1BFYA

Solution structure of reduced clostridium pasteurianum rubredoxin, nmr, 20 structures
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
54
structure length
54
Chain Sequence
b'MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title Solution Structure of Reduced Clostridium Pasteurianum Rubredoxin
pubmed rcsb
molecule tags Electron transport
total genus 5
structure length 54
sequence length 54
ec nomenclature ec 1.18.1.1: Rubredoxin--NAD(+) reductase.
pdb deposition date 1998-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 1bfyA00
1FHMA 1R0JA 3RZTA 1DX8A 1YK5A 3PZAA 1S24A 1YUZA 2PVXA 1S2ZA 2RDVA 1IROA 1YK4A 3RZ6A 1B71A 1RB9A 1S30A 4AR5A 1CADA 1BQ8A 3KYVA 1FHHA 2V3BB 1RDGA 5RXNA 2HR5A 1BRFA 1VCXA 4POFA 8RXNA 7RXNA 3KYYA 3A44A 1T9PA 1B2JA 2VL6A 1IU5A 3QVDA 2GMGA 4YWLA 1T9QA 1H7VA 3RYGA 2PYAA 4POGA 1E8JA 5IY0A 2QL0A 1B13A 2DSXA 1YV1A 4AR4A 2K2DA 1LTLA 1IU6A 1R0IA 1R0HA 4RXNA 3KYUA 1CAAA 1SMWA 4K9FA 1RWDA 1SMMA 4AR3A 2MS3A 1QCVA 1JYBA 3SS2A 2KKDA 1C09A 1T9OA 5AI3A 1B2OA 3KYWA 1BQ9A 1LKOA 1DVBA 6RXNA 1BFYA 1RYTA 1IRNA 2M4YA 1NNQA 3PWFA 1SMUA 1LKMA 1BE7A 1QYBA 3KYXA 1RDVA 2PVEA 4ME3A 1ZRPA 1R0FA 1LKPA 4TPUA 4YWMA 1R0GA 2KN9A 1YUXA 3MPSA 2LCQA 5AI2A 4AR6A
chains in the Genus database with same CATH superfamily
5DM61 1FHMA 4AHXA 4C3HL 5GAGc 1YK5A 2Y0SP 5C4JL 1OWBA 2PVXA 2RDVA 1IROA 1PFUA 3GTJL 1B71A 5IP7L 5C4XL 2EY4E 2CKAA 1BQ8A 2YU9L 5RXNA 4B8CD 5C44L 2AQCA 3GTQL 4AHZA 3MQKB 5FLML 3KYYA 2ERSA 3M4OL 3H3VM 3HJYB 1Z92B 3HOZL 3H0GL 2NVXL 1WCML 3RZOL 4A3CL 3RYGA 3H97A 2NVTL 2QL0A 2DSXA 2XJRA 1YV1A 2K2DA 2XJTA 1R0HA 3NFPI 1TWCL 1RWDA 2A6HD 2J9UB 5MF6A 2MS3A 1QCVA 3JR7A 2APOB 2XJSA 3S17L 4C3JL 3B0AB 1BQ9A 2B63L 1DVBA 1RYTA 1IRNA 4UY81 2R92L 4TVMA 4A3DL 1I50L 3KYXA 3S16L 2Z3QB 3ZG6A 4C2M1 3LNLA 2RFKB 5H1Sc 3S1QL 1YUXA 1VZGA 3MPSA 2LCQA 2Z3RB 2E2IL 4G6BA 3LWPB 1R0JA 2JA7L 2A6ED 1DX8A 3GTML 3PZAA 1S24A 1YUZA 1S2ZA 2R93L 1YK4A 2XJPA 3PKJA 2WAQP 1S30A 2PMZP 4AR5A 2JI1A 3S2HL 1QQTA 2VUML 5M3ML 3KYVA 1FHHA 1TWFL 4LHNA 1F4LA 2HVYC 2JA6L 1T9PA 4A3BL 1TWAL 1B2JA 3PL5A 4GS7D 1R9TL 4YWLA 1IW7D 4JAFA 3GTLL 2NVYL 4ZN1B 3S14L 4A93L 4QIWP 4POGA 1P7PA 1PZXA 3S1RL 1E8JA 3FDJA 3HOVL 4AR4A 5GAHc 1LTLA 1R0IA 1SMMA 5GAEc 1Y1VL 3S1ML 1JYBA 1NXEA 2KKDA 5M5XL 2XJUA 1B2OA 3GTPL 4X6AL 4A3LL 2WB1P 3B08B 1LKOA 2V0FA 4LHLA 6RXNA 3S15L 5IYDL 1NNQA 3MSUA 1SMUA 1K83L 1LKMA 3VPBE 1QYBA 2BE5D 4AI2A 1I6HL 3S2DL 2NVQL 1ZRPA 5AN9H 1LKPA 1Y1WL 5FJ8L 4TPUA 2AYJA 4YWMA 4Y52L 1R0GA 5IYBL 5DM71 3HOXL 3H99A 3RZTA 5JVH1 3S1NL 5C3EL 4U671 2AUSB 2JI2A 2JA8L 3J7Z1 3HJWB 3RZ6A 5IYCL 1RB9A 4AI1A 1VZHA 3HKZP 3I4ML 2V3BB 1RDGA 3H9CA 2HR5A 1BRFA 1VCXA 3FKIL 4BY7L 2E2HL 3HOYL 1TWGL 3WWLA 1IU5A 3QVDA 3PIO1 2GMGA 1SFOL 5K2ME 4Y7NL 3J7Y1 1H7VA 1TWHL 2PYAA 1B13A 3K35A 5MLC3 4AHWA 3HOWL 4AI0A 1IU6A 1WJVA 5M3FL 4XXBB 3KYUA 1CAAA 1SMWA 2CKCA 2C6BA 1PFWA 1I3QL 4ZN3B 3K7AL 3SS2A 3GTOL 1PFVA 2XJVA 3I4NL 3P8BA 1T9OA 3KYWA 5MFPA 4A3IL 4E6YA 1BFYA 2ZIXA 2M4YA 3PWFA 5IP9L 4BBSL 2L0ZA 4AYBP 3WWNB 2R7ZL 3LWOB 5M5YL 2KN9A 2ERJA 2B5ID 5AI2A 5GADc 2M6OA 4XGHA 4AR6A 3M3YL 4AI3A 1PFYA 3P2AA 4BXXL 3LWRB 2A69D 2PSMC 4WFN1 2O5JD 3GTKL 2JA5L 5MFZA 2CR8A 2JI3A 1CADA 4A3GL 4POFA 8RXNA 7RXNA 3H9BA 3A44A 4A3KL 3PO2L 2VL6A 3LPEB 1T9QA 1VZIA 2XJQA 3GTGL 3PKIA 2H12A 3RZDL 1RYQA 2A68D 3HAXC 5IY0A 2NYDA 4A3EL 4RXNA 2V0EA 4K9FA 3PIP1 3PO3L 4JAGA 1NXGA 4AR3A 5JVG1 1OWCA 2PPTA 2M6PA 5EIOC 5MGNA 3IU3I 2E2JL 4AHYA 4V196 1C09A 3CQZL 4C3IL 5AI3A 4JAEA 4A3JL 5M5WL 3QQCE 5EINC 3HOUL 1BE7A 2C6AA 2M4VA 3LWVB 1RDVA 2PVEA 4BY1L 4ME3A 3LWQB 1R0FA 4JADA 1ODHA 4A3ML 4A3FL 4BBRL
chains in the Genus database with same CATH topology
4G6BA 5DM61 1FHMA 1R0JA 4AHXA 5GAGc 3RZTA 5JVH1 4AI3A 2A6ED 3P2AA 4U671 1DX8A 1YK5A 3PZAA 1S24A 1YUZA 2JI2A 1OWBA 2PVXA 1S2ZA 2RDVA 1IROA 3J7Z1 1YK4A 3RZ6A 2A69D 2PSMC 1B71A 4WFN1 2O5JD 1RB9A 2XJPA 3PKJA 4AI1A 5MFZA 1S30A 2CR8A 4AR5A 1VZHA 2JI1A 2JI3A 2CKAA 1CADA 1BQ8A 3KYVA 1FHHA 2V3BB 4LHNA 1RDGA 5RXNA 4B8CD 2HR5A 1BRFA 1VCXA 4AHZA 4POFA 8RXNA 7RXNA 3KYYA 3A44A 1T9PA 2ERSA 1B2JA 2VL6A 3WWLA 1IU5A 1Z92B 3QVDA 4GS7D 3PIO1 3LPEB 2GMGA 5K2ME 4YWLA 1IW7D 1T9QA 4JAFA 1VZIA 3J7Y1 2XJQA 1H7VA 3PKIA 2H12A 4ZN1B 1RYQA 3RYGA 2PYAA 2A68D 4POGA 1E8JA 5IY0A 1B13A 2QL0A 2DSXA 2XJRA 3K35A 4AHWA 5MLC3 1YV1A 4AR4A 5GAHc 2K2DA 2NYDA 1LTLA 2XJTA 1IU6A 1WJVA 1R0IA 1R0HA 4AI0A 3NFPI 4RXNA 4XXBB 2V0EA 3KYUA 1CAAA 1SMWA 2CKCA 2C6BA 4K9FA 4JAGA 1RWDA 3PIP1 2A6HD 4ZN3B 2J9UB 5MF6A 1SMMA 5GAEc 1NXGA 4AR3A 5JVG1 2MS3A 1OWCA 1QCVA 1JYBA 1NXEA 2PPTA 2M6PA 3SS2A 2XJSA 5EIOC 5MGNA 2KKDA 3IU3I 2XJVA 2XJUA 4AHYA 4V196 1C09A 3P8BA 3B0AB 1T9OA 5AI3A 1B2OA 3KYWA 1BQ9A 5MFPA 4JAEA 3B08B 1LKOA 4E6YA 1DVBA 2V0FA 4LHLA 6RXNA 1BFYA 1RYTA 2ZIXA 3QQCE 1IRNA 5EINC 4UY81 2M4YA 1NNQA 3PWFA 3MSUA 4TVMA 1SMUA 1LKMA 3VPBE 1BE7A 1QYBA 3KYXA 2BE5D 2C6AA 2M4VA 1RDVA 2L0ZA 2PVEA 2Z3QB 3ZG6A 4AI2A 4ME3A 3WWNB 1ZRPA 5AN9H 1R0FA 1LKPA 4JADA 3LNLA 4TPUA 5H1Sc 1ODHA 2AYJA 4YWMA 1R0GA 2KN9A 1YUXA 2ERJA 5DM71 1VZGA 3MPSA 2LCQA 2Z3RB 2B5ID 5AI2A 5GADc 2M6OA 4XGHA 4AR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FHM A;  1R0J A;  3RZT A;  1DX8 A;  1YK5 A;  3PZA A;  1S24 A;  1YUZ A;  2PVX A;  1S2Z A;  2RDV A;  1IRO A;  1YK4 A;  3RZ6 A;  1B71 A;  1RB9 A;  1S30 A;  4AR5 A;  1CAD A;  1BQ8 A;  3KYV A;  1FHH A;  2V3B B;  1RDG A;  5RXN A;  2HR5 A;  1BRF A;  1VCX A;  4POF A;  8RXN A;  7RXN A;  3KYY A;  3A44 A;  1T9P A;  1B2J A;  2VL6 A;  1IU5 A;  3QVD A;  2GMG A;  4YWL A;  1T9Q A;  1H7V A;  3RYG A;  2PYA A;  4POG A;  1E8J A;  5IY0 A;  2QL0 A;  1B13 A;  2DSX A;  1YV1 A;  4AR4 A;  2K2D A;  1LTL A;  1IU6 A;  1R0I A;  1R0H A;  4RXN A;  3KYU A;  1CAA A;  1SMW A;  4K9F A;  1RWD A;  1SMM A;  4AR3 A;  2MS3 A;  1QCV A;  1JYB A;  3SS2 A;  2KKD A;  1C09 A;  1T9O A;  5AI3 A;  1B2O A;  3KYW A;  1BQ9 A;  1LKO A;  1DVB A;  6RXN A;  1BFY A;  1RYT A;  1IRN A;  2M4Y A;  1NNQ A;  3PWF A;  1SMU A;  1LKM A;  1BE7 A;  1QYB A;  3KYX A;  1RDV A;  2PVE A;  4ME3 A;  1ZRP A;  1R0F A;  1LKP A;  4TPU A;  4YWM A;  1R0G A;  2KN9 A;  1YUX A;  3MPS A;  2LCQ A;  5AI2 A;  4AR6 A; 
#chains in the Genus database with same CATH topology
 5DM6 1;  1FHM A;  4AHX A;  4C3H L;  5GAG c;  1YK5 A;  2Y0S P;  5C4J L;  1OWB A;  2PVX A;  2RDV A;  1IRO A;  1PFU A;  3GTJ L;  1B71 A;  5IP7 L;  5C4X L;  2EY4 E;  2CKA A;  1BQ8 A;  2YU9 L;  5RXN A;  4B8C D;  5C44 L;  2AQC A;  3GTQ L;  4AHZ A;  3MQK B;  5FLM L;  3KYY A;  2ERS A;  3M4O L;  3H3V M;  3HJY B;  1Z92 B;  3HOZ L;  3H0G L;  2NVX L;  1WCM L;  3RZO L;  4A3C L;  3RYG A;  3H97 A;  2NVT L;  2QL0 A;  2DSX A;  2XJR A;  1YV1 A;  2K2D A;  2XJT A;  1R0H A;  3NFP I;  1TWC L;  1RWD A;  2A6H D;  2J9U B;  5MF6 A;  2MS3 A;  1QCV A;  3JR7 A;  2APO B;  2XJS A;  3S17 L;  4C3J L;  3B0A B;  1BQ9 A;  2B63 L;  1DVB A;  1RYT A;  1IRN A;  4UY8 1;  2R92 L;  4TVM A;  4A3D L;  1I50 L;  3KYX A;  3S16 L;  2Z3Q B;  3ZG6 A;  4C2M 1;  3LNL A;  2RFK B;  5H1S c;  3S1Q L;  1YUX A;  1VZG A;  3MPS A;  2LCQ A;  2Z3R B;  2E2I L;  4G6B A;  3LWP B;  1R0J A;  2JA7 L;  2A6E D;  1DX8 A;  3GTM L;  3PZA A;  1S24 A;  1YUZ A;  1S2Z A;  2R93 L;  1YK4 A;  2XJP A;  3PKJ A;  2WAQ P;  1S30 A;  2PMZ P;  4AR5 A;  2JI1 A;  3S2H L;  1QQT A;  2VUM L;  5M3M L;  3KYV A;  1FHH A;  1TWF L;  4LHN A;  1F4L A;  2HVY C;  2JA6 L;  1T9P A;  4A3B L;  1TWA L;  1B2J A;  3PL5 A;  4GS7 D;  1R9T L;  4YWL A;  1IW7 D;  4JAF A;  3GTL L;  2NVY L;  4ZN1 B;  3S14 L;  4A93 L;  4QIW P;  4POG A;  1P7P A;  1PZX A;  3S1R L;  1E8J A;  3FDJ A;  3HOV L;  4AR4 A;  5GAH c;  1LTL A;  1R0I A;  1SMM A;  5GAE c;  1Y1V L;  3S1M L;  1JYB A;  1NXE A;  2KKD A;  5M5X L;  2XJU A;  1B2O A;  3GTP L;  4X6A L;  4A3L L;  2WB1 P;  3B08 B;  1LKO A;  2V0F A;  4LHL A;  6RXN A;  3S15 L;  5IYD L;  1NNQ A;  3MSU A;  1SMU A;  1K83 L;  1LKM A;  3VPB E;  1QYB A;  2BE5 D;  4AI2 A;  1I6H L;  3S2D L;  2NVQ L;  1ZRP A;  5AN9 H;  1LKP A;  1Y1W L;  5FJ8 L;  4TPU A;  2AYJ A;  4YWM A;  4Y52 L;  1R0G A;  5IYB L;  5DM7 1;  3HOX L;  3H99 A;  3RZT A;  5JVH 1;  3S1N L;  5C3E L;  4U67 1;  2AUS B;  2JI2 A;  2JA8 L;  3J7Z 1;  3HJW B;  3RZ6 A;  5IYC L;  1RB9 A;  4AI1 A;  1VZH A;  3HKZ P;  3I4M L;  2V3B B;  1RDG A;  3H9C A;  2HR5 A;  1BRF A;  1VCX A;  3FKI L;  4BY7 L;  2E2H L;  3HOY L;  1TWG L;  3WWL A;  1IU5 A;  3QVD A;  3PIO 1;  2GMG A;  1SFO L;  5K2M E;  4Y7N L;  3J7Y 1;  1H7V A;  1TWH L;  2PYA A;  1B13 A;  3K35 A;  5MLC 3;  4AHW A;  3HOW L;  4AI0 A;  1IU6 A;  1WJV A;  5M3F L;  4XXB B;  3KYU A;  1CAA A;  1SMW A;  2CKC A;  2C6B A;  1PFW A;  1I3Q L;  4ZN3 B;  3K7A L;  3SS2 A;  3GTO L;  1PFV A;  2XJV A;  3I4N L;  3P8B A;  1T9O A;  3KYW A;  5MFP A;  4A3I L;  4E6Y A;  1BFY A;  2ZIX A;  2M4Y A;  3PWF A;  5IP9 L;  4BBS L;  2L0Z A;  4AYB P;  3WWN B;  2R7Z L;  3LWO B;  5M5Y L;  2KN9 A;  2ERJ A;  2B5I D;  5AI2 A;  5GAD c;  2M6O A;  4XGH A;  4AR6 A;  3M3Y L;  4AI3 A;  1PFY A;  3P2A A;  4BXX L;  3LWR B;  2A69 D;  2PSM C;  4WFN 1;  2O5J D;  3GTK L;  2JA5 L;  5MFZ A;  2CR8 A;  2JI3 A;  1CAD A;  4A3G L;  4POF A;  8RXN A;  7RXN A;  3H9B A;  3A44 A;  4A3K L;  3PO2 L;  2VL6 A;  3LPE B;  1T9Q A;  1VZI A;  2XJQ A;  3GTG L;  3PKI A;  2H12 A;  3RZD L;  1RYQ A;  2A68 D;  3HAX C;  5IY0 A;  2NYD A;  4A3E L;  4RXN A;  2V0E A;  4K9F A;  3PIP 1;  3PO3 L;  4JAG A;  1NXG A;  4AR3 A;  5JVG 1;  1OWC A;  2PPT A;  2M6P A;  5EIO C;  5MGN A;  3IU3 I;  2E2J L;  4AHY A;  4V19 6;  1C09 A;  3CQZ L;  4C3I L;  5AI3 A;  4JAE A;  4A3J L;  5M5W L;  3QQC E;  5EIN C;  3HOU L;  1BE7 A;  2C6A A;  2M4V A;  3LWV B;  1RDV A;  2PVE A;  4BY1 L;  4ME3 A;  3LWQ B;  1R0F A;  4JAD A;  1ODH A;  4A3M L;  4A3F L;  4BBR L; 
#chains in the Genus database with same CATH homology
 4G6B A;  5DM6 1;  1FHM A;  1R0J A;  4AHX A;  5GAG c;  3RZT A;  5JVH 1;  4AI3 A;  2A6E D;  3P2A A;  4U67 1;  1DX8 A;  1YK5 A;  3PZA A;  1S24 A;  1YUZ A;  2JI2 A;  1OWB A;  2PVX A;  1S2Z A;  2RDV A;  1IRO A;  3J7Z 1;  1YK4 A;  3RZ6 A;  2A69 D;  2PSM C;  1B71 A;  4WFN 1;  2O5J D;  1RB9 A;  2XJP A;  3PKJ A;  4AI1 A;  5MFZ A;  1S30 A;  2CR8 A;  4AR5 A;  1VZH A;  2JI1 A;  2JI3 A;  2CKA A;  1CAD A;  1BQ8 A;  3KYV A;  1FHH A;  2V3B B;  4LHN A;  1RDG A;  5RXN A;  4B8C D;  2HR5 A;  1BRF A;  1VCX A;  4AHZ A;  4POF A;  8RXN A;  7RXN A;  3KYY A;  3A44 A;  1T9P A;  2ERS A;  1B2J A;  2VL6 A;  3WWL A;  1IU5 A;  1Z92 B;  3QVD A;  4GS7 D;  3PIO 1;  3LPE B;  2GMG A;  5K2M E;  4YWL A;  1IW7 D;  1T9Q A;  4JAF A;  1VZI A;  3J7Y 1;  2XJQ A;  1H7V A;  3PKI A;  2H12 A;  4ZN1 B;  1RYQ A;  3RYG A;  2PYA A;  2A68 D;  4POG A;  1E8J A;  5IY0 A;  1B13 A;  2QL0 A;  2DSX A;  2XJR A;  3K35 A;  4AHW A;  5MLC 3;  1YV1 A;  4AR4 A;  5GAH c;  2K2D A;  2NYD A;  1LTL A;  2XJT A;  1IU6 A;  1WJV A;  1R0I A;  1R0H A;  4AI0 A;  3NFP I;  4RXN A;  4XXB B;  2V0E A;  3KYU A;  1CAA A;  1SMW A;  2CKC A;  2C6B A;  4K9F A;  4JAG A;  1RWD A;  3PIP 1;  2A6H D;  4ZN3 B;  2J9U B;  5MF6 A;  1SMM A;  5GAE c;  1NXG A;  4AR3 A;  5JVG 1;  2MS3 A;  1OWC A;  1QCV A;  1JYB A;  1NXE A;  2PPT A;  2M6P A;  3SS2 A;  2XJS A;  5EIO C;  5MGN A;  2KKD A;  3IU3 I;  2XJV A;  2XJU A;  4AHY A;  4V19 6;  1C09 A;  3P8B A;  3B0A B;  1T9O A;  5AI3 A;  1B2O A;  3KYW A;  1BQ9 A;  5MFP A;  4JAE A;  3B08 B;  1LKO A;  4E6Y A;  1DVB A;  2V0F A;  4LHL A;  6RXN A;  1BFY A;  1RYT A;  2ZIX A;  3QQC E;  1IRN A;  5EIN C;  4UY8 1;  2M4Y A;  1NNQ A;  3PWF A;  3MSU A;  4TVM A;  1SMU A;  1LKM A;  3VPB E;  1BE7 A;  1QYB A;  3KYX A;  2BE5 D;  2C6A A;  2M4V A;  1RDV A;  2L0Z A;  2PVE A;  2Z3Q B;  3ZG6 A;  4AI2 A;  4ME3 A;  3WWN B;  1ZRP A;  5AN9 H;  1R0F A;  1LKP A;  4JAD A;  3LNL A;  4TPU A;  5H1S c;  1ODH A;  2AYJ A;  4YWM A;  1R0G A;  2KN9 A;  1YUX A;  2ERJ A;  5DM7 1;  1VZG A;  3MPS A;  2LCQ A;  2Z3R B;  2B5I D;  5AI2 A;  5GAD c;  2M6O A;  4XGH A;  4AR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...