ1H 1FL5B 4UNUA 4ZAKD 2AK4E 2XA8H 1RJZA 3VFRA 4RZCA 4Q74A 4Y4HD 4K7PX 2VISB 5JTWA 3RAJL 5F9WB 5C07A 5EU6A 3T04D 4OQTL 2QKIB 4U6VH 3HUJB 1H15A 4X6DE 3KYOB 5E24E 5E8OA 4HKXB 2HVKA 3PDOA 1MWAH 3ARUA 4K3HA 4IDLA 5FCSH 1NFDE 3VXME 3ULVD 4MJ6B 4QF1A 1OOAA 3QAZB 2Q3ZA 3MRKB 3DBXA 4FQIL 1Q94B 4J4PC 5C6TH 1P7QA 3JV6B 5HGDB 4ZNEE 4EEEA 4MHHI 2G2RA 3D39E 5DJAA 3D85B 2DQJL 2VDNL 4LCWD 2CDGA 1G1YA 2FB4L 4G6KL 4XBEH 5JW4Q 4FTVA 3DV4A 4HK0B 1KCVH 2V5SA 1ZLSL 4XNMB 3MLUL 4R4BB 5BQ7B 3U83A 1JHLL 3EO9L 4OLVH 1AO7A 4LSUH 3BXNA 4NRYB 1JNLH 3KXFD 1YEKL 1UKTA 4LVNC 2AP2A 4OIIL 1N6QL 3RTQA 3RWFA 5JA8B 3VXNB 3C60B 4KXZI 1ZV5A 4GUPA 2DQDL 1JV5B 2J6EA 1IGYB 2F54A 1R3LA 1RJYA 3LPGA 1XR8A 4IRSA 3V6ZA 4JJHA 4F8QA 2BVTA 5FUOH 1FVDA 3MYZA 1VEPA 3DX8A 4K9EH 4ZFZB 3U6RA 43CAB 4L3EB 3OKOB 1CZ8L 4PB9L 5DQDH 2ZPKL 1LEGB 1A02N 4Y4HB 3AS1A 3T65A 4OKDA 1OF2B 4UNVA 5C2UB 4Q9BA 5IVOA 1DANU 2YD4A 4N9GA 1IQWH 1BOGB 5F9AC 4HEPG 2GHWB 2ICWI 4OQ1A 2X1WL 4OFKA 1S9XA 1SBSL 2X42A 5J9PA 5E2WH 3BVNB 3HE7A 4MDJA 2W60A 5IBLC 3AREC 2GUOB 2FRGP 4DEPC 3BSZL 2QHLA 2B2XL 3ULUL 4LU5L 3WO4C 4BFIB 4HMEA 5GIRA 3VXTA 1YEHL 1EJOH 3LKSA 4PJBA 3MR9A 3PGDB 4L3AA 4AEIH 4FFZL 4JFFB 4L5FL 4LCCC 4PJGB 5C0CB 3V2AR 3WXWH 4R0LA 3BN3B 2BJMH 3GHEL 5A43C 5A16B 2HFTA 3KNBB 3MLSH 4OZHF 4G6FD 4HIEB 4LHUD 5FM8A 3FO0L 4E0RB 1INDL 2EDWA 5IB1A 4CAGA 5E2VH 4CMMA 3L9RB 2YEZA 5DI8B 4AM0A 4MB4A 4X4YB 4XVSH 4D0BB 2WIIB 2VXUL 3LRHA 4X9BA 4CDGC 5C9JA 3RTQD 2NY6D 4KJQC 1JI2A 1SMAA 3PNWA 3RDTA 2D4FA 4BFBD 1NC2B 1D3CA 1IEBB 4HWZA 4ZUWA 4HIHA 1UA6H 2BXYA 4X80H 4RSVA 1ZEAH 4EUPG 1JNLL 4OZHA 4LVNB 5CAYB 1C1EH 3VWKA 3DROA 1FGVH 4KTYA 4GQ9H 3SDDD 5J6GA 1BREA 3SJVD 2I07B 4LRNH 3K1KC 5E8EA 4L1DA 1CQYA 2I27N 1ZVSB 3P9MA 1RULL 4H26B 5CJQL 2AJ3A 5EWIL 1KCVL 1I9IH 4P4RB 2Q20A 3IVKB 3TNMA 1OSPH 2B4CC 3KHQA 5MEOA 4U2YA 4LSUL 2V17L 2EC8A 4HWEL 2CK0L 3D5OF 5KS9E 1CD1A 4YFLF 4PGDB 4QRPA 5E5RB 4MWFB 3EYOB 2EKSB 3HB3D 4X6CA 3W9DB 3KXFB 3UTZB 1J5OH 3VH8B 3MV7D 3MYJB 4G8GE 5F21B 1EHLL 4PJFF 1JP5A 5I15H 2PETA 5CBAA 2ZSVB 2VLJB 3OBAA 4K8RL 5ALBH 4YUEL 4AH2A 4MCZB 4KRPC 3U9UA 5T1LB 1DQLL 4O5LL 3Q5OA 5FYJE 5T1KA 1JPST 2EIBA 3KPRA 5E00B 5KSUA 3OJDA 3QWRD 1RZJC 4HWBL 1IGCL 4LVEA 5IW1B 4NZTH 5IWLA 3JWNC 5D7KD 4LCCB 4X6DF 3B6SA 1BIIA 3BWAB 3C8DA 4G6AC 4CVUA 1FHGA 2RQ8A 5K59E 3LRGA 3BISA 4YR6B 2MPAL 4P2QB 4KVNH 4KFZC 4BSJA 3CVHH 1LEIB 3W2DL 2F5BH 2B2XH 4OZIF 1K5NB 4APQB 2LVEA 3VFWB 4G6MH 4ONHB 1AGEB 2A1WL 1P4IH 4UILH 5KANI 2PW1A 1S78C 2E9BA 4NO2B 4HPOL 1AIFA 1VFBB 3VFTB 5CGYD 2YRPA 5SWQB 2VRAA 1PQZA 1B88A 2P42B 3FQTA 5FK9B 5HHXH 1J0HA 1JRHH 2NZ9D 1NCNA 3VE0A 2WP3O 2E7HA 2P45B 3O6FB 3ES6A 1FPTH 1NGWA 3MRPA 4GW5A 5DJXA 1DN2A 4H20L 3RFZC 1VGKA 4P2RB 5FECB 3EFDL 4ZUUA 3UTSE 3LKPA 1SJHB 1Q38A 4OCRH 4RIRA 3MLYL 5T1MA 5JXEA 2G9HB 1XGTA 4KK6C 1JTPA 4OAWA 4TUKL 1KTKE 5F7DA 4YBQC 1P4BH 4X6EA 5C6PB 2CH8A 3B2VH 4L8BB 2R4SL 3EYVB 4LK4A 2AERT 4XPAL 1MRDH 2NYYD 1QSEE 1WEJL 2EDLA 4XVUD 4LLUB 1ZOXA 2R9HD 2B1AH 4IMLA 4HJ0C 2COQA 3TVMD 2DQDH 3HLAB 4R90L 1OD7A 1DUZA 1QRKA 2R4RL 3ZE0E 4NUGH 3BKMH 3ZT5A 3B43A 3TN0B 4ALAH 1WFUA 2GQHA 4NQDD 2E27L 3JVGC 1IAII 3U82B 1XCTB 1MCIA 3A6BL 2GT9B 4MX7A 4O2EB 1WZ1H 1PX4A 3D1MC 5CJOL 2ZG2A 4EJ1C 4KI5D 4QEGA 1R3JB 1RK0B 3H9SA 4KRPB 4L8DB 2MQ3A 4F9PA 4ZPTA 4DKEH 1NCTA 2UUDK 2VXQL 4KTDH 1IJ9A 2R2HB 4ZUSA 3UPRB 1X3DA 1C5BL 1DBJL 4R96A 4PTTA 4WUKH 4NCC2 4JFFE 2X05A 1HIMH 3MNWB 1H3GA 4PTUA 5FYLH 1KB5A 3N85H 4OBSA 1FAIH 5E6ID 3W0WA 3GMOB 3CFEB 3UTQB 5CLWA 5EN2B 3FO1B 1KN4H 1A1NA 2QJDA 3DMMA 4LU5H 2FECL 2RCSH 5C6TL 5GGTL 3LQZA 3LEVH 4MCYA 1EGJH 4PGDA 5FYJD 4AIXA 4APQC 3ULVH 2OR8A 3QT2A 4I2XA 5DUPL 1HWGB 1JWSA 3L3HA 4Z7NE 2D7OA 2FJHB 3U4AA 3A6CH 4Y1AA 1WSST 5CD3A 3NAAL 2PYEE 3PWJB 1QSZA 1GRWA 2RAMA 4FTVB 2ICEA 2GTZA 2YD6A 3DV6B 1D5BA 4H8WH 3MRBA 3M1BA 3B4NA 4KDVA 1SEQH 2J1KA 1H0DB 4PS4H 3O6FC 1S7RA 2ZOKA 2MPAH 2BK8A 2Y36H 3L3IA 2MSPA 1RZIA 4WHTA 4NKIH 3ISWA 1VERA 4X7TB 4L3EE 4Q97A 1JNHA 2ZZUT 1A22B 4FFWC 4YEFA 4JZJA 3VMNA 1CFQB 4Y2DB 4P5TD 2X4UB 3LSOB 1TTFA 4MJIE 1I3GH 2DM4A 5IG7B 2D2OA 3NA4A 1G6VK 2G5BA 4JFXA 2ATKB 1D5ZB 1Z6JT 4C59B 5HHOB 3JZ7A 1A7QL 3EFFB 3T0ED 1S7TA 4R4NC 4DAGH 2YMXH 4P23C 4WFFE 2UZYB 1Z9SA 3WFBL 3LMJL 4LHUB 1H3PL 2X41A 4C83A 3KLDA 4NUGL 4N9GB 1RUQL 2MNUA 3QDJD 2BCKB 4LLQA 4ELME 1KB5L 3OAYK 4FXLA 1KIQB 1RZ8B 3QEHA 4PJ5E 1CL7H 2NXYD 1V7NH 4M1DH 2FSEA 3V4VH 5J11C 5IJVB 4HWUA 1YMMD 3GEWB 4TPRH 1YNTB 4M02A 2EECA 4GQPH 5F9JA 5LWYL 4RFEA 1FE8H 1KIPB 1ETZB 1KJ3H 1MNUH 3KVQA 2V2TB 4IIQA 3T4YA 2VLRA 1SQ2N 5J0BA 4K3DL 3IKKA 4UAOB 1C5BH 3S96A 1FZJB 3U4BL 3Q6GH 5DMIL 3F65A 4L8BA 4BZ1H 4R4FH 4XNYH 1P53A 4FQLH 4O9HL 4RMUA 2IALB 3I02B 4JN2A 1DTUA 4WO4D 2D9CA 1FIGH 2JJWA 1JZ4A 2YUWA 2G60L 3ME0A 4XTRD 3ALXA 1Z9OA 3AMKA 4RX4A 4YHIB 1IKFL 3RY6C 4M48H 4UQ2A 3WSQH 2JIXB 1CXHA 3I6LE 2YC1A 2OTWA 3D39D 1QPPA 5ANME 5C8JA 4K2UL 1FYHB 1YEFH 1R3IL 1XH3B 2J8UB 4KVNL 3MBXL 5F89A 5DO2D 2X4SA 4HHAA 4KDTC 4WRLA 1CGSH 5FOBA 4KUCF 4X83A 4WTXA 1KLUA 3WNPA 5I0ZA 3P30H 3MRHA 2VWEE 3MLRL 1MAML 2EEDA 4JM4L 1RURL 3MOAL 5KVDH 3QHZL 4BZ2H 1QFWI 3DNKA 3DX7B 1OTSD 2J4WL 4D9RD 4R96B 3VCLA 2F53A 4Y2DC 1V7ML 2JE8A 5EWIH 5LBSH 2PCPB 2ZCKL 4HT1L 4NRXA 4WI7A 2AJ3B 1U3HD 4OM0H 5CUSL 1Q9LB 3KPSB 3PV6A 2WMPA 3PGCB 3QJFA 1DE4A 4LCWA 4X8XA 3SGJC 5IMOB 3M17A 4QXWA 1H5BC 3GHBH 2XZZA 1DQJB 3UX9B 4YPJA 4TVSa 1ZHNB 4D3CH 4MAYD 4HS6B 3ZKXC 1TNNA 2AJVL 1IEHA 1FG2A 2NMSA 5AD0A 2BOBB 2P8MA 2VTFA 3GIZL 1HI6A 3MYJA 2IPUK 2AKRA 4OD2A 2R29H 5I16A 3RGHA 2B1AL 3MODH 3ZE1E 1VFAA 2E7CA 5J11B 4PG9B 4P2RE 4OFYD 4R7DA 3FB6A 5BV7C 3IF1B 5K9QG 1CI5A 3RGVA 2EZ0C 5JW4N 4KVCH 2FR4A 2A0LC 2D0GA 4JPVH 5HHOD 4L8SB 5E8DL 3JWOH 2BNRD 4X9FA 2EIDA 1TPXB 2C7UA 1S9WB 2HFEB 2P5EA 2EDRA 4LPTA 3T1WA 4KMTL 3CH1B 1YMHA 4HZAA 4FQLL 1TQBC 4MXVF 3BFOA 4YXKH 2NPLX 1N6UA 4X6DA 3B3IB 1S7TB 1P7QB 3JV6A 5HGDA 3WJJA 3RWHB 5HHVL 3O3UN 4HQQH 3CSPA 4CRPA 1II4E 5E0QA 4NGHH 3EO0A 1ERNA 3O45B 2PW1B 3IETB 1Y0LB 4XWOD 3SBWC 1KENL 3MCKB 3W9DA 1CGYA 3VH8A 4LPCA 3V5HB 1VFUA 4FXGA 3QG7H 4JFQA 4XNYL 5E6ZA 3VMPA 3TM6A 1AO7B 3FN0H 1FO0L 2HH0L 2VIRB 5C1MB 2D31A 5JW5A 4AT6B 3CXHJ 3ULVL 4S11A 1M7IB 4Q6IC 1QHOA 3LKPB 2DQTL 5K9JH 5F88A 3SKMB 2QQLL 1GVIA 1U8PA 1YC7A 2CUMA 3KPRD 4HEME 2HFFB 3HE6A 3ZSTA 4G43A 1BZ7A 1PY4A 3C8KA 4NUJB 4LSVH 1J05A 3QIBC 5B3NA 5CIPA 2AGJL 2W9EL 3B5HA 2J88L 5EU7E 5EORL 3MRMB 1E4WH 4X4ME 3PJSA 3TVMA 5L88H 1BZ9A 1I7RA 3F7VA 4P3CH 2ZJSL 3RWEA 4PJ7F 1Z2KA 2MWCA 4ALAL 3BI9X 3HZMB 3QRGH 4YAQA 3RGVD 3IS1X 1PZ5A 1ZT1A 4LNRB 1L0QA 5IF0A 3RKPA 4BQ9A 1NLDH 3Q5YA 2YN3A 3EKCA 2C9AA 4JB9L 4PJXF 1G7MB 4HV8A 4P3DA 3WE6A 3KLHC 4NFCA 5BV7B 4ISVA 1U8HA 3S6CA 5DD5H 3PXJA 1GC1L 2VJXA 4TSBL 5EULV 4EDXA 5HYFA 1WBZB 4WWID 1M6OA 2VSCA 3FO2B 1YN6A 3CAFA 1TPXC 3HA0A 1FAIL 5MI0B 2OR9L 4P57A 3X11B 1INQA 4M5ZL 1TQBB 3RBGA 1UYWH 1LP9B 4N1HB 1KSRA 1CFNB 2V5RA 3L1OL 4DFIA 1NBVL 4MD5A 3R0MA 4K3JH 3AMLA 3BW9B 3BH8B 1FG2B 4P48A 3W5MA 2WQ8A 3GJFK 4OLWL 1Y18B 1IQWL 5JHDD 5TFSL 2VSDA 3X14B 4YX2H 5BJTA 3UC0H 2EXYC 4YO0B 1FIGL 1EUUA 2X4QB 3VGFA 1LK3H 5DS8A 5I1GH 1TVHA 3M8OH 4XCCH 4LPYA 1A3QA 1NC4D 2DN7A 2EC9T 5DUML 5TE7H 1S9YB 5HGBB 4WV1A 3IDIA 3RGVB 4YQXL 2PYFA 1IGJA 4ORZC 4RAUA 4WW2A 3INUL 4X4XB 3UZQA 3V0AC 1Q0XH 4YDJB 3QCUL 5FUCE 3NA9L 1CIDA 1XIWA 4G8GB 3MNVB 3MLUH 3TJHC 3AXLB 1UWXK 5T3ZE 4IRJA 3OHXA 2FH8A 3QIBB 4W4OC 1GPOL 3GGWB 4TSCL 3BGFB 1DVFB 1DDHB 3FMGL 3SKOB 4XVJH 2ERJC 5IEKB 3HI5H 2P8PA 3V8CA 2MCPL 3M07A 2PF6A 1NGZB 1KXTB 3IDJB 1W72B 1RPQA 1D7FA 1E0OB 3LKNB 5D2NB 4PJDF 1MUJB 2R0LH 4KJYA 3RPIB 2LE9A 5GJSL 1I1FA 3CFJA 3OF6D 4LARH 5ISZB 1N4XL 3QULB 1TENA 4O2FA 2IH3B 3QXVA 1NL0L 3CXDL 5I66A 4KHXL 5D71L 1KJ3L 1MNUL 2B1HH 4ZSOE 1KUMA 1XGRA 1QFOA 3TP4A 4HIIA 5DJ0B 4IIQB 3P73B 4JY5L 3WNMA 1BMGA 2Z93A 3JBG7 4S1RL 3TV3L 1JZ5A 1HILB 4GMTH 3NN8A 3OJVC 1BJ1J 4ORGB 4F9LC 3I9GL 3MODL 5MI0C 1T1ZA 4FFVC 2Y6SD 3QZWA 5ID1A 3QDGA 5MEOB 1X5ZA 1QKZH 2VH5H 4P99A 4HFWB 1X5JA 1HDMB 5FO7A 1CT8A 3QO0A 2DQHL 2QTEA 3UTSA 2DQCH 1TQCB 2ZCLL 2R8SL 4NQSB 4M48L 2XY2A 3MO1B 5EBGA 4E9LA 3VD5A 1CQKA 4LBEB 2PW2A 4PLNC 2I9TB 1UKQA 1PZ5B 1OSZA 2YSSB 4B0MM 4U6HB 3WEXA 3FO0H 4ODXA 3WFZA 4X98B 4ACPA 3IXAA 3KYAA 3U0PA 4XBGB 5EZLB 32C2B 3QNZA 4TNWK 4UI2A 3FONB 4WVRA 3BZ4A 3BH9B 5I1JL 4PGCA 3VD9A 2YPLE 1WV7T 1VSCA 4MJID 4DN3H 4WW2B 2J4WH 3WHXB 3SDDA 5DXWA 1Q1JL 2VR9A 2PTTA 4OFPA 2GSGA 4HS3B 5EUOF 4UTBH 4O58H 1WC7B 3FN0L 3VFUB 5ESAA 1JRHL 3HNSH 4IEFB 1KF9B 5HYEA 1MVUB 4GS7B 15C8L 3H42L 4I18C 2DQEL 3QUKB 4ZD3H 2XZQL 1SJEB 3RIFK 2A2QT 3O41B 4PRPD 3S5LG 2BNQB 3IDJA 4HC1L 5EFIB 5BOZG 4MJ4A 2KKQA 1CN4A 2V7NB 3DTXA 4JM2B 4NC1E 3QNXA 1FGNH 4KJPD 2JJSC 2W0LA 5D2NC 2WINA 4XPTH 1Q9WA 1QFWH 4UQ3A 3VXOA 4S0TD 3UAJC 2NY6B 1QBBA 3C5SB 1JWUB 4HG4K 4KQ3L 4A2LA 2HYMA 3JTTA 2GUOA 4IOSD 3VI3F 4GQ9L 4RZCB 5HYIA 5JUEL 3QUYB 4JJ5A 2GY7B 3H9SE 3QDGD 4M6AA 3NTCH 1GGTA 4ODWA 4BYHA 3PUCA 1XGTB 3U4EA 3QBTB 3QFJA 4YWGL 4OI7A 4NKDA 3HN3A 3FCTB 2CKNA 1MCNA 2ITCB 2X4PB 1PEZA 3GMRB 5ANMA 3CH1A 12E8L 4L8CA 4Y4FA 3AC0A 4HH9A 3P4NB 3P9LA 3GBNH 3S36X 1SYSA 4KZDL 1DVFA 1WJ3A 4Y4HA 1N2RB 4FP8L 2QSVA 3BZFA 3RU8L 5FKAB 1A7NL 1I8LA 5JR1H 2O26U 1VPOH 2EYSB 4X99A 5HD8C 1PBYA 2XWJA 1G9NL 2EEBA 4GG6E 1KTLA 3IDMB 4HDIB 5D6DA 5DRWB 3MRQB 4F33A 5DQ9A 3QUML 1GCFA 4XP1H 2IPKA 2NW3A 4LSRL 4U1KA 4B41A 2GCYB 4O2CA 1W0WA 2ZUTA 2RCSL 4JRXB 2CMRH 4FABH 1QPXA 3STZA 3CX2A 5I1JH 1A7RH 1BBJA 1R6VA 1K9TA 5IVZB 5BS0E 2WUCH 5J1AB 1U36A 1KTRL 3LPWA 4OFYA 3T0AA 4X9HA 4QXGL 2NTFA 3MMEA 1JMXA 4ONGH 3MTRA 1CXIA 1MCEA 3D0LB 5AAMA 4LLMB 2DI9A 5HHOA 3MCLL 1KNOB 4RDQG 1ACZA 3QDGB 3G6JA 3AGVA 1SEQL 3EFFA 3GNML 1DBMH 5GGVY 3RL1A 3OXSB 4GS7C 4HIJB 4I18B 1GHFL 2PXYB 5HVWA 1JYXA 1L4IA 1P4IL 2MMXA 3CFKB 3MGAA 4ZOBA 3PJSB 1AD9B 2NY7L 4AEHL 4HS8L 4OUUA 1JI1A 1OVZA 2Z35B 4JM2C 3QUZA 1SHMA 2WANA 3NMEA 3MRIA 3UTZA 5ITFB 1CICD 3ARBD 1E6JH 5TH2A 5SWZE 4PJEA 5A2JH 3ARGD 2IQ9L 5KBNC 1JF6A 5C07E 3MROB 3TIDA 3C09B 4O58L 4TUJA 5CP7A 1S7RB 4I0PC 3OX8A 3L5XH 4YJZL 5B8CC 4DGIL 5HHOE 5FF6A 1IC7L 5EH1A 1QLRA 3HPJB 4EI5B 5IIEB 2VXTL 3ECBB 3EJZD 3HS0A 5JOEA 1HHHA 4ELMF 1JK8B 4F58L 4HS3A 5E8EB 3ULUD 4GRWH 5DVOA 2A6DB 2GY5A 3W39B 1N5AB 1D5ZA 3TWCH 3QIUA 5E6IA 3PP3H 1LEKB 3C5JB 4P5KA 3WNLA 5EU6E 3FQUB 4XNXL 3WBDA 1CFSA 1IM9A 4BK5A 1S9VA 3VFMA 1MFEL 4NOBA 3A67H 1F5WA 1UG9A 3WS6C 1MAKA 4X99B 1HHGA 1ZANL 3SPVA 3T3PE 1GSMA 2ITDA 2Z91B 3LPFA 1KIQA 1U58B 2AXJA 3GO1L 3D6GA 5H35A 3H9YA 2ENYA 4D0DB 4HGWA 4WU7A 2YHGA 1CFVL 3JWDL 1ZVYA 3C9NB 3BN9C 4X7SL 3GBMH 4FQHA 2HWZL 1LK2A 1UXWB 1I1CA 1UM4H 4KTEL 4UUJA 2R15A 3UMTA 5F96H 5HHNB 3UJTL 3VA2C 1DQML 4ODWB 3WDIA 2HVJB 1IKFH 1Z9MA 3RDTD 3DXAB 4LCUA 5DTFA 5ICZB 3SKJH 2J5LC 3LHPH 3TYGH 1A6WL 1JHTA 1I7TA 1A3RL 2UYLB 1VHPA 1MCOH 4V1DD 3K7UA 4PBVC 4YHOH 1IC1A 1AY1H 3K8MA 2ICCA 1TCRB 1EGJL 3G04A 1JPTH 2CLRA 1T0NB 3HC3H 3UO1L 3B8SA 5D7IB 4QRRA 3OKEA 3IRPX 4R7NB 5DJCB 5KSAD 2AS5M 3BZEB 5F7LB 1HNFA 4GAFB 4OCYL 1LDPL 4WHYG 5JOFA 2HKHL 1CLCA 2ADFL 4S0SD 4Y16D 5D7LD 3FQNB 4PREA 3G5ZB 5CEZD 3CFDA 1Q0YH 3C09C 4PG2A 3ES6B 2D0HA 2FL5B 3BGMB 1NDMB 5B8CB 3IF1A 1QSEB 3ULVE 1N3NB 5CZVH 5CD5D 4JDZB 4RMTA 4YHKH 1MREL 1F4YH 4MQ7B 5GGQH 5DVNA 1Q9KB 1RUQH 1T04A 4EI5C 2NY7H 5KVDL 2R0ZL 3FB7B 4NN7C 5DJ0A 4XGZB 3DECA 4NHCL 4X8JB 5GRYA 2GI7A 5TDOB 2CK2A 3EYSL 1P1ZB 2V9RA 4XPHL 4YFDB 4L4VB 5JOPD 4K9EL 1VEMA 3U79A 5IMLA 4PJFA 3QQ9C 2FGWH 4N8PA 4BKLB 1JPFA 2R1XB 2ZCLH 1B4JL 4LL9A 1NFDA 1ORSB 5JNYA 3OKNB 4GBXC 1EVUA 1YEGL 3CX5J 4HWBA 4JPVL 4PJ9C 2RJMA 3SQOL 5HXMA 4M62H 1KG0A 1OAYL 1ZWIB 1J0ZA 2ED8A 5F1IA 3SGKC 1OT1A 3MROA 2OI9C 4KV5F 4YC2B 1FLRL 5J6HB 4P49A 2D31B 5JPNB 4U0QB 1GGBL 2R29L 4RGOL 4KGLA 2C5DC 4JGJA 1CDBA 2VAAB 3WD5L 1FE8L 4BFEA 2OK0H 3FONA 3PABA 3V6BR 4MJIA 4HZLA 3V4PL 1B90A 1AO7E 2GKIA 4GKSA 3RWDB 3PGFL 3WHE1 4PD4J 5F3HB 3TBYA 1J1XH 2VC2L 1JUFA 3MXWH 2DQFB 2A6DA 3E6FB 2PTUA 3RZCC 5CGMA 1EHXA 3NFPB 3MV7A 1MWAB 4XNQB 2H3NB 5KSBE 4NHUA 3I3BA 3TN0D 2HTLD 1B2WL 3VFOB 4ZS7H 5HYJE 2VLJE 3EZJB 3UYRL 4KI5F 5E9DE 5DJCA 3WO3B 5DHYA 1I7UB 1UB6A 1YPZB 5DHXB 2FATL 3O3AB 5LBSL 3DJ9A 1NMCC 1YEFL 4O4YL 5INCB 3IFPA 4RFOL 5FEBA 2DQGL 4KQ3H 1BZQK 1L7TH 3RVVC 4QKXB 4BH7B 4QRQB 4XCNB 3DRQB 4YBHA 3EIFA 2AXFB 2FDBP 5T1LD 2CGRL 5CZVL 1JGUH 1E4WL 5AZ2L 2OM5A 4OIAA 4P9HC 1DFBL 3QEUB 1WBZA 4UV7L 3RPKA 1LE5B 2PTVA 2NY4D 3S4SA 4NN7B 4XP6H 2XT1B 2DKMA 4QHLB 1E4KC 1T21A 1ZT7A 1O7VA 2A77L 4G8GD 2WWMD 1E27A 2YK1H 4L8CB 2A6JA 1FPTL 2OQJB 1Q0YL 2I26N 5EZJA 3L7FA 4Y8DC 5F7WC 1OGAB 1SBBA 4YPGB 2V17H 3LOWA 4DKAA 2OZ4L 3GRWL 3L3HB 1JZ7A 4D2NA 1VPOL 3TZVC 4N1EA 2EDXA 1ED3B 4GBXB 1FNEB 2HT2C 3MXVL 1KJMB 4PJ9B 4QXTA 4W6YB 1FCGA 1WBYB 4HJGB 3FT2B 2VE6A 3MRQA 1N8ZB 4F33B 3BPLB 2H6PB 3MRRA 3LH2H 5D4QA 2OI9B 4IMKC 1Z5LA 4FZEH 1I9IL 4WW2F 3C5SA 1MFCH 3B9DA 5SWSD 5JOPE 4HHAB 2C3GA 5ECJE 5I8OL 1QBLH 2VAAA 3D3VE 5F3BA 1FFRA 1KT2B 2CLVB 4KVCL 1IGJB 3TBVA 2CDFB 4F3FA 3BEWB 3PF2A 4PJAE 4Y5VB 1RJZB 2IMNA 1ONQB 4K8RC 1NEZB 3CUPB 5MP6H 2ESVE 1B6UA 5T1KD 4LNVA 1UCBL 3O6KH 4PGEB 1GC1H 4L3CB 3CCHA 1QZ1A 3IRZA 4LRIA 5A2IH 2J8OA 4WENB 4MD0B 3O4LE 2BNRB 3JWDH 2GAZB 4PV9A 3FN9A 3GSRB 1N59A 3LN4B 4MQSB 4PJFB 3S8WA 3FAWA 3OPZL 5KVMC 1YQ2A 1JFQL 5IEKA 1JCKA 2IPUG 4YHLH 5LGJA 4J23A 2CPCA 5CEXA 5HHPA 5IBTL 3H7LA 2H2SD 3E1F1 4OUUB 3AM8A 3G5VA 5T1DL 5EU5B 4Q0XL 3WFDH 1A6ZB 5FGBC 5GS0D 4O4YH 5L6YL 2ICWJ 1Z9LA 2IFFH 5C8JB 2RR3A 5SWZB 4YFEA 5HVHC 2IJ0C 3CXHK 4CW1A 1LP9F 5DJDA 3VGAC 4G5ZL 3EAKA 4JRYA 3K3QA 3HNTL 1EEUA 3MLXH 2V7HB 5LQBL 3MRJA 3WYRA 4YXHL 4U31A 1EHNA 5KN5A 2P24B 4OCRL 3VD7A 4YHMH 4PLKD 3IXTA 3MLTA 2F53B 5L8KB 4NQDE 3ZE2F 5IGXL 3E6FA 4ZS6D 3DX8B 4ZFZA 1OSPL 5AUMB 3DRTA 3CSGA 4LLVB 4Y19A 1T03H 4WDIA 3OKYA 2XZCH 5B38B 4KI5E 4GW4A 5CSBA 1MCWM 2M2DA 4XB8A 3MUY1 5DD5L 1IM9B 4MLIA 4ESKA 1BJMA 1NH6A 1U9KA 4U3CA 3HCVA 3V6OE 4YGVA 4Z8FH 1WUNT 4UV7H 1F11B 4RBPK 3HAEA 1BOYA 4KZEL 4PJDA 5INCA 3OR7B 1S9XB 5IHBA 3D2UB 4P5TA 3Q3GA 4S1SL 2W65B 5IB3A 3BUYB 1X9QA 5CJOH 1WTLA 1ZGLP 3LEXA 3R1GL 2VH5L 2VDOH 5F8RC 2N56A 3BDXA 4HWBH 5FECA 3KWWA 1ONQA 3W9EA 2W1NA 4OLWH 1J8HA 1AXIB 1WWAX 5HJ3B 1TTGA 3FT4A 4N5ED 1DVFD 1HILA 3WIHA 5C0CE 4I9WE 2E27H 1FH5L 2OL3A 4LLWA 4NQEE 5D70H 4OF8A 3UPCA 5EN2A 1KPVA 3LQAH 4K55A 4X4MA 4M7KH 3TC9A 5DGRA 5DEFB 2DICA 5F6HI 2KL6A 3QNXB 2HN7A 1MCKA 1YMMA 4DN3L 1NANI 1FSKC 2OX5A 5D9SA 3PP4H 1VACA 2Z8WC 3DV6A 3PL6A 5D7LA 2AJYL 5DD6B 1HIML 2VR4A 2E9WA 3DYPA 1JGDB 1MWAL 1UGNA 4GXVH 3CVIL 1HSAA 3L6FB 1BVKB 4FG6C 1S7XA 3DLQR 4MA3A 1SVCP 2JB5H 4AMKL 4RWYL 2FR4B 4YLQT 5SWSA 2B7DT 4Y5VA 1ZGLB 4PRBA 1X6LA 3CFIC 5DRZA 1KELH 3MR9B 3PGDA 3WS3B 1CTNA 2G75A 2LU3A 3I75A 1CDHA 2DQGH 3SKNB 4PTUB 1F6AA 3JWDC 4K2UH 4ELKB 3BKYL 3OAZK 5D7JB 5EO0A 4WDIB 3X11A 3KPPB 1JHLH 1QG3A 5DC4B 5B38A 3L7EB 1H3VA 1ZHKA 5D71H 2Y36L 4L29B 5FGSA 2FWOB 5AZ2H 4DKFL 4R90H 3MRGB 3F7YA 2BNQA 1MFBL 1UWGH 2YEZB 5DI8A 3BPCB 1VA9A 4D0BA 2VZVA 3LD8C 4UDTB 2WNGA 4UDUB 3IYLW 2R23A 3O3DB 4GMTL 5DR5L 2R1YA 3GI9L 5C08B 4HK3N 5C7XH 2XN9E 3LZFL 5T3XL 3BP5A 3X12B 1TCMA 1S7VA 3D2UA 2NXZD 3D39B 4Z0BH 5H94A 1T83C 1ZT1B 1NFDF 2C4FU 3EJYD 1U92A 4O2CB 2W9DL 4PIRF 2FD6L 1QR4A 1ZA6A 4WUUB 1KCUH 3JTSB 4QNPF 1S7UB 1KGCD 4OCWL 5F7FA 3ARYA 3UBXG 5DWUH 4OI9A 1FO0B 1K6QH 4Z76B 3G6JF 4WFFD 2CO6B 4XPFL 3QXWA 4PRAA 5IB5B 3QQ3B 5DF0A 4HUNB 4KUCD 4CNIB 5DEZA 2LAAA 4MNGE 3VFGL 2QHRL 4PJFE 4Y2OA 3T0EE 1FYTD 4U1NB 5MHSD 3ZYJA 1F4XL 4NNXA 1UADC 4LSPH 4PJEF 2PN5A 5MEQA 4UT7H 2BC4A 4J8RB 3K4DA 3Q1SH 2W0KA 1DL7H 1VADB 2X89A 5I1CL 3KLAA 1BJ8A 2NLJB 2CXKA 1FSKB 2OP4L 4AEEA 5EIIB 1T66C 2M26A 4K7PL 3MJGX 4WY7H 3QRFM 3R0NA 3OR7A 1P5UA 2AEPH 2D03L 3HE7C 3BDYH 3P4OA 3UZVB 4KKBC 1CGXA 3OPZH 5I8KL 2X4TB 1A9BA 2OCFD 3C5ZD 3FRUB 1IBGH 3DRQA 1QBAA 2X5PA 3GSXB 2AJUL 3KPQA 2E5EA 2HTKC 4TNVF 1AGFB 4NQVA 1SYVA 2IH1B 1KIPA 4U7SA 4MA7L 4HG4J 4J2XA 3NAAH 3PWPA 2FEEL 3PDGA 2EE6A 4X4XA 4LAQH 2OYPA 3G08B 3MNZB 4UT6L 5D5MA 3TBWA 3PP4L 4PJ7A 3GHEH 1QFHA 4X6EB 5FYJH 1C5DA 4P9HL 4R8WL 2H8PB 1XF2B 1B0GA 3QFDA 5C0NC 4H25B 2XKNB 5F7EH 1N0XH 1OWRM 4D0CA 3H8NA 4Y0GA 1U8IB 1HDMA 3ZE1F 3P30L 5DK2B 1H3PH 2SEBA 4NT6A 2P8PB 1ZSDA 2X70A 1I8MA 1JE6A 3LS4L 3SBWA 1KIRB 1HCVA 3O3EB 3ZL4H 5CBEA 5IJKA 2YA2A 4XMKH 2QQLH 5D96C 3TN0A 1U8JA 4LSSL 2IGFH 1VKXA 1A14L 2VUOA 5C7XL 4ODSL 5I16B 5FYKH 1I9JL 1RIVH 1M7XA 1AO7D 2A73A 2GJ6B 3CDYA 2MFNA 1S5HB 1XZ0B 1HXYB 4JQVC 2J88H 3ET9F 1C12A 1A47A 4LPUA 3S35X 2R2HA 3KPNB 4CDHA 1BFVL 3E8UH 2EDEA 1JK8A 1WAAE 4OI8A 3SJVB 3G9AB 3MZGB 5T1MB 5JIPA 3NCYP 4HXBH 3ZMRA 1RFDL 2Z31A 3QUXC 1FZMA 2JF1A 2B0SL 5D7IE 1EEZB 5F7HA 1QA9A 4MLSA 1LEGA 4K94C 3S98A 3GSWB 2DD8H 4MA1C 1RUAH 4NNXB 3T65B 3ROLA 2FWOA 4EI6B 5DVMA 3B9EA 1WIOA 2HWZH 1A9EA 5CMAB 1F4WH 5FO9B 1IL1A 3SDAD 1EEYA 1HHGB 1MI5B 3FOMB 4KWUA 5FGCB 1J1PL 4MNHA 3B2UC 5D1QC 5GRXG 1TVBA 1SJXA 4K7PH 2W0FA 5BXFA 4NQTA 3GMPA 1LMKA 1KB9J 2OTUB 3T77A 3GNMH 3HE7B 4MDJB 3ILQC 2CJUH 2VERN 1SY6H 1INDH 1QSEA 2HT3D 1RZIB 3FB8A 4P2OD 3SY0B 2KH2B 3UROR 3GSOB 4ZPTB 5JA9A 5IWLC 4E41B 2X6MA 2JTDA 1UH2A 4UBDC 2XKUA 1FV1B 3KYKH 5CHNA 5DMKA 4PJ8B 2GW5A 4JPKL 4Y8AA 5BO1H 4U4BA 5E99L 5GISH 4L3CA 5A16A 4YDVB 4ZO8A 3L5IA 1CGSL 2YOCA 1J7VR 4M8QB 1X5AA 1QBMH 4PY8J 4P4KD 5TQ0H 5E2TL 3AY4C 1A7OH 5DA4A 1T3FA 1Q8MA 1TZHA 1I7RB 1ZAGA 4GOSA 4Z7UB 3KAAA 4LDEB 3D9AH 1WCQA 1CLYH 5TPWL 3H9ZA 2G5RA 1GGIH 4J3VA 3PHOA 3QRGL 3VRLE 5I2IA 3NA9H 5FB8B 4JRYE 1RU9L 2X4OA 4OT1L 1KYOJ 1NEZG 2K7QA 2FL5A 4D9QE 5TDPB 3TT1H 1JL8A 3MV8E 2UZIH 3WFEL 4JFHE 4OB5L 3O2WL 2L0DA 5GZOD 5BS0A 1CYGA 5GGQL 2JIXD 5IFAL 1W0VA 1T7YA 2PO6C 4NN6C 3GMMA 4EBQH 3SJVA 3QNYA 1KCRH 3TT3L 2R0ZH 1MHCB 3H3PH 5D5MB 4POZC 5GJTL 3TBWB 4OF3A 4JO2L 3C6LA 1RUML 3T0EB 1T1WB 2R0LL 5AWNH 4HKZA 3OAUH 4NC1C 5L2KA 3QQ4A 2W9DH 4JFOB 4M6MH 1F3DH 1CXLA 2G5BB 4JFXB 3BIKB 3P4MA 4M5ZH 4OSUL 1KPVB 3EO1A 2Y7QA 2VAJA 3B9KC 4F80A 2HRPH 2ZUVA 1FFOA 3CXDH 4OM1L 5D1XA 1L6ZA 2BDNL 4GKZA 4N8VG 2VABB 5CBEB 1B0RA 4C54A 5IV2B 1BAFL 3HC0A 5GGVL 1DQDL 2H32A 2BY3A 1PD6A 4YHNA 1RZKC 1A4JA 2XN9B 2CJUL 5JHLH 3MV9E 3RUGB 5HHQA 4PB0H 4XXCC 4K7FA 2D4DA 4JN1H 4RGOH 3T0BA 4G9FA 4TN9A 5E00A 4NBXB 5MENA 5DD1L 3N1QC 3V7AE 3O8XB 3ZKND 5B38G 2CSPA 5ERWA 1I8IB 1U8MB 4NFBA 2DQIL 2J8UF 4PJ8C 3ZTNH 3CDGA 3AU1A 2EDDA 1CE6B 2HVKB 3IB4A 2DMKA 8CGTA 1WICA 2QKIA 2ESVD 5I8KH 2Q7YA 2IF7A 1MQKH 3MRCB 4M93B 3VXRE 2YN5A 5E6IB 4U7MA 2ZUSA 3DGGA 1ZLVK 5EC1A 4XCEB 3X13A 5L88L 3L5WA 1CF8H 2LU4A 2FNBA 1ODAA 4XVSL 2WBJD 5FO9A 5SX5K 5KVGL 3S35H 1UWXH 1MJJB 4EN3A 1I7UA 1YPZA 4NHCH 1FYTB 3DV4B 4ZPVB 4UQ2B 5LG1A 1XF4B 4F57H 4Y4FD 1CLZH 5C08A 4HMDA 4QRTA 1EMTL 3CGTA 2VYRE 2A9ML 4U1HB 4YO0A 2YR3A 4HX1B 3SE3A 5KSAB 1Z0MA 2EXWC 4QCIB 5C09A 3MQIA 4GKNB 5C0AB 4TUJB 5CP7B 3S5LB 4LARL 2BRQA 3OX8B 1IM3B 3STZB 1MPAH 5F1NB 3SY0A 1RMFH 4GT7A 4Y5YB 4OCWH 2WV3A 4R7DB 2LVCA 4BSVA 3QP3A 5J3HC 5ADPH 2APTA 3DX7A 4JFZL 4Q9RH 3HI5L 1N64H 3UCRA 1W0YT 5EZOH 1XR8B 3WFBH 1L0XA 4WI9A 3RVUD 1G9MC 4GUPB 4EBQL 1PKOA 5C70A 4L1HA 4P59H 2Y72A 2IQAB 1QRNE 2HKFH 5IT2L 4ERSH 3C5ZB 3OXSA 1WZ1L 5CSGA 1ZK9A 3S3PA 5HI3D 1M4KA 1U8NA 3AB0C 5E4IA 4JKLA 3GSVB 3WFEH 3MO1A 4WO4C 3VI3E 2PYEB 1MELA 3C08H 3VDCA 4TVPD 3BP7A 5D2NA 4IJ3C 5CD3B 3ARED 4FN0A 4M9OA 1ZA3B 1EHLH 3CK0L 5SX4H 4NQDA 3Q6FA 4LAJH 1PY9A 2Z91A 3F58H 3UJJH 5T5FL 2FX8L 5L7XH 2VZSA 4XX1E 3UTTE 3ALPA 4HUUA 1NMBL 25C8L 4Z7WE 3RHWK 1MLBB 5I73B 3V0VB 3FRPA 4MHHG 3ULUF 4PGZA 3ILPA 3BH9A 1W72H 4J7RA 3V8OA 4FMFA 1I4FB 3K8KA 4BH8B 5GGSY 1L6XA 1RUPH 3PGFH 2F54B 3O8XC 5T3XD 5TF1L 4Z76A 3BPNB 4WTZA 1YEJL 3AU1B 3CDCA 3T0EA 4QGTA 1GJIA 2GAZA 2JKXA 3CC5B 2YUVA 5T3ZH 1N59B 1MFAL 4RGMC 3OGCA 4LSRH 1EK3A 3QFJE 5C9KA 4HUXA 3RVWD 2GITA 4MDIA 2N4IA 3UTSB 3MRDB 4HPOH 4JO1L 1GOHA 1ORSA 1NFDB 3JSSA 5DJZB 1T0NA 1FYTA 4TUKH 4GMSH 1B0RB 3OKEB 1IARB 2YPKA 1XGUA 3E3QC 1J88A 4Z95L 3REWB 1YN7A 3NIGF 4CGTA 1DBAH 3WFHA 2CKBA 1HZHH 5IBUG 3NIDE 1CDJA 4IOFD 3GMLA 2A9MH 4LLDB 3HG1E 1KXVC 5AAWA 5CBAB 4FXGB 1CK0L 4I13B 3VXRD 4PLJC 1J86A 4FOMA 2X09A 5C0JA 2VITA 1NBZB 3TPUA 4EVNB 5F9JB 1UZ6F 4HF5L 3UBXB 1RK1A 3QHFL 3QXUA 2I9LB 1BWWA 1U8OA 4PRPE 4PJ7E 1X5HA 1CLYL 1S5IL 2GK0A 1X7QA 2E3VA 5ERWB 1RZ7L 1I3GL 2HFFA 1JHKH 1NLBH 1RI8A 1RFDH 5ICYB 3BWAA 4D8PB 5D7SL 4NQEB 2CRZA 4H26A 4E41D 5I8OH 4ZFOA 4PLOB 3GJFH 3STLA 3PWPD 1PKQA 2I5YL 3X3GL 4DUVA 3AB0B 3LN5A 3NPSC 2R1XA 3LQAC 4QRRB 2EXYD 3TNNA 4CVZB 2MCG1 4ZAKC 1P4LB 1VDGA 5DRXB 2GIYA 4IJ3B 4LSQL 5SWQA 2DWEB 4V1DA 4XBPA 3REVB 3WNNA 1IT9L 4ZNEA 1N5YL 2Q8AH 4GKOA 2F74A 3QUMH 1CBVH 1K8IA 5C0AD 1URLA 4JDZA 5I73C 3Q0HA 4Y5YA 3TCXA 5SWSB 2R0KL 1UM5L 1GZQA 3TJEL 3B83A 1OT2A 5HGBA 4FP8H 1RUPL 3SGEI 4RIRB 3BYTA 3BZDA 3O6ML 3BPNC 4Z77A 4CN1A 5L6YH 1P9MA 3HMXH 2IFFL 1LE9B 1YDPA 1T21B 1ZT7B 1I85C 4CADB 3OGCB 4BKLA 1JPFB 2YD7A 1GIGL 4L29A 5DFTA 1OAKH 3WXVH 5AG9A 2IG2L 3ARDA 1QEWB 5KJRL 1IAOB 4LCWE 1KJ2L 1UB5B 3K4ZA 1E6OH 4GAJL 1D6EA 2BX5A 4H1LB 1AIFB 1VFBA 4GG8A 1R3IH 2EDFA 2YPVL 3QUMB 1JTTA 3STBA 4POYA 1AC6A 5DGQA 1DSFL 2FHFA 5E1AB 3LRSB 1HK6A 1BQHA 3HZVA 1JZ8A 1NC2D 5ETUB 3VWJC 2NNAB 3GUTA 4XAWH 1NCBL 3F6IA 1PG7W 2JB5L 4AMKH 2VDNH 3AS3A 3GM8A 4PRHA 4Z8FL 1BBJB 4OD1L 4L8SA 4R0LC 3C6LD 4Z95H 4P46A 3MV7B 4U1IB 43CAA 3TBSA 4JREC 4QY8A 3QIBA 2EKJA 5GS3A 3TZVD 3IJYB 3MRKA 4LPWA 2BZDA 4PRNA 3V9FA 4HUMB 1CFSB 3MUJA 2V9TA 5LWYH 4YHZL 4TQEH 3C8HA 1AGEA 5SX4I 3KHOA 5EZOL 5I1AB 3EO0B 7FABH 5DDHA 3CPLA 4OLXL 2ZWLT 4ZAKB 1MHEB 2W07A 1IM9D 4OQTA 1ED3A 1AE6L 5AD0B 4MJ5B 2I25N 4I3RH 5I74C 3MGTB 5KZCD 1P2CA 2VDML 5J9PB 4LP4A 4UB0H 4HK3J 4GRLC 3QPQC 5LJYH 3NBNA 4JQXA 4PRIA 1IVLA 2XWBA 4JB9H 4FQ1L 1BVZA 1OAUH 1M7IA 3SCMC 1JGVL 5MEND 1MCBA 2Q87A 3FB5B 5HHVH 1OM3L 5DLMH 1A1OA 3WKML 3BEWA 1QSFB 3JV0A 4HUVA 4D9LH 4DZ8B 4U0RB 4XWGL 5LXGL 2Y07H 2CXGA 1V5JA 2NY2B 2GSGB 3VXMA 5DJ6A 4I3GA 2R56L 2FX8H 4LQ1A 2JCCB 3MBEC 1MQKL 4L4VE 5FUZL 2RIKA 3QCTL 4APQD 3DO7A 5DC0A 4KROD 1K4DA 4C56B 4LQFH 3NCJL 3LCYA 3BIKA 2R2BA 5AYUL 4NO0B 2NZIA 3MRMA 3EO1B 2WBKA 5IW6A 3T3PF 2J6EL 3TO2A 2NYYC 4HD9A 2A9NL 4YE4H 3UO1H 4MXQC 5I1HL 1BVLB 4HJ0D 5D2LA 2RFXB 5C08D 3ZYIA 4JZOA 3DYMA 2AJYH 3M1BB 4P2OA 2I9TA 3DVNA 2UWEE 3CD4A 3FOLA 3SDCD 3QR2A 5KVFL 5KSAA 5FYJL 4DCQA 1GXEA 1ES0B 1I1AC 4V1DE 3EYUH 3X17A 3BUYA 1KN2H 1FGVL 1N0XL 5ETUA 4DVBB 2CDFA 4QNPE 3GUTB 7CGTA 1NUFA 2MCPH 5J6GB 2PTTB 5KS9F 4LFHD 5DR5H 1WWBX 3ESVF 2GK2A 4KK9D 3WHXA 3TYFB 1XIWC 4X8JA 1HKLL 5GRUH 1NJ9B 1P1ZA 2ZCKH 2APVA 4G7YH 3CFEA 1BD2B 3NABH 5DQDL 4IRJC 4MQXD 3S7GA 4JREB 2F8VA 1DQTA 1QEWA 3ARDB 3SO3B 2X4RA 2DKUA 2ESVA 4Q2ZA 5IMMA 3MRFB 5LCVH 4EUPA 2BHYA 3MV7E 4NO5B 1FJ1B 4A6YL 3E8UL 3BZEA 2GTZB 1F4AA 3U7WL 4NKMA 3DHJA 4OFDA 2BMKB 3PL6B 3C2AH 4LOUC 3OQ3B 5DEGA 5IB2A 5JPMA 4OD3H 3U9UB 3LRSA 1YY9D 1CG9B 4PJBE 1BFSA 3HMWH 1YEHH 1DL7L 2XG5A 3SE9L 2W92A 3HZYB 3RWIB 3T4YB 3LVEA 1L7IH 2C1PA 1ZANH 1JGEB 2R69H 2RBLA 2DMBA 4UIKH 3WKMH 5EU6B 1G6RL 2V2TA 3FT3B 2NY0C 1OQXA 1BFVH 4JY4A 4NFDA 1VB9A 4KPHH 1N5YH 1ORQB 2J3SA 4P2RD 4U1MA 4U2ZA 4F9LA 2YS4A 4JFDD 3SQBA 4YR6A 2VDLH 4O00A 5CSZB 4I1NB 2B5IC 1KNOA 5BV7L 3MLZH 5KZCB 1DE4B 4G6ML 1X6NA 1KEMH 3TZVA 3RA7L 5EA0H 1FL6B 3MRDA 2DDQL 3FQXA 4X5LA 3VGDA 1DBJH 5J7CC 5D1ZD 1W8OA 2EDOA 4G42B 5A2FA 2IADB 1OGTB 4R8WH 4G9DB 4Z7WA 4PJEB 5GZNC 5I1GL 1C16B 3B5TA 2QR0B 4WWKD 2NY5C 3T4AB 2XIDA 3AAZA 4Z78A 4U1GB 4IDJH 1Q72H 3N50A 3FTGA 1C1EL 1DBKL 3JXAA 1NC4A 2X4NB 3LKQB 3CMGA 3C60A 3PV7A 1JV5A 2CGRH 1UQSB 1TJGH 4GJTB 4M5YL 2J12B 4RAVB 3VFNA 5A1AA 5DRZB 4JKKA 4PJHF 1XF3B 4OZ4A 3QXTA 5BO1L 1NBYB 4BSWB 2A6IA 3MACL 2EIZB 3PGCA 3BD4A 2RGSA 1GYAA 4PS4L 1J0YA 1UC6A 1PKQB 1GAFL 2VLJD 4OLUL 4Z7WF 1MREH 1NAMA 4NM4L 1NCAH 1A7OL 3SO3C 4Q2ZB 5TE6H 3D85A 1G7IA 3V5DA 1T2XA 1S7WB 4LCIH 1NAML 4JRXE 3MV9B 4YHML 3D9AL 1G7LB 4RQQB 2V5TA 5FB8A 3THML 2GSIA 5TH2B 5IGXH 1S7SB 3ZHLA 1IFHL 3NACH 3HI1A 5H2BB 4QHNA 1FQ9C 1A7QH 3RWIA 2OJEB 1RQ5A 2VLKE 3D0VB 3E2HC 5ILTL 1IGIH 1CGVA 4WUKL 3P77A 1HHHB 5JR1L 1OLLA 4HC1A 1D9KA 4PGBA 2X1QA 4BK4A 3ECBA 3BE1H 1UEYA 3DSFH 4XZUB 1U8PB 1AH1A 4QOKE 2NW2A 3ARSA 4ZMAT 1LE9A 1TTUA 2WQRA 2YXMA 1F3RB 4U1JB 4XP5L 5E08H 4E0RA 2A83B 3CX5K 4NC2B 3RY5A 4H1LG 2H9GA 1UVQA 1V3LA 4Q9QH 1TIUA 3S37H 1BBDH 2FBJH 1AKJB 3SE9H 4NYLB 3G04B 4HCRA 2EYTB 5C0DB 5LGHH 4TOYL 4HKBA 4F2MB 3V5HA 3CLFH 5T33L 2DI8A 3UC0L 4GG8B 3RQ3A 2WLYA 1MFDL 1RZKH 4XBPB 4HWZB 3TFKC 3UYPA 1K8DB 5TQ0L 4LQFL 1LO3L 3VI4F 4MD4A 3AAZB 5EZLA 2E7MA 3JTSA 1HQ4B 4WEBH 4PD4K 3OR6B 5BV7H 2VOTA 4WHCA 2VDPL 5C07D 4LMQE 1D6VL 2EO1A 4RNRB 3QPXH 4PRHB 1FZOB 4JCMA 5FHBL 2DLGA 1LO5B 4P46D 5KVFH 5T3XE 2EIZA 4H1LH 3RUGF 2E7LC 3IU3A 2IC2A 2VKXA 5F9OH 5SV3A 5IMLB 4XVJL 1GC1C 3CVHA 1AQDB 4E41E 1ADQL 1JIBA 3T0WA 1CF8L 5FYJU 4I77L 1Y0LA 4YXHH 5A3ID 1BIHA 5DDHB 3F7VB 4MB5A 4HS8H 5T3ZD 5L8LB 4GFTB 3BD5A 3EHBC 4RQQA 4H0IA 3KXFA 4UQ3B 5C0EB 2GSIB 3FQWB 3NFSH 4N0FA 3VRIB 1D9KD 1QYGL 4U1LB 1Y6KR 3VG9C 2O5ZL 12E8H 5B8CA 3EOTH 3L3IB 2CQVA 2LABA 4ISVB 1G7MA 4KZDH 1WFTA 1AD0B 3MJ6A 3G6AA 2XTLA 4E41A 4WI8A 4D3CL 3BEVA 5IMKA 4XWGH 5C09E 5E03A 1UWEL 3BN9D 4IRSC 3EYQD 4XZUA 3QFJB 3IFNL 5E8DH 3UDWA 4YGAB 5E5UB 5TJWK 5KAQF 2OBGA 1DQDH 4OGAC 5LVEA 1KTDA 2LAGB 5DHVB 3C5ZA 1QNZH 4EIGB 3MRNB 4F15C 1QRNB 3SDAC 4MJ6A 5HVFB 5IESH 1K4DB 3AFLA 1CR9L 4NWUL 5CINH 2IBBA 3VFWA 1SMOA 5D1QD 4JHZA 1LEIA 5C0DA 4X7EC 3BPOC 2ZUWA 1U8JB 2YPKB 4L4TB 1ADQA 1ZLUH 5GGVH 2D7MA 3WFHB 4UTBL 2CUIA 1U2CA 1LILA 4CN6A 2EICA 4KJYB 1JYVA 2PKDA 4Y4KB 3DX6B 2XYCA 2DMCA 4N8CH 1R5VB 5FDYA 5KOVC 4DCQB 1VGKB 1DBBL 4UBDD 5LQBH 2Z8RA 3PL6D 4GW1A 3HI6L 2XWBB 3OJDB 1NCWH 3TCLA 3ULUH 2DDQH 1FL3B 2DIJA 1KFAH 1JUFB 3VCLB 5T1DH 4QTHB 1FZJA 4HUKB 3F7PC 2AAVA 3CLFL 1AXTL 1FVDB 1MJUL 2ED9A 5F1OB 1AKJD 3CMOL 3JV5A 1H15B 5D7JA 1BGXH 4XMPH 4JM2F 3AXLA 1LP9A 2C3HA 3N1MC 5CJ5A 4WTWA 5B3JE 2HP4A 3V4UH 1CK0H 1T5XA 3IJHB 4JPWH 4PR5B 2AVGA 5ENWA 2A38A 4OKVA 1X4XA 1TJGL 4P2QE 1MFBH 2BVPB 2X7LB 3MGOB 5DJZA 3I6LD 3O3AA 4QRUB 1NFIA 4G8EA 1S5IH 1ZTXH 2A0LD 2BNQD 4XMLH 1HEZB 4JGMA 5E70A 1T2JA 3C2AL 1F58L 2HMIC 1WBXA 4NQCE 3DVNB 4XXDA 1R3JA 5CUSH 1QR1B 3GBLA 4PRHD 5EU7C 4O2EA 6FABH 1DN0B 3U46A 1BEYH 3DURA 3OR6A 3U9PH 1M71A 2AGJH 4NRZA 2JK5B 5F3BB 3MV11 3PE9A 2MQCA 3GMNA 1AP2B 2I9LA 2QSCL 5C0CA 3U4BH 4HIIB 4M6NH 4IRSB 1R5WA 3GK8H 3HE6C 4H88L 2OR7A 4K23L 4X5WB 2IGFL 3SKNA 3W0WB 3CDGB 5ADOL 1NJ9A 2XI9A 1EFXA 4MNGB 1KLGA 4Y19D 2F53D 3QQ4B 2K1MA 3B3IA 5HDOA 3DVGA 3U2SA 2R1WB 3LN4A 4HQQL 1F6FB 1MI5D 1QFUH 5ACLA 4J3SA 5CINL 3CLEL 4NCDA 3QISA 1SJEA 1F8TH 4YPGA 4DQOH 1YPZE 2EDQA 4LBEA 5FYLD 1FL6A 3GI8L 2Q6WB 5DWUL 1YEJH 3ARXA 3PWJA 3BPOB 4PRID 3DETC 3O3DA 3O6FD 4KMTH 5HYJB 1P6AB 5HI4C 3SGKA 1JMZA 4TSAH 5IV2A 4HXBL 3NIDF 3O9WD 5EU4B 1IT9H 3DWTA 4DEPB 4Y4KC 1I3UA 4X7SH 2VKWA 5E2VL 5C0GA 4YHOL 5GGRB 2AI0L 1DQQA 1GIGH 3MA9L 1H3UA 5GIRB 3VXTB 3ZDZF 4LGPB 3LKQA 1PDKA 2HJLA 3FN3A 4M5YH 5BRZB 1J8HD 1CFQA 3NH7L 5FIEA 3KPSE 4WFHD 1KFAL 3HPLB 5L9DH 1QVOB 1O0VA 3QCUH 5L2KB 1MJUH 1LO3H 1NCDH 2L7UA 4KV5E 4QY8B 5CP3H 2BNRA 4EDWL 4EOWH 5I17B 4L4TD 3IFLL 3QI9A 5BS0D 1MVUA 2YUZA 4CMMB 2CO7B 3QHFH 4HGKC 3QUKA 1YNLL 1UCTA 1NCWL 2K9UA 3CSYB 3G6DL 5D7IA 4G8EB 4F58H 5BW7A 4G3YH 4R7NA 4L9DA 2P5WB 2QQNH 3GIZH 4LVHC 5AEAA 3EOAA 4JAMA 3VGGA 4PJDB 1WAAF 5K59F 5HHXL 5C3TA 2YK1L 2H32H 1G7QB 1MY5A 1EV2E 3O3BB 4DGIH 3QYCA 4E5XA 4JFPB 4MS8C 5H2BA 1ADQH 1S7QB 3IS0X 1ETZA 2ZNXA 3TBTB 3S34H 4DN4L 3FMGH 1YNTA 2V5YA 4TSBH 4FNLH 1NGYB 1ZHLA 1FZKA 2XTJD 3VFRB 5JXEC 4XRCB 1J8HB 1NLBL 3FO2A 3HRZB 1I1RA 3HE6B 2L4OA 3MLTB 2NTFB 3RI5K 4F7CA 4OZHE 5I1LA 4NDMA 4R3SA 5EOTB 3DMMC 4JG1L 5J12B 2GJZA 1DEDA 1HSBA 4Z7VA 2Z31D 4Q9QL 5F96L 4NZTL 5BZDB 4K94H 1MHPH 3ZLQC 1CFTB 4ZXBC 3BH8A 1JTOA 5J13B 1UWEH 3BHBB 4R6UA 2YZ8A 1OAYH 4S1DD 4WUUE 1HN1A 3HZMA 3QUZB 5DQ9B 4P9ML 1WLHA 3IDGB 3IDMA 4KY1H 4YUEH 1JWUA 1P84J 3D85D 4N0UA 2CIIA 3AROA 1KLUB 5EOQL 2W59A 3MJ7B 2J8UA 1MFNA 3K80A 4QT5B 3H3BC 2O5XL 4HFUL 1PG7L 1JJUA 5HSFA 4N90D 1MLCA 4EN3D 4LGSB 2UY6A 2PYFB 1OTSC 4OM1H 1Y6NR 3KWWB 3QG6A 5IQ7L 3LKOA 3HS0B 3KYKL 2ITCA 2V2XA 4F37F 4H8WL 3N85L 3VU2A 1GPOH 1U8NB 3VI4E 4KQ4L 3DVGB 3OJ2C 3QQNA 5C6WH 4GH7B 5EG6C 3EYUL 3B9KA 3SKOA 5AYUH 5EOCJ 1JPTL 1U3HB 4MAYC 2LFGA 4JFEA 1YNLH 1T7XA 3DXAD 2Z35A 4JFHD 3DX9B 5JDSA 1Q0XL 4FQXB 1KTLB 1UFUA 4WW1B 1HI6B 3HUJE 1JGLL 4HDIA 2AKRB 3MLWH 3LIZH 5FA4B 5D2LF 4PY7A 4B53A 5KSBA 1V3KA 3SDYH 5IBLD 1WCBB 4PJXE 3O2DA 2FJFA 1PYWB 5JZ7C 3GMLB 4LLDA 4NJ9H 2BSRA 4JO3H 5D93C 4Z7UF 3MLVH 4UZGA 1BVKA 2NXYC 4WFGD 4HCRH 3LY6A 4R97C 1R5IA 3K2MC 4KU1A 4ODHH 3UZEA 4QRSA 3CCHB 3ORJA 4XP4L 3VRJA 2ZOLB 2DYPA 2PCPA 1KC5L 4KZEH 4OCSL 3UP1A 4OV5A 2M1KA 3OKOA 3SO5A 1KBGL 2VL4A 2DBJA 4Y88A 4QF1B 2P46B 2X2YA 1A1NB 3DMMB 3OV6A 5EO0B 4EQ2A 3IDNB 5D7KE 3EYFB 3WIFA 1QOKA 1T66D 3KPLB 1YEEL 3O45A 4DN4H 3P3YA 5CS7A 4Z7UA 4O51A 1UJ3C 4ZXBB 3VRLF 2OJZH 4UT9H 2JJSA 3TH4T 5FHAH 4I8DA 4JRYD 1WZMA 1AGCA 3QIUD 4U6HA 4JQIL 1ACYH 4ODXB 1MFCL 1I1FB 2AV1B 4AL8L 3G5ZA 1DBBH 1WTGT 5F6HJ 3H9SB 2OMNA 5ICXB 2OK0L 2Q8BH 3SE4C 5IHZB 2ADIB 3IDXL 3LEYH 5INDB 3V4PH 1MQ8A 4N68A 5IQ7H 3PWPB 2C4XA 2R56H 4KK5D 4WI3A 4XMPL 1TLKA 5T5FH 1EA9C 1SY6L 3MBXH 3UTTB 4HGMA 1C08B 1NAKH 4HMCA 4QOKD 1DBML 3TVMB 4KKCD 4PP1D 2WUBH 1U3HC 4HXAL 4MAYB 3S4SG 4JM2A 3QDGE 3P0VH 4K9EC 2AK1L 2BFVH 2BXZA 2FIKB 4G42A 4DGYL 1NCDL 4PREB 5EIIA 3QHTC 4HX1A 2ICEB 3QCVL 4M1GL 3SDYL 3QJHB 4I0PA 4I48A 2YWYA 3B9VA 4XXDB 4M3JA 5E2TH 1R5VA 2W9LA 4PJGE 4ZD3L 5D93B 4PRIB 2V7HA 1T6WA 2XA3A 3GSUB 5DVKA 5E1AA 5C09D 3D0VA 2FX9H 3FL7A 3KPRB 1T4KA 2Q7NA 3P77B 4R97B 3PQYB 4YDLB 4RAVA 4NJAH 3EDDA 1R5WB 2A77H 4Z7OE 4XGZA 2APXA 5B39G 4G6FB 1E4JA 2FX7H 3TPKA 2VLME 5CIPB 3RKDD 1IEAA 3OKLB 4P57B 5GSVB 4GBXD 2VWEC 3UTTD 4P2QA 4UTAH 3KDMA 2DLTA 2NX5B 1AKJA 2ORBH 2WIIA 1KIRA 3X3FL 1YEEH 3VXRA 5D2LE 4V2BA 1UJ3B 1ZWIA 2HA1A 5DK3A 1DLFL 1YECL 4QHKJ 1ZA3A 4QYOA 4ZOEA 1WGOA 5EUOA 4UOJA 5JXAH 2A6KB 3X14A 1ZKAA 2F19H 5DD6A 1JNNH 3FOLB 5CJXA 4QHMB 4ZDHA 3ZT6A 5T1KB 5I8EB 3IJSB 4AG4H 1RD6A 3LAFA 3VW3H 5HDBE 4HH8A 1IAKA 2AJZB 1BHGA 2P5WD 3HG1A 4UAOC 3TJHD 2VLRB 4ZFGL 3T3MF 4I0KA 2HRLA 4RWHA 2C1OA 1G7HB 3I85A 4UV4H 3F8UB 1L9NA 4Y5XC 3MCLH 5B22A 3EYVA 1OP9A 1TDQA 4JHAL 5IK3B 3ROLB 1CBVL 1U8KA 3SKUD 1XF1A 3CVIH 4G6JH 3RWJB