1BG6A

Crystal structure of the n-(1-d-carboxylethyl)-l-norvaline dehydrogenase from arthrobacter sp. strain 1c
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
356
structure length
349
Chain Sequence
SKTYAVLGLGNGGHAFAAYLALKGQSVLAWDIDAQRIKEIQDRGAIIAEGPGLAGTAHPDLLTSDIGLAVKDADVILIVVPAIHHASIAANIASYISEGQLIILNPGATGGALEFRKILRENGAPEVTIGETSSMLFTCRSERPGQVTVNAIKGAMDFACLPAAKAGWALEQIGSVLPQYVAVENVLHTSLTNVNAVMHPLPTLLNAARCESGTPFQYYLEGITPSVGSLAEKVDAERIAIAKAFDLNVPSVCEWYPATIYEAVQGNPAYRGIAGPINLNTRYFFEDVSTGLVPLSELGRAVNVPTPLIDAVLDLISSLIDTDFRKEGRTLEKLGLSGLTAAGIRSAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and active site location of N-(1-D-carboxylethyl)-L-norvaline dehydrogenase.
pubmed doi rcsb
source organism Arthrobacter sp.
molecule tags Oxidoreductase
molecule keywords N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
total genus 123
structure length 349
sequence length 356
ec nomenclature ec 1.5.1.28: Opine dehydrogenase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
A PF02558 ApbA Ketopantoate reductase PanE/ApbA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1bg6A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1bg6A01
3UKOA 4XYMA 3B20A 1GY8A 4DQUA 1WDLA 2DFDA 1ENZA 2POQX 3K73O 3KV3O 1NNUA 4L4RA 1IOLA 1PJTA 2OUIA 4CLEA 1ZXBA 1ENYA 2VRCA 4HP8A 3DB2A 4QFDA 2WYWA 3KSDO 5A9RA 3TZQA 1UZNA 1B8UA 1V6AA 3WS7A 3L6OO 4XB2A 3D64A 2HAEA 5ENDA 4P4LA 1LLDA 4GMGA 1GQQA 4YAKA 1QYCA 1R4MB 4RF4A 2DPGA 3D7LA 2DLDA 2AHRA 1Y6JA 2PY6A 1KVSA 4PVDA 2D5CA 1VL0A 3Q9NA 4JX8A 3LT4A 4B4UA 3UUWA 1F17A 2J6IA 2EKPA 1DHTA 2CVZA 2P9EA 5DDIP 1UXIA 4YJHA 1YQDA 3OQ1A 1VL6A 5LDGA 1GFSA 1TEHA 2FN7A 3DR3A 4IDFA 3JD2A 2TMDA 3JQDA 4UVIA 1PJQA 4BO3A 1K6IA 2GERA 2B69A 3AFMA 3K92A 3WSWA 2O4UX 4UUOA 3F5SA 4WNCA 3WBBA 1GUZA 1CIVA 3CH6A 4NU6A 4CLOB 2O7SA 3OETA 1SPXA 3IOYA 1HE2A 2GZ3A 4IQ8A 4RPHA 4D41A 4XIYA 1NWCA 5THKA 4YT4A 1E6UA 2J3IA 2Q99A 4JROA 5A1TA 3FBGA 1XEAA 2C5EA 4DL9A 4JP2A 3ZWMA 3T4EA 4JJGA 4NMHA 1LDBA 1RKXA 2EG9A 1LDEA 2NLOA 1A7AA 2D2IA 1WPQA 3D5QA 1P1JA 4JN6B 3D4NA 3TZHA 1YWGO 4TQGA 1B0AA 4D79A 3NT2A 3STHA 4YAEA 3HFGA 1GADO 3DBVO 1WAMA 3EVTA 3JYNA 5CHEA 3ZDFA 4B7UA 4WK6A 2R00A 3D4OA 1Z75A 4IMRA 3UCXA 1JU9A 4F6CA 3AUUA 1YB1A 1IYZA 2DTEA 1Y9EA 4R1TA 4ZHSA 3GVIA 2BMAA 5JY1A 2V6BA 2QYSA 2FR0A 4RV9A 3OFSA 5AYVA 4FFMA 4DMMA 3RAJA 1PJLA 4OIMA 1U8XX 1PWZA 5H83A 3ZHXA 4IXTA 3NTQA 5EIOA 5A9SA 1SCUA 1N9GA 1O5IA 3IP1A 3IKVA 1YQGA 3M2TA 3PIIA 2Q4BA 2OOSA 1X7GA 2VWHA 4IJKA 3UAGA 3WICA 3JYOA 3WGYA 2IYOA 1T26A 2LDXA 3GFGA 4GH5A 4EEXA 3HWRA 4PZDA 5K6AA 3L4BA 1TI7A 4H3VA 5TIIA 2Y68A 4XQGA 4AJ1A 2B5WA 1W6UA 2OP1A 1M6WA 1RPNA 2Y1EA 3HG7A 4GX0A 2FPGA 3ZU3A 3CEAA 3KSUA 1GV1A 4RJTA 3RJ9A 3UF0A 5BR7A 2H63A 3ETEA 5F1OA 2CVOA 3U4DA 2GZ1A 1AUPA 3KSZO 1HXHA 3VPSA 1ISIA 3RUIA 3ICPA 4JP3A 4TVBA 2P68A 4B8WA 3C24A 3GDGA 5EINA 4A03A 4A10A 3UFXA 2C54A 2OORA 4DMLA 2WEKA 3ZNNA 2ZCVA 1EUCA 4DPLA 3FR7A 3BIOA 4MINA 1P45A 5ADHA 4ZQFA 4JXKA 1HETA 3W4IA 4BVAA 1DAPA 3DBLA 2RBEA 4JJFA 1NHWA 2NU9A 4FFRA 1NR1A 1ZJYA 1NFFA 5FI5A 5JXWA 3WNQA 1BW9B 1RYEA 2RAFA 1LDNA 1H6BA 1DIBA 2H9IA 3C3XA 2BFOA 2JHFA 3U49A 1LSJA 1P1RA 1BDBA 4I5GA 1D8AA 3TQHA 3C1AA 1E3SA 1HRDA 2VZ9A 2B35A 4PIVA 1F8FA 1N9GB 2X22A 3OHSX 4E3ZA 3KYBA 3S2GA 1NBOA 2DBRA 4GKVA 1U7TA 2VUSA 2EW2A 1Y8QA 2X4GA 1QYVA 5KJ6A 3JQ6A 1BHSA 3E5RA 1QYWA 4MOWA 2IXBA 4S3MA 4M49A 5JY6A 4PG5A 3TN7A 4W6ZA 4TKMA 2BD0A 1YJQA 1HEUA 2EEZA 1ZSVA 6LDHA 1TT5B 2HMWA 3UICA 5A02A 2IODA 1DDOA 4CMHA 2EXXA 1X7DA 2WJPA 1YDWA 4BHTA 2QZZA 2O2SA 4YACA 4NBUA 5LC1A 4II3A 3E03A 4WPGA 3WIEA 3IS3A 5DCWA 1PGNA 4IGFA 5ITWA 3T7EA 2VHXA 5F5NA 2DBQA 3DMTC 2AA3A 1HDYA 4E2YA 1OOEA 1KY4A 2LDBA 3N7UA 1XDWA 3O9ZA 4NQZA 5FI3A 5JLAA 1HSOA 1W0CA 5MDHA 3WLFA 4EUEA 2P5YA 3GRPA 4H15A 1C1DB 4CM6A 2NADA 4FB5A 2C2YA 3DHNA 4Q3CA 5F1PA 4M8SA 3ANNA 2VHVA 4HBGA 2RHCA 4K1LA 4BS9A 1DFGA 4CUKA 4QSMA 4WASA 3BMCB 3B70A 3WYBA 2VQ3A 4K28A 2CSUA 4U8GA 3DOCA 3ANMA 2PZLA 3NGLA 2HDHA 1Z7BA 2FZEA 5T57A 1PJ2A 2FZWA 3WMXA 4AFNA 2XF8A 1I2BA 3W6UA 1GEEA 4D43A 1ZK1A 5DZSA 1EMDA 4E30A 1QP8A 1D1TA 4CMKA 4PLTA 1Y8RA 2GASA 4N5MA 4GQAA 4OQYA 4MP3A 4GGOA 4YJHB 3U5TA 3FPCA 2QG4A 3OH8A 2Y0CA 4N7RA 1P1FA 1VC2A 2Y0DA 3I6QA 1SB8A 3QW2A 1N2SA 5GY7A 1OMOA 3HADA 4A7PA 3TJRA 4GGPA 3HJAA 1P1IA 1WZIA 5TGDA 4EBFA 4LRTB 5KJFA 3WFIA 5KJCA 1K0UA 1P77A 3KHUA 3RC9A 5K9ZA 2DT5A 2DTDA 2NU6A 1PWXA 1N5DA 5JMPA 2ET6A 3JD3A 4HFMA 3DZKA 4R51A 4BQRA 1XELA 4Q3BA 2NU8A 2PD4A 5JC8A 1CRWG 4B7CA 3RFXA 3GFBA 3D3WA 4BMSA 2QQ5A 2XXJA 5L95A 3AOGA 4LSMA 1T24A 2PD3A 1FDTA 5JDCC 5K0ZA 1RM5A 1TLTA 4Z0TA 5ITVA 3GMDA 2F00A 3CE6A 4R1UA 4YJDA 1EUZA 3GDOA 5BNTA 1ID1A 1GPDG 4TRNA 1LDYA 2E82A 2JCVA 3GN2A 5I9NA 4I9NA 2GR9A 4GL4A 2W8ZA 5A3JA 3LDHA 3DZFA 5IXSA 1ZMTA 3ZZNA 4I5FA 1VSVA 1PGPA 2BLLA 3AU8A 2I5PO 5A3VA 1A7KA 1I3KA 1C0IA 3FTNA 2AEJA 1A72A 2YJZA 4O59O 2B5VA 1XSEA 2RHRA 1UAGA 5A9SB 3IJRA 1YBAA 4DA9A 3H9JA 4QQRA 5HRUA 5I8ZA 2HMUA 2HSDA 4JGBA 3F6YA 1JVSA 4R01A 4OKIA 1GZ6A 3TFOA 4XQ9A 2X5KO 3LK7A 3L6EA 3PZBA 3EVNA 1P33A 2W2LD 1Q7CA 3BAZA 4OQZA 3DBHA 3RU9A 1N7HA 2QRKA 2WE7A 2ZQYA 3JD0A 4HNHA 3UXYA 4DIFA 3RFVA 5L4LA 2ZKLA 4IXWA 3PDUA 1T25A 2F1KA 3LC7O 4TWRA 4XGIA 4D42A 3VPFA 1XWFA 1XA0A 5HBRA 1U2GA 2FPIA 1MXFA 5FF9A 3QLJA 4UVEA 3PI7A 1YBVA 1HLDA 4TRJA 3WOHA 1A5ZA 3WFJA 5KIAA 3IUSA 3Q11A 1E3LA 3ABIA 4GX1A 1HE5A 5A05A 2HQ1A 3LLVA 4XD2A 1DEHA 3RASA 3RWBA 3GLQA 2UV8A 3JQ9C 2GN6A 2R2GA 4L8VA 4WLVA 3DONA 1ZZEA 4NBTA 3PHGA 1NP3A 5IDYA 1N8KA 3I4CA 4RQUA 2C0CA 5T8KA 1YH3A 3CTVA 5CEJA 3WB9A 1A9ZA 2FHSA 4M55A 1ZKMA 1UDBA 3SC4A 2PGDA 2O3RA 4IDGA 4PCVA 1FDSA 1X7HA 3PHLA 1DC3A 3NGXA 2UUPA 3GNSA 3ZU4A 1ZSYA 5KKCA 2PGJA 3BMQA 4FOSA 5I7EA 1LXCA 2EERA 3D1LA 4LGVA 5JDIA 1MLDA 1NX6A 4R41A 3SBOA 3BTSA 3JYPA 1BRMA 1NAIA 2QW8A 1I5RA 2UYYA 2IXAA 2NTVA 4YYZA 1B14A 4IJWA 5U1PA 3KLMX 5IN4A 5B12A 4XCVA 4PG7A 2B0JA 3P7MA 3JQ7B 3KYCB 3NUGA 3AM3A 4W99A 4E12A 1NHGA 4BNHA 1EDZA 5ILGA 3S1LA 4BB5A 4XJSA 1U3UA 3EMKA 1PGQA 3RQSA 1HWYA 1ORRA 3MJEA 3OECA 1NYTA 2PGLA 2ZB3A 3H6KA 4J16A 4BV8A 4FSHA 1E3IA 3QHAA 4M89A 4XYLA 4FPXA 2X9GA 3GEMA 2NQTA 1PS9A 2D4AA 4TKLA 4D7AA 1K5HA 3NT4A 1QSGA 1NQOA 1RJWA 3ULKA 1X14A 3HDJA 4OMUA 1TB4A 1CJCA 1YBMA 3OA2A 3LQFA 5L7WA 3WYCA 4HKTA 4L0QA 4I9UA 1P3DA 5BNIA 1H6AA 4YT8A 5KVCA 3BMOB 5BT9A 4PG4A 4NFSA 3AOEC 1YXMA 1NPYA 2I3AA 3MZ0A 1LA2A 3OSUA 3VPHA 2HK7A 1VI2A 1PX0A 3R3JA 4J2HA 1TA4A 2V6FA 4CR6A 5EL0A 5JC1A 1CWUA 1KEWA 1X1TA 3M2PA 3PRJA 4XDZA 5JAIA 1HDRA 5JMWA 5KTKA 2DUWA 4PLZA 3VZPA 2ZQZA 4Z3DA 5A03A 2FR8A 2E49A 1V3TA 3INRA 3FN4A 1GPJA 4D3FA 3I9LA 2OBYA 2P9CA 2WD8A 3U3XA 3OICA 1EE2A 1PQWA 3VTZA 1K3TA 3RUEA 4PFJA 4NBRA 1PL6A 4OXNA 4GX2A 4BMVA 2O7QA 4IDCA 5KCZA 2WWRA 1ZEJA 2E6UX 3WDSA 1KEVA 1J5PA 3RIHA 3C8MA 3AUAA 1ADFA 1JA9A 1M2WA 5TRTA 1NVGA 3E1KA 1SOVA 1NTOA 3PYMA 4NBVA 5A5EA 1FJHA 1MP0A 3I83A 1H9BA 1I8TA 2X9VA 1JQBA 1E3WA 3FD8A 2D8AA 1K2WA 3KBOA 1LC0A 4DC0A 4G81A 4DLAA 3DHEA 1ADCA 1JDJA 4OXKA 4YR9A 3W6ZA 3OIDA 2CY0A 4GKBA 2GN9A 4GI2A 1HDGO 5AXBA 5TLSA 3GMSA 2YHUA 4U6QA 3PWKA 1CQJA 3C85A 1VKNA 3CZRA 3M1AA 4LSWA 3ZU2A 2ZJ1A 1YJ8A 4ILKA 1M6HA 4E5YA 4MIYA 4AL4A 4BO1A 1JKJA 4CV1A 4W9NA 5G0WA 2HO5A 3ZH2A 2X0RA 4YAIA 1T2FA 1H2BA 3D3WB 4NZ9A 2X5OA 2Y1CA 3I9KA 4CM1A 3QVTA 1Y5MA 2VT2A 5IDWA 1BVUA 3COSA 3BMOA 3UOGA 5L4SA 2ZTUA 4CM4B 4U0JA 4DYDA 3OJEA 3RROA 1KBZA 2J3HA 3LC1O 3TSCA 5CDSA 5JDIC 1HTBA 1R37A 2DC1A 2VWGA 3IIEA 4OYRA 1E77A 4MP8A 1HYEA 4GVLA 4IQGA 4MVJF 2C59A 4IJUA 2NVUA 2VRBA 3BMCA 3TOZA 5JSFA 2PKQO 1NASA 1UDCA 1J0XO 2IZZA 1LQTA 3WSVA 3F4LA 4YQZA 2X9NA 4BKPA 2B4RO 2CNBA 3PWSA 1JAXA 4DWVA 3WTBA 2PH5A 2VYVA 2X8LA 4MJLA 1DC6A 1IZ0A 4PVCA 5F1KA 1D7OA 2Y66A 4FC7A 4MVJI 4YQYA 4ZRNA 1A27A 1YE3A 4GLOA 1E7YA 2EP5A 4LK3A 3RD5A 2JCXA 3OJOA 4CQLA 4FCCA 4RF5A 2YDYA 1HF3A 1EFLA 4WGGA 1DIGA 4OL9A 2BI8A 1U2DA 4WCFB 5B37A 3DWFA 2X6TA 5JO0A 1LI4A 4OSPA 4HADA 1EK5A 1HDZA 3QJ5A 3L6DA 1E1KA 1MUUA 4D46A 1J6UA 1LLUA 3BTUA 3MJVA 2JFHA 2Z5LA 3R3SA 2X0JA 4BKRA 4E21A 1U28A 1KYQA 4KTTE 3INGA 1Z73A 2PKQP 5CFZA 3EK2A 5G4LA 4LN1A 4ND4A 5DP1A 3ITDA 2O50A 1V8BA 3LSYA 4EUHA 4UUMA 2O48X 1WVGA 3EHEA 4HX5A 3HHPA 5JAQA 1O94A 1U9JA 4JNKA 4BNFA 1Q1NA 3E8XA 2AG5A 2FSSA 2YYYA 1IPFA 3KXDA 1QLHA 1U5AA 2NWQA 4FR5A 1DRWA 1N92A 1SB9A 3C1TA 1N1GA 3TNLA 3RUFA 3SX2A 3U62A 3LU1A 3FWNA 3WQRA 1MA0A 3ETDA 4Z9YA 4KZPA 4LVCA 1CQIA 5L3ZA 1DIRA 4CLRB 3G17A 3PJFA 4CUJA 2O2YA 3K96A 1V9LA 2WTBA 5LDHA 4BNYA 2W2KA 4CLHA 5I7SA 4Z9XA 4IQ0A 4Q39A 4J9VA 1HDXA 2FOIA 3H7AA 4M87A 4NR0A 3SC6A 1KS9A 4PGFA 2BI7A 3JQBC 2ZIZA 2EGHA 3K2BA 4NJMA 1Y8QB 2P2SA 3EC7A 2O3TA 3G1UA 3V1YA 1HYGA 1YL5A 3DMYA 1EK6A 2JL1A 2YV3A 1NQTA 1JVBA 1H5QA 1DJNA 4NK4A 5ILOA 1F06A 4QX6A 2B4TO 2C29D 1LUAA 2NTJA 1WZEA 3VC7A 1YOVB 5CP8A 5F3RA 4ZU3A 3ZV6A 4RPGA 2PWZA 2WYUA 1C1DA 1GYQA 1LLQA 1LU9A 3C7CB 1IUKA 4R3NA 3WMWA 1QV6A 3EUWA 4O1MA 3PIDA 3KETA 4ND3A 3INTA 1F8GA 3OBBA 3JQAA 1JN0A 5JCJD 1E1LA 5L9AA 1LLCA 1ISHA 3Q2KA 5FYDA 3WGGA 2PZMA 4XKJA 1NXQA 2CDCA 4WEOA 3VTFA 1ZJZA 3OEWA 1RM0A 3ZNOA 4RZIA 2NM0A 1I24A 4ZQGA 2ZTMA 3JQFA 4RLSA 4XZ3A 1S7CA 3BTVA 5FWNA 4CMIA 4ND1A 3GG9A 5COQA 2X0IA 2VOJA 5EQFA 4J7CA 4YPOA 4TVOA 3Q1LA 3MWEB 1JLLA 2JAHA 3UN1A 4GLLA 3K31A 4XYBA 3W8FA 1OZAA 1YB5A 5TJ9A 3ROMA 4FFNA 1LSSA 1XHLA 4IIVA 1DIHA 4BO2A 4CQMA 2Z95A 4WLFA 5TX7A 4OXYA 3Q6IA 4ALKA 4FJ0A 3JQCA 1CERA 2W2LA 4YWJA 1SOWA 5DCUA 2Y99A 3G0OA 1D4FA 3P2YA 2J5RA 3AK4A 1DB3A 3OM9A 1XQ6A 3ZNPA 2Q2WA 4O6VA 4IJVA 3BMNB 3FPLA 3I9OA 4J4HA 4WEQA 1NPDA 4AJKA 2R00C 4K26A 1DHRA 1PZGA 4D3DA 4JLWA 4GWGA 2EHDA 1DC4A 4ZGWA 3DAGA 3FWZA 4LRSB 1KERA 3A14A 4EYEA 1SBYA 1KVUA 5IJZA 5KJ1A 3EZLA 1GZ3A 2CD9A 5IF3A 1PTJA 3IJPA 1ADBA 1AHIA 3R1IA 3GEGA 4CMJA 1MB4A 5DT9A 1U3VA 3DC2A 5ENVA 2DBZA 1WXDA 3WGTA 4KTVE 4B4OA 3C7AA 1JKIA 4QXMA 3BHIA 1NPTO 4FOOA 2VOEA 2AE2A 3KYDB 3OJ0A 3V1UA 4E5NA 2HJRA 1MGOA 2VTEA 4BGVA 1SEVA 4WOJA 4XRRA 3ITKA 3WLEA 4CQMD 1ZCJA 4YXFA 5G0SA 3ZWNA 4DREA 3ZV4A 3A4VA 2EF1A 3I6IA 1DSSG 2IRWA 3ZV5A 5IDXA 2ZYGA 2BFPA 3GNQA 2W4QA 3NV9A 4CM7A 3GEDA 1SO8A 4XEHA 1Q2XA 4IS3A 3TDKA 4LCEA 3VH4A 3Q2IA 4J0EA 4H7PA 3PHHA 2I9PA 4BUCA 1EFKA 1J4AA 4XGKA 1V35A 2BGMA 2DTXA 1BG6A 3FCOA 1ONPA 2I66A 5KVVA 1LJ8A 4MKXA 1I3NA 4E2ZA 3WGIA 5J23A 1UP7A 4I9HA 1Q7GA 4J9UE 2CDAA 3IMFA 4JJIA 3ZHBA 3DZHA 3I3OA 3AWDA 3GPDG 5A5FA 2ZTVA 4D0SA 3GG2A 4UEOA 4NNJA 1HDCA 5A04A 1M76A 1NQAO 3CPSA 4MDHA 3RUCA 4P4GA 3D5TA 5B4UA 4DLBA 3ROPA 5T67A 5CDYA 1BVRA 1I30A 2GPTA 1KOLA 2BRUA 3MJSA 4INAA 1KC3A 1R4MA 2EIHA 4EJ6A 3JD4A 1IL0A 3WTCA 3RCBA 4DLLA 3TL3A 3E82A 3WWYA 1GL3A 1ZVMA 2A9FA 1V0JA 1TXGA 1EVJA 5JAZA 2B4QA 2AQHA 3TRIA 4DIBA 5C5IA 3VAZA 4WUVA 3EAGA 4DXHA 1A71A 2DBVO 4AJ2A 5B1YA 2P9GA 3ADPA 1N1EA 3CTMA 4R9SA 3PQFA 4I5DA 2BGKA 4IUYA 1Z45A 2X58A 1E92A 6ADHA 4BGIA 4EI2A 4Q3NA 1RM3A 5JFOA 2Q3EA 3ZN2A 4PZCA 2YUTA 4PLPA 1FF9A 3KLPX 3DL2A 4RCVA 2NQ8A 2YW9A 4DQXA 4Y98A 1YDEA 2UAGA 4PLHA 1DRUA 1ZK4A 4D45A 3KTDA 1R12A 1BMDA 4NFHA 2GSDA 4WCFC 1B15A 3UHAA 1HZJA 4AJOA 4B79A 4BO5A 5ES3A 3IL2A 4Z0HO 2OZPA 5G4KB 2D0IA 3NJ4A 3RBVA 4CL3A 3H3FA 4RVSA 1Q0LA 4BL5A 5JW6A 4E5MA 4P38A 3FI9A 1X0VA 4EGFA 1O6ZA 3AUTA 5BSEA 4OO3A 1YQXA 2B37A 5KVSA 3PHIA 2I67A 3C7DB 2Y1DA 3DTYA 3E9MA 5GMOA 1GUYA 3EYWA 4S1VA 3KEQA 3VZSA 5C7LO 3F1KA 1Y7TA 4ONEA 3W4JA 2BH9A 3OA0A 5TF4A 1AN9A 5MGBA 3L4BC 1OFGA 1T4BA 3AY6A 1R4NB 4Y6PA 4CMIB 3GDFA 1B8VA 1YOVA 5A06A 5A4DA 4CL8A 1PZEA 1AXEA 3BHMA 4WJZA 1E5QA 1Q0QA 4DPKA 4MVJM 4Z6KA 1ML3A 1UJMA 4BNJA 3DAFA 5IZCC 1SZJG 1GCUA 2E37A 1DPGA 1QLJA 1IY8A 1EUDA 4J1QA 2C07A 2VZ0A 4PLFA 4B8ZA 2Q1UA 2YZ7A 3W4KA 1B3BA 5F5LA 4ZD6A 4W9NC 1PL8A 3DZIA 4HY3A 3O8QB 2V6MA 3L07A 3NDIA 4BNGA 4B3JA 3OJLA 3UW3A 2CDBA 4J4BA 4ZJUA 3BMQB 3IC5A 1X13A 1NQ5A 2CZCA 4PG6A 1UZLA 3ZCXA 4R69A 1DXYA 3L0DA 3ONDA 1YKFA 1UH5A 3AI2A 4UREA 4CJXA 1LRKA 9LDTA 2PFGA 3OQ6A 1JKFA 5G4KA 2YV2A 1JW9B 5T6BA 2Q1TA 3KO8A 2B36A 2Q2VA 3CMMA 3IP3A 1UZMA 2QRJA 3PGXA 4OH1A 1UP6A 4CM3A 3G49A 5CAEA 1UXKA 3VZRA 3IKTA 2EJWA 2ZB7A 2IZ1A 3AI3A 3D0OA 4Y67A 4Q3DA 2VYND 4DC1A 4WECA 3PQEA 4GWKA 2PK3A 3IDSA 4JCOA 2QIOA 1HKUA 3B1JA 4P22A 4CM5A 2FSVA 2DVMA 1ENOA 1KVTA 3DFUA 4J3FA 2HLPA 1WMAA 1ARZA 1U4OA 3BMNA 1XU9A 4CMAA 3LF1A 3GQVA 4HXYA 4UVGA 3RJ5A 2Y93A 4ALNA 4Y6SA 3WYEA 4C7JA 1PS0A 1WLYA 4U7WA 1GU7A 2RCYA 1VLLA 2DQ4A 5BQFA 3ASVA 1R4NA 1Z82A 3V2HA 2H5LA 3DXFA 1I3LA 5C3MA 2Q49A 1ZK0A 1XKQA 4Y8VA 1Z6ZA 1T4DA 2ZATA 4FS3A 3MJTA 3M1LA 3O8QA 2Q50A 4Z9FA 3ZU5A 4JBIA 1D3AA 3Q0EA 4AJJA 4R5MA 4I08A 1C3VA 1O8CA 4J1NA 2DKNA 4W82A 3JQGB 3WJ7A 3Q3CA 3ZW9A 4CMCA 2X86A 2RH8A 4E33A 1QYXA 4D3SA 3AW9A 4RF2A 3GGGA 4M1QA 3V2UA 2BF7A 3LT2A 1VSUA 2HJSA 3TZ6A 3CXRA 4U5QA 5L53A 2YHIB 4L75A 3TFQA 3UH1A 3WR5A 3CSDA 1WWKA 3JQAB 4QUKA 3BHJA 4CQMB 3ASUA 4EW6A 3RI3A 3PVZA 1AE1A 2NV6A 3OQBA 3GGPA 4K6FA 2V7PA 1BXGB 4N18A 2V6GA 4BQPA 3HFSA 4E31A 2AE1A 4ZQEA 2DU8A 3LF2A 3VZQA 3DHYA 3PYXA 3PYLA 3ADOA 1D1SA 2HKIA 4IMPA 3W8EA 4GX5A 4CM8B 4LW8A 3SEFA 1PEDA 1V3UA 4YJGB 4RQTA 1HYHA 3GGOA 1AXGA 1LBEA 4TZKA 1WW8A 2AQKA 2NNLD 3WQSB 3DBRA 3ZWYA 2O23A 4P8RA 2E4AA 4M86A 5IFLA 2EKLA 4OSOA 3OIGA 2VWQA 3QP9A 5HM8A 2DAPA 1UUFA 2VTDA 4GSLA 1ISMA 4O0LA 4RGBA 5G0VA 2VCYA 1DFIA 3DBLB 1NFQA 3BTOA 2C7GA 4NG5A 4R4JA 5CG2A 1P9LA 3F1LA 3NEPX 4M54A 1QR6A 2YHIA 4CMEC 4AICA 1I36A 4IPTA 3GVPA 3CIFA 3ONFA 3H9QA 4PLVA 5EESA 1BSVA 5TNXA 5TSDA 1MFPA 4FJ1A 5AQ1A 5JNLA 2ZTLA 1T1RA 2DM6A 2H1SA 2JCYA 2PKRA 5L40A 1PQUA 4MVJP 4E32A 5COAA 1XR3A 4UUNA 4RL6A 1K6XA 1YVEI 2XPCA 5B4TA 2GLXA 2OMEA 1QORA 4N5NA 4CM9A 4BO4A 2VHWA 1ZXLA 2I6TA 2ZK7A 1KVQA 4J6FA 2B83A 3ZHZA 3AOEA 4Q3EA 2NU7A 2Y05A 5AXDA 3A28A 4DYVA 4N5LA 4R16A 5DBIA 1GR0A 4DQVA 1LSOA 3ZWAA 5FEUA 4XA8A 3RC1A 5CEFA 4IDBA 3GY0A 2HRZA 3WIDA 1ADGA 1OBFO 2ZCUA 3ZWCA 4F46A 3DZJA 4KUGA 3FF4A 2ZYDA 2WD7B 4YVFA 3UCEA 3AM4A 1WNTA 3GZNA 2IE0A 4BIIA 2CMDA 4CMGA 1ZSNA 2QYTA 3H5NA 1Y81A 3H9GA 1CDOA 3HN7A 2CUKA 2GYYA 1MX3A 1I2CA 1AHHA 2C7VA 4PZEA 7ADHA 1MG5A 1Y1PA 2WMDA 4HFJA 1PGJA 2WD7A 3PLRA 1VJTA 4GVXA 3ZWVA 1QG6A 4MKRA 2X5JO 4Q3AA 1U5CA 1H93A 2A4KA 3B1KA 4J7XA 4YBZA 3PHJA 8LDHA 1Q0HA 4BO6A 3AI1A 2QRLA 1K6JA 4WOKA 1T2CA 3AY3A 1YL6A 2XOXA 3RSHA 3ANLA 4A26A 1GAEO 2NVBA 2GN4A 3MTJA 1BXZA 4KDEA 5ER6A 5ER9A 1XCBA 4MO2A 2EGGA 4LVUA 1PQPA 4J90A 3A06A 4CUZA 4PG8A 3VKUA 1I3MA 3JCZA 3WBFA 5GZ1A 1B2LA 1W73A 4FFOA 4L74A 3KZVA 2VNSA 2JFGA 4W7IA 1U3TA 4RVGA 4TMFA 1PJCA 4Z3KA 3GHHA 1S6YA 2OXIA 4MPDA 4YB8A 4J91A 4HV4A 3JSAA 1R0LA 5KOIA 3PLNA 3VPXA 5THQA 1E5LA 1ZUD1 2J5KA 3DOOA 2AXQA 1I2ZA 3ENKA 3FBTA 3HZZA 4KOAA 4E2WA 4D44A 1B16A 2WE8A 4CLDA 3EGOA 1X0XA 1ULUA 5I9MA 3ZHYA 5EJ2A 1EEHA 3DEYX 5H82A 5T64A 1HZZA 3F46A 1F0YA 3RKRA 3OJFA 3I23A 1IULA 1EVIA 1NFRA 1JWAB 1C14A 1NR7A 2Q46A 3GUYA 4FQ8A 5IG2A 3A1NA 4HUJA 5COBA 4BNXA 2NTNA 1ISFA 3LC2O 3NDJA 4D0RA 2GZ2A 4BMNA 3MEQA 2Q45A 3GA0A 4IINA 3S2FA 1FMCA 4WKGA 4UUPA 4EDFA 4BNTA 1GEGA 2OHXA 3H4VA 1T2EA 4IS2A 1HDOA 5L45A 2OL4A 3ROQA 9LDBA 1KETA 3AU9A 4QECA 4U0KA 4OKNA 4AJ4A 4O5OA 1NVMB 1UXJA 4ZVVA 4XR9A 1M75A 1G0OA 2GRAA 5AVOA 3SXPA 3TPCA 4TROA 2CFCA 2EJVA 3MWDB 3QVOA 2Q1SA 4MIOA 1SNYA 2A92A 4IIUA 1Y5RA 3GF4A 3KEOA 1YGYA 1CEQA 1ENPA 1GD1O 1BXKA 1E7QA 3A9WA 4CM8A 5TS3A 4G5HA 3FR8A 4EJ0A 5JE8A 1ZK3A 4J2OA 4J1TA 5AXCA 4RVHA 1EQ2A 4TZTA 1C1XA 4CLRA 1FDVA 2PNFA 3JYLA 4NFYA 4JIGA 4OHUA 1B8PA 5C7IO 1GYRA 1U7HA 4FN4A 1H2HA 3HDYA 3PZRA 5B4VA 3SVTA 2BFAA 1XG5A 4YT2A 1PSDA 3C1OA 1L7DA 1KC1A 3H3JA 3NAQA 1FK8A 3U4HA 4BNZA 4W4TA 3DBHB 1L1FA 2DPHA 5GZ6A 2OGUA 3U4CA 1LSUA 3JQ8A 4E0BA 1LDMA 3JQAD 3O03A 2CF6A 4UEJA 1EVZA 4YTEA 3SJ7A 4ND2A 1A4UA 5JO9A 3MJCA 2GF2A 8ADHA 1T1SA 2AW5A 2Y1GA 3JTMA 1B3RA 3ZI0A 4NJMB 5I9LA 4BKOA 5L7TA 2Y0EA 1IHXA 1SC6A 4B4VA 3GC6A 4B3HA 3I1JA 2A94A 3G3EA 4FC6A 2RIRA 2X0NA 4UEKA 2IZ0A 2AEMA 2D1YA 3ORFA 3GR6A 3GAZA 3PFFA 1HSZA 2HMSA 2P4QA 4KQXA 4TSKA 4PLWA 3ZWOA 4MVJA 1PR9A 4TRRA 1M67A 2SCUA 3RUDA 1ZH8A 4XYEA 4ZQBA 4DUPA 5F21A 3GOHA 3GNTA 3V1TC 4B4WA 1HL3A 1XQ1A 1G1AA 3QIVA 1LRJA 4BNKA 5CDGA 1RWBA 1GQYA 1GQ2A 2PLAA 1DO8A 2VZ8A 4QEDA 3WJAA 1I0ZA 1VRWA 3GZ4A 1BWSA 2HRBA 2WM3A 1ZNQO 1BDMA 2JFFA 5JS6A 3QWIA 1ZW1A 1CETA 3TL2A 2Q4EA 1C1XB 2JKVA 1BGVA 3JD1A 3V8BA 3KYDA 2OBNA 5L4NA 3GVHA 2AG8A 2VNAA 4IM7A 5C7OO 3F3SA 4PRLA 1MXHA 4RPLA 1OC2A 3CMCO 1Y8RB 1YB4A 1A9YA 3FNEA 4MIEA 3IUPA 4PN3A 3RUHA 3E5MA 3TWOA 4UAGA 5DBGA 3P2OA 2W90A 2HMTA 4LCJA 2O3UA 4XQCA 1E3EA 5KKAA 4ROSA 5DP2A 3VHRA 4GPD1 4DIOA 1VPDA 2PZJA 4U6SA 1P44A 4WLUA 5BSFA 4DPMA 2QZ9A 4DBZA 4L4XA 4JBHA 2HMVA 1I33A 1P31A 1UP4A 4BNLA 2GCGA 4RDHA 4RZHA 3U9LA 3R0IA 1W8DA 1HLPA 4F3YA 2O3SA 2YFQA 1GYPA 4C4OA 1QV7A 2QX7A 4OGWA 4CQLB 3MJ4A 4KUHA 1G0NA 3W1VA 2P91A 4FDAA 2J8ZA 1DAOA 3F9IA 3HN2A 2J3JA 5KJEA 1BW9A 3WQQA 4J1SA 2FP4A 4RF3A 2NVUB 3GN1A 5EMHA 3PQDA 4W7HA 2ZYAA 4YRAA 3AJRA 1GDHA 4YT5A 4BKQA 1F14A 4XDYA 2A35A 1ZO8A 4CV3A 5CPBA 1W4ZA 4R1SA 4CM4A 1HE4A 2I65A 3I9JA 4IDAA 4FW8A 2EW8A 4FJ2A 4IDDA 4NBWA 3LYLA 4KMSA 4URFA 4UULA 3L77A 3V2GA 4EEZA 1G6KA 3D3EA 4AJLA 3HQ4O 4EZBA 4BO7A 1P0FA 1BTOA 4DRYA 1U3WA 5IN5A 4MVJH 1M66A 3GHYA 2JJYA 3JYQA 4I8XA 4NHEA 2Q2QA 4N54A 4OAQA 3U09A 1SMKA 3DQPA 3ONEA 4FFLA 4XX0A 3FHLA 3QQPA 5IDQA 2W98A 1DLIA 4XWYA 3E18A 1MC5A 5G2OA 1P74A 2O3JA 3EZYA 3SLGA 4BNMA 1GZ4A 3GVXA 4KWIA 4ALIA 1EDOA 4UVHA 4AJEA 2H6EA 3GVCA 4XR4A 2AQ8A 3EDMA 5H81A 1O95A 3H2SA 2ILTA 3MOGA 4RLHA 4Y6RA 1ONOA 1VE9A 2J5QA 3JQBA 5G0UA 4H16A 4J4TA 1O0SA 5DF1A 5EERA 4R1NA 1ISGA 5T8KC 1Z74A 3RFTA 4GSKA 4L73A 4A2CA 2HU2A 5I7VA 1PGOA 1RM4A 1LDGA 3T7CA 2C2XA 2JHGA 2PR2A 4A5OA 1UR5A 3ROKA 1DC5A 1MFZA 3QWHA 1E3WB 4WNIA 5JCJA 3VH2A 1YONA 3KRTA 1H6CA 3NKLA 3QE3A 1LX6A 3DZGA 5L51A 3WNVA 4CMEA 2UVDA 4B7XA 1XYGA 5CPFA 1R66A 5ICSA 2I99A 2YQ5A 4RVFA 1E7WA 3VPGA 5JCXA 2X23A 3FNHA 4G2NA 4DTIA 4WE3A 3HE3A 1H94A 4G65A 1H9AA 3QVXA 1F12A 1N7GA 1MG0A 3RBZA 1DLJA 1JWBB 3I4FA 4QT0A 1TT7A 1GUFA 1JTVA 2Y67A 1EBUA 3UCFA 5DNAA 2CF5A 4KQWA 4J49A 3NYWA 1XU7A 3L9WA 1DRVA 3GAFA 3F5QA 3SJUA 3MCVA 4BNNA 4RDIA 4Z0PA 1KY5A 1SAYA 2Y1FA 3JQGA 2X1HA 3LZ6A 2FMUA 1DIAA 4F45A 3VOSA 2XXBA 3DOJA 3OIFA 1GV0A 4E13A 3OMLA 5CEEA 3NJ8A 2YFHA 3IQDB 2XAAA 4NH4A 2YV1A 3VKVA 1B7GO 1PJSA 5AXAA 5JDCA 5HS4A 5KNLA 2VN8A 3KOUA 4FBGA 2ZB4A 4NJOA 3DFZA 4XIJA 2G1UA 3S8MA 4IZHA 1CYDA 4EUFA 2FRDA 1I32A 4BO0A 3PJGA 3ZWXA 1OC4A 3H5AA 4DGSA 3VDRA 1XIVA 2VRCD 4RO0A 4BO9A 2ZB8A 2EWMA 3NTRA 2DUUA 1PZHA 2G0TA 1EE9A 3HB4X 4L4SA 3UGKA 2FPPA 4LISA 2GNAA 3ZWPA 4BKUA 3CUKA 4IDEA 4X54A 4ALLA 2G76A 4ITUA 2HK8A 3JQEA 1P0CA 3NX4A 3K6JA 2D3TA 2RH4A 1R16A 4ID9A 1EZ4A 1WMBA 4BNVA 3F47A 3L4SO 4F6LA 4KWHA 3HDHA 3KUXA 4J0FA 1IZ9A 1WDMA 3HUDA 3I52A 3S2IA 3GK3A 5LCXA 1WP4A 3HSKA 1EQUA 2VYVD 4ZN6A 3BA1A 4TRMA 4ZRMA 3QSGA 1DBVO 1K89A 1IHYA 1NM5A 3L9XA 2IYPA 3ZW8A 2Z1MA 4JQCA 4HFRA 2DFVA 4BNWA 3QY9A 2AEFA 1SEPA 4YCAA 5BNFA 3WGZA 2C20A 2GUGA 4FGSA 1CF2O 3ZGYA 3GT0A 4YRDA 1JAYA 2PZKA 1J49A 4CR8A 1Q7BA 4AJIA 5TC4A 1B26A 2IDZA 3OP4A 5L7YA 3R6DA 1X1EA 3I5MA 4R68A 3ZNQA 1ZEMA 3N74A 1GCOA 1C0PA 1TT5A 1IPEA 1Z7EA 3ETGA 2GGSA 1YRLA 1E7SA 1OI7A 4MVJG 1KEUA 2FR1A 4IGEA 5AOVA 4CR7A 4GMFA 5TT1A 2Q1WA 5IZCA 1QRRA 2FWMX 4K9DA 4NU5A 4OOFA 4ALJA 2VT3A 2J3KA 1YS4A 4MP6A 1PS8A 5CDUA 2GDZA 2BKAA 3WXBA 4FFPA 3HNPA 5DCYA 4R5HA 3M6IA 3RC7A 4PLYA 3VVBA 1E7MA 2X7HA 3H9EO 3HB5X 1PIWA 3KVOA 3FSRA 3JQ9A 4C7KA 3MTGA 1DFHA 1OAAA 3ENNA 4E5KA 5I7FA 1HE3A 3GPIA 4JBGA 3ZWWA 1H0KA 3KM0A 3F4BA 1IE3A 4FGWA 3LVFO 4K6CA 1E1NA 3PK0A 4YJFB 4ZQHA 2EV9A 3E6AA 1V3VA 2QHXA 3TOXA 3RC2A 4XQEA 1VKOA 2IEBA 1KVRA 2JD1A 4BNUA 3PJEA 4IY1A 2NACA 3ZWBA 3GRKA 4GAEA 1VL8A 4O63O 5DOVA 4QO8A 1NVTA 3I9MA 3N58A 2HUNA 3Q9UA 4NIMA 5GZ3A 4NI5A 1ZIDA 3PJDA 4WLOA 1QXSA 4YJFA 4R9RA 4KUEA 2PD6A 1U1IA 3AUSA 3PXXA 4MVJD 5KWEA 3EW7A 2JD2A 3WG9A 1YL7A 1O89A 3DDNA 3OF2A 2EKQA 1EVYA 1I10A 5KVQA 3BYZA 1R6DA 2JD0A 2P5UA 2WSBA 1FDUA 2PV7A 2O3QA 5DN9A 1WDKA 4HWKA 1ONNA 4KDFA 2YDXA 3H9UA 2WDZA 2BGLA 4XB1A 5TT0A 3SLKA 1H6DA 3K5PA 3RBXA 5JYDA 5T5QA 2FY8A 5BSGA 4L9RA 3PFWO 2G5CA 1T2AA 3H5RA 3UVEA 4R54A 2V65A 1ULSA 1ISJA 1UDAA 2G17A 1KIFA 4LMPA 4CM9D 2I3GA 4CV2A 4BGEA 4LMRA 1E6WA 4FD3A 3OEYA 3TZKA 3O26A 1U8FO 5U4QA 3JV7A 2TMGA 5IZ4A 3WGHA 3H8VA 2JAPA 5IXYA 4CMBA 1DJQA 1O9BA 2D59A 1MC4A 4YRBA 5I8WA 2G82A 4WCFA 4JK3A 2OP0A 4IZIA 1FXSA 2VHZA 2P4HX 4CPDA 4E4YA 3WWZA 1PU2A 3B1FA 3RKUA 4PRKA 3DTTA 5EPOA 4OOEA 2VYNA 2NSDA 3DMTA 3FRJA 3PTZA 3CZMA 3P19A 2HCTA 2Z1NA 4RPJA 3WGQA 1A4IA 3AFNA 3G1TA 3QWAA 2W2KB 4NDNE 3E9QA 1DOHA 4RORA 1IB6A 3ZV3A 5IAAA 4CLOA 3EY4A 1XGKA 3NTOA 4J7UA 1C0KA 1VJ1A 4P4NA 4E6PA 2ZJ0A 2BHLA 3CINA 4WLNA 5U9CA 1ZMOA 2BELA 4RPKA 4B3IA 1L7EA 5CDTA 4KP7A 1ZBQA 2R6JA 3RUAA 5HWSA 4CODB 1LEHA 3CKYA 3RU7A 1E1MA 2I76A 5EN4A 1LTHR 5G0TA 4WCDA 1ZK2A 1R0KA 2WYVA 3NDRA 3AM5A 3DO5A 2GD1O 1P1KA 3S55A 3QV1A 2C82A 4YDRA 1FDWA 4MKZA 3V5NA 4BOYA 1LRLA 1P1HA 4NK5A 3U0BA 3QA9A 4WLEA 4BO8A 1NAHA 5JAMA 3VVCA 3X2EA 2YY7A 3P5SA 1E7RA 4HFNA 1HT0A 1UXHA 4A27A 4NPCA 1E0DA 1GTMA 4Q9NA 3X2FA 3GH3A 3IAHA 2NVWA 1U4SA 3H65A 3QVSA 4GBJA 3T4XA 4A73A 2CVQA 3QWFA 3JQ7A 3ICCA 3KYCA 4XGNA 3S2EA 3VH1A 3HDQA 2BFMA 4BV9A 1E3JA 2C5AA 5FFFA 1PL7A 4QFCA 1MV8A 4CV0A 1VM6A 5CG1A 1NWHA 4RVDA 3PPIA 3FTPA 4PLGA 4II2A 3GUCA 3LLSA 1UXGA 2O4CA 2VHYA 1QKIA 1R0SA 2UUOA 4AVYA 5DULA 7MDHA 4XRGA 1PZFA 3PGJA 4E2XA 1TVEA 5HTOA 3BXXA 1I01A 5ICMA 3U4IA 3I9NA 4E5PA 3JQFC 3K30A 2OO5A 3B6ZA 4QO7A 4OM8A 3H2ZA 2YQ4A 4A0SA 4J43A 5C37A 3K2EA 3LT1A 4BNIA 4ESOA 5HA5A 2AMFA 4ND5A 4EJMA 2PTGA 1UAYA 2D5AA 4L76A 3E48A 1PJ3A 2GN8A 4IBOA 2UDPA 3FNGA 4Y9DA 4ZICA 1LC3A 4DBVO 3MOIA 4YAGA 1X15A 3FNFA 3WX0A 5TQVA 1YO6A 1AGNA 3AY7A 1LQUA 1T2DA 3VDQA 2Y1OA 5JPIA 4I5EA 1PJ4A 2OFPA 4AJPA 3QWBA 4DVJA 4YEDA 1QYDA 3E9NA 3O4RA 2VUUA 4ZA2A 4BGUA 1VJ0A 3TZCA 5K6AC 1KEPA 3NRCA 4OJNA 3GZNB 4YA6A 3G79A 4AJNA 1Y9AA 4BB6A 3PP8A 3BZUA 5DBFA 3ON5A 4XJTA 3PWZA 4QTZA 1LNQA 4RVUA 4CLXA 1XLTA 3PDJA 2VUTA 5TJHA 3JQ8B 3DAPA 4HNGA 3K9QO 4I1IA 3VH3A 4ALMA 1ZFNA 3D4PA 3PEFA 2EP7A 3QRWA 1R15A 2PA3A 4MVJE 3NT5A 5JBIA 3LT0A 3ST7A 1BXGA 2E48A 4AG3A 1RYDA 4UVDA 5JYEA 1QMGA 1EBFA 1PJBA 3DZBA 5A9TA 3WGOA 2HK9A 4FIZA 3O38A 5BSHA 3TF5A 1E6EA 4PLCA 4R3WA 5HS6A 3KB6A 3DBRB 3RVDA 4EITA 2IEDA 3K8ZA 4XYGA 3QVWA 5DOZA 2AQIA 1PR3A 2NUAA 2VWPA 3W8DA 5EQDA 2PH3A 4YJGA 4AJHA 4YAJA 2GO1A 1C0LA
chains in the Genus database with same CATH superfamily
2DQYA 2WJAA 1IN7A 3HUEA 3UKOA 1GY8A 4AF8A 1O3YA 1A88A 1C3OB 2WV9A 4R2IA 1QHYA 2POQX 2OLKA 2ZRFA 3KV3O 1SCQA 3GGCA 3OQIA 4HWRA 4ZU1X 4CT4B 2YWCA 2FFHA 2ZRDA 4NZOA 5FTLA 2PBRA 1ENYA 4OD0A 3WNDA 3DCIA 1BQEA 1ZD3A 2YWEA 5A9RA 5KQMA 3T94A 3QBDA 1P7YA 2AFIA 2PEYA 1J39A 4XB2A 1EEXB 2V3VA 5M34A 2FXIA 3TECE 5ENDA 4P4LA 1EHIA 1LLDA 1CR4A 3TOVA 4YAKA 2W6JD 3EZ7A 2HJVA 4JELA 1R4MB 4RF4A 3OF3A 4TTSA 5EXEA 3UJ9A 1Y6JA 4PVDA 4IHKA 2H8GA 5J2TB 2ZXUA 1I94B 2WQ6A 2MYNA 1F17A 2WTXA 3IX7A 5EFZA 4FMDB 4EGSA 2FCAA 2JI7A 2MDTA 1LVGA 4CI0B 2VQEB 3G5UA 3NH6A 2X5XA 1GFSA 2PPVA 3HKDB 1GGMA 1VLJA 4AURA 3DR3A 1X3LA 5BUSA 1XZCA 2JJQA 2OXEA 1NRXA 3BWXA 4LNHA 5KVAA 4BO3A 1K6IA 2GERA 2QN2A 3AFMA 5BYAA 2GX6A 3WSWA 3RANA 3F5SA 3EDQA 2ZI5A 3WBBA 1GUZA 3EG5A 3EE6A 1HZZC 2LP4Y 3FZQA 5K0FA 2HF7A 3K1YA 4OMDA 1ZCZA 2EZ4A 2CJWB 1SPXA 3ZDZB 4LVNA 1I51A 2AFIE 5AK5A 1NWCA 1DNPA 1R0RE 5D2CA 5THKA 5I4CA 4YT4A 4X97A 4L1KA 1SBIA 3FBGA 4CG2A 4DR1B 4B34A 1KBOA 2KX7A 4I55A 3H5WA 4X8MA 4JJGA 5JR3A 4NMHA 3COZA 3IT3A 1LDBA 2EG9A 2NLOA 2ATEA 2GARA 4BFWA 1VMKA 3U60B 2D2IA 1SIOA 3D5QA 3L6UA 4M4SA 3T1NA 5F23A 4YCSA 2MSEB 1RQXA 4IO1A 4JXZA 4D79A 4CKWA 4PRYA 3C6BA 1PT7A 3STHA 4LKRA 3KD3A 1M7BA 1GADO 2WILA 4PSDA 3EVTA 2L19A 2WU0A 3AUXA 4L5CA 4B7UA 5BW5A 3T3HA 1OBHA 2OD2A 3D02A 3D4OA 1E2EA 1JU9A 4HDAA 3LGXA 3MRVA 1IUOA 3UMCA 1IYZA 2DTEA 4KBFA 4F86A 3TSZA 4EK9A 5HZKA 3G85A 2HBZA 3A3PA 2Y9YA 4ZHSA 2BMAA 2QYSA 2D1FA 2FR0A 2OMKA 2YVKA 1XEFA 3KKKA 1W87A 4RV9A 5IP5A 4DCCA 3ZZTA 1QHEA 3DA8A 1PJLA 4E1AA 2FB9A 1UMKA 2JEOA 2QI9C 2YUIA 3FF1A 4LJ5A 4HTAA 1PWZA 4MO9A 4UMDA 5DHAA 1O97C 1IY2A 5H83A 4F5WA 4Q1CA 5C8YA 1LWNA 2XGOA 4IXTA 5HMMA 4IX1A 4CL2A 1TZMA 1OYOA 2FPMA 3U4MA 1O5IA 1J24A 2ENWA 2X2PA 3IP1A 3F74A 4QUGA 4EELA 3MD0A 3IAS1 5J4KA 2OCXA 2VKTA 4KPEC 3M2TA 3VU9A 1GKYA 2Q4BA 1JU3A 3I5AA 3SX4A 1UPBA 3D8BA 4HAWA 2VH2A 4A8PA 1BROA 3WGYA 4LJAA 4TXNA 1VHLA 5K6AA 2LDXA 3GFGA 4GH5A 1ZQ1A 1WMEA 4KMMA 1BXRB 3H0KA 5DK4A 4H3VA 3RS9A 3SXUB 1DARA 1XMJA 2XUJA 2NO5A 1QNFA 4AZSA 1W6UA 2AOTA 1M6WA 3F2IA 4QTYA 4ENRA 4I1UA 3REOA 1L5OA 1UFOA 2QMYA 3R44A 5D6OA 3UNXA 2TSYB 1X6VA 3GRAA 2JH3A 3KSUA 1GV1A 5AKHA 3WIBA 1ECBA 3ORSA 2W58A 4KO1S 3FWKA 3UF0A 6PFKA 3RT9A 1G5RA 2PKEA 4U4AA 4U7PB 5JAUA 1Y5IA 3FA2A 3O9MA 4HLUA 1E1RD 1UANA 1JG6A 1ZL2A 3ZK9A 3EY9A 3KZKA 3COJA 1CIPA 2X3UA 3E0XA 3IPAA 5CT6A 3VPSA 1RBQA 1DAFA 3IE1A 2R8PA 1ISIA 4ENQA 3TB4A 2VHUA 1K75A 4HNAA 4FR2A 3WDMA 2CNKA 2P68A 1ZIOA 2C00A 2YZNA 3IIMA 4HC4A 1UJBA 4RJJA 5DYGA 4A03A 2OR3A 4A10A 3V7WA 3UUEA 1PAUA 1JJBA 3I28A 5FBWB 1GG5A 4ZJYA 5BWLA 5L3VA 4DPLA 1Z5OA 1SFRA 4KWEA 4MINA 5D5PA 1E1CB 3IPRA 5HCIA 4TWIA 1AVTA 1HETA 4TKUB 4JLAA 5I47A 1DAPA 5LQNA 4YRMA 3VU1A 1N5JA 1ND5A 3U7HB 5CH5A 2NG1A 3EWSA 2PM8A 1N5MA 1H42A 1NLUA 4REQA 4WFIA 3RNOA 1AZSC 3ZQ4A 1YVDA 3TQFA 1P0IA 2G28A 2HSWA 3CE9A 4MNTA 2GEFA 4R2KA 1FFDA 3UTCA 3SHOA 3C3XA 3CNOA 3KTAB 2IPAB 5BVHA 2IUYA 3AZPA 1HOXA 3BK2A 1KQ3A 2GPNA 3TQHA 2Z6UA 2JVIA 3C1AA 1HRDA 5ALLA 2B35A 3BCUA 3SS9X 3WRWA 5BORA 1N9GB 5E9JA 4DJTA 2XEDA 3OU2A 3PFNA 1R6BX 2VNJA 2DBRA 3OKPA 4R1LA 3UWKA 4BX3A 1YZVA 2VDPB 3UT5A 2X4GA 4TUYB 1XU4A 3JQ6A 3I53A 3K0AA 4IX9A 1ECPA 1Z4JA 2R751 2VPTA 3LVBA 4Q34A 1QYWA 3NFYA 2C97A 4S3MA 5MF6A 5GPBA 1G20E 2XCUA 3P27A 2Y3IA 4EYGA 2HEIA 4BZXA 1HG0A 4G1VA 5JHHB 2XUIA 4LCBA 5GV7A 5YASA 3EUFA 2BD0A 1YJQA 2H1WA 3ZJTA 2I6UA 5E0OA 2FW8A 1ZSVA 2JIMA 1TT5B 4ICIA 5EE9A 5A02A 4BB0A 1KAOA 1Q14A 3HXKA 4YLYA 3H75A 5M2QA 1D4ZA 1N0WA 1UWVA 2WWWA 2CXNA 4A3SA 521PA 4CF7A 5IRCD 1RXYA 4G0PA 4JLVA 2NUPA 3KHKA 4DBLE 1DQPA 4BHTA 5FH9A 1E64A 1UPXA 4ZO6A 3L8ZA 2OUKA 5LC1A 4BMOB 4MUGA 4MWSA 4QXQA 4UDXX 5DNCA 4II3A 3E03A 3KVRA 3IS3A 4MKFA 2I91A 2J3QA 5E9AA 1PGNA 2VQ6A 1DQYA 1XZNA 1DCKA 1MPTA 2AG1A 3R0ZA 4HVTA 4B6QA 5LR6A 4ZRDA 4CTKA 3K6SB 2PVSA 4MS3B 5K20A 3LYAA 3GT4A 1D9ZA 3A9CA 2WC1A 3L6RA 1XDWA 1WCWA 3CUSA 5FI3A 5JLAA 1BKDR 1HSOA 2I87A 1TL7C 1X7XA 1NMSA 1CUUA 1MRSA 4TL9A 5CB4A 3FFBA 1PLJA 1YZ3A 1B0PA 1TRKA 2GHRA 3BF7A 2W2OA 3PSAA 4A9AA 1XI2A 4J03A 1NUSA 4CM6A 2NADA 4MB6A 2CXPA 3DHNA 3STTA 3RHZA 4KVFA 1WD5A 1ZW6A 4PEVA 3ZJ4A 4EQZA 2C3MA 4GECA 5CDHA 2RHCA 1CUIA 3AZOA 4UZSA 4X3PA 2V5UA 5B2ZA 1NW7A 2FEMA 4BS9A 2R86A 3C5WP 3BICA 2I29A 2PSFA 4XWKA 4K28A 2HXYA 1E6KA 3NGLA 2HDHA 2BFCB 4JUDX 4ZAWA 2YZGA 2FEXA 3WMXA 1TK9A 1DG1G 4Q82A 4B31A 4C05A 3VU8A 1TUBB 3DOIA 3W6UA 1TZJA 3AUFA 4WVLA 5B7QA 4DRXB 3DFIA 1F2DA 1YR9A 3TCKA 1LTKA 2BBSA 2Y9ZA 4IKPA 4XPIA 1D1TA 1RSZA 1JR6A 1Z4MA 4OJKA 3OP1A 1HEYA 2JGMA 3MGCA 1N8NA 4RZQA 4GGOA 1JHDA 1NYLA 3OH8A 3LDFA 1P1FA 3I6QA 2QW0X 2ZJ6A 3EB9A 4NV0A 5F7OA 3QW2A 4IAOA 4L0MA 4ZANA 3RJZA 1RC8A 3CPHA 1ZONA 3U48A 1O9GA 1OTXA 2JS7A 5LB2A 1TAUA 1WHTB 1QBKC 2PXCA 1VYVA 3RG8A 1NKTA 3GLHA 5DNVA 1XBTA 4BE4A 2B4AA 3E22B 3N2KA 3O4GA 4MKGA 5KYTA 3WFIA 3OESA 4RETA 3KHUA 1ORVA 2BGWA 5HNKA 1EWTA 1PZMA 2NU6A 3MT9A 1PWXA 5HQ3B 3W9SA 3EGXA 1KS2A 2BEJA 3MA0A 4ZYLA 4R51A 3JD3A 2VAXA 4HFMA 4N7JA 5LQJA 5FA5A 4YV7A 5T4BA 3EJWA 4HQRA 2WIAA 1TMGE 4JEHA 2JJ1A 4Q3BA 5JC8A 3LCUA 2O2GA 4B7CA 1C3EA 3ND8A 3RFXA 5KC9A 3ZE7A 1ZR4A 1BH6A 1WXGA 2B82A 2XXJA 1BOOA 3DW1X 2QWXA 4J3NA 4YJ2F 4IEEA 1SG6A 5JDCC 1IY9A 4WK2B 1TLTA 2XI4A 4Z0TA 1W59A 2F00A 4D8YA 4EY6A 1QRUA 3TTVA 4E07A 4M7PA 1EUZA 4XGQA 4HXEB 5BNTA 3HCOA 1U0RA 1YBHA 1VL2A 2J4FA 2YIJA 3DT6A 2I4LA 2QQFA 2RGWA 3DDZX 5IYZF 3ROXA 3U3DA 2GR9A 4KC0A 4N7BA 1OLOA 1ZUNA 4GL4A 1HRKA 2O1SA 4D9NA 3KWLA 4ME6A 3HYLA 3HB9A 3BWVA 1ZMTA 2OYCA 1UDWA 4RWEA 5BRJA 5K8IA 3ZZNA 2QAGB 3AONB 4C4XA 5CCDA 1Q57A 5LXTB 4NY1A 2WJ3A 3EXEA 1I3KA 1JXQA 2C2GA 4KODA 4CRWB 3FTNA 1G2PA 2X6QA 1NURA 4PX2A 2B5VA 1WR8A 3H2GA 3KPJA 3IJRA 4ENVA 3ORHA 2UXBB 1YBAA 4DA9A 3CRVA 5DNDA 3AF1A 5I8ZA 2GJ4A 2RGUA 5LMNB 3VNBA 3F6YA 1O2DA 2XTMA 3A6HA 2X8JA 3EWNA 4R98A 2WF6A 1NVAA 3LK7A 1KQNA 1SVOA 3NHSA 2N47A 3EVNA 4M8KA 5EE3A 2HSJA 2W2LD 3QHPA 4JC4A 3VX4A 3IVGA 1R5BA 1MIHA 2GJAA 3TSAA 4YP1A 4F4DA 1N7HA 5CITA 4DIFA 1FLVA 5E2IA 3O0TA 4K9MA 3DVRX 3RFVA 1N6IA 2ZKLA 4QEKA 5JNRA 4TWRA 1J00A 2VDVE 3E22A 3LC7O 4ZKEA 4D42A 5T7BA 3VPFA 1KAEA 1BQ4A 1SVWA 2XTAA 4AMGA 4BKMA 3VPAA 1MXFA 1QYIA 2O0JA 3KAQA 5ALJA 1FSFA 5FF9A 4CEHA 3GH1A 5AI9A 5FTKA 4IWNA 4BDTA 3GJXC 2ZOSA 4NDZA 3CF0A 1RC0A 3WFJA 3AEQB 2A5LA 3DDCA 5KIAA 3Q11A 1E3LA 4MRMB 1E2GA 4U2DA 3VVMA 4B6OA 5A05A 3AR5A 2HJGA 4MUBA 4YDSA 3O90A 4LKOA 5GONA 3H18A 1K08A 3O6VA 1MAUA 4XD2A 1DEHA 2BT4A 3L93A 2UV8A 4R8RA 4TKUA 1GPWB 1EAYA 3FB4A 1HDEA 2R2GA 4WLVA 4DANA 2RGXA 1EFPA 2LWIA 4O4HB 3PHGA 4OCZA 5CB8A 2VT7A 3TUIC 3NRBA 4RQUA 2C0CA 4G8DA 1EK1A 3HYNA 4LJKA 8OHMA 1A9ZA 4PTZA 2O20A 4M55A 4KGZA 4Y2PA 4ZCPA 3H83A 4ZVTA 4RKFA 2F3SA 4NQRA 1FDSA 1P4JA 4R1MA 3CRMA 3RT7A 3WLNA 2RI1A 1JV2B 1VI5A 1FFAA 3RYHB 1S8FA 2AXEA 2UUPA 5BVGB 3ZU4A 1MB9A 1XF9A 5HX7A 2C9ZA 2FX3A 2JARA 3AESB 4G4JA 2GXQA 4MYSA 5H3LA 1Y1KE 3TIIA 4F1KA 4N5IX 3TPFA 3TUZC 1K6MA 3MHPA 3HP7A 1RTTA 3MSCA 4LGVA 4QOSA 3WL5A 4OA5A 4RLFA 5THXA 3S3TA 3HYTA 4AM8A 4TN1A 1FVOA 3BTSA 2VFAA 3MRTA 3RT1A 1NAIA 2QW8A 4B6FA 3G2QA 4YJ3F 4RH1A 4PPGA 4B17A 1I5RA 4EYQA 5LNK6 1RYHA 4G2TA 5AESA 5KC8A 4BX9A 3SR3A 2JH8A 1DT5A 2NTVA 4QRIA 2X8WA 4IJWA 5BSRA 5U1PA 5HJ5A 4G25A 4JMLA 1RKVA 4CCWA 4XCVA 2QTLA 4QOGA 2GD2A 5L6MB 3R9XB 3L8GA 1GPKA 3RFCA 5KOJA 3NHUA 4NZNA 3VR4H 1H4SA 4R8LA 3BGOS 3OCUA 1RYFA 5KAMA 1NHGA 1UXOA 4Q9IA 1HFEL 3R0XA 3U80A 1VKZA 4DJJA 1SIBE 1ZLXA 2J33A 4TMYA 1XTKA 1A5BB 2P79A 1GHTA 2QR3A 4V0NA 3WLKX 1U3UA 3EIQA 2OQRA 2XQKA 4ZYZA 1D6SA 1C8LA 1HWYA 3RBAA 1TCCA 5A4JA 2IDKA 3WLHA 5KHAA 1EB9A 1ZOPA 1Q0SA 3EZFA 4FWTA 2GK4A 2ZB3A 2BGIA 2IBMA 3HP1A 4ZT7A 1XVLA 2ZRLA 4EMTA 2ZWMA 4EY7A 4TMWA 3GAMA 1NVWQ 4XYLA 4ESEA 2GT1A 1QFZA 3TB6A 1A7UA 3GEMA 3MFQA 4JJ8A 4GP9A 2NQTA 4LF7B 4NONA 2D4AA 2P62A 2D54A 4G5YA 1AV7A 1QCCA 4JDUA 2ID9A 2Q7XA 4EB0A 3ELYA 4X64B 4KSCA 3EX7C 4WSOA 1KZ7B 1T6YA 2Q9AA 3CNEA 1YDHA 4A92A 1K8ZB 6REQB 5A0TA 4Y6OA 2PZGA 2QIPA 1IZ7A 2R48A 3L7JA 4HKTA 4L0QA 4PV7A 1KXJA 2FN4A 4I9UA 4P2GA 4RK0A 4HWOA 1ODSA 4NFSA 3RSLA 2RKOA 1NPYA 3O0DA 4UEWA 2A9QA 1VI2A 2ZRMA 3CM0A 1TZBA 4QPPA 4CR6A 3UIEA 1MJNA 1KA9H 1CWUA 1X1TA 1YQTA 2OC4A 3OI7A 2D2FA 2P78A 3FBWA 3QELB 4YFYA 3D8HA 3PQ6A 4PLZA 2ZWOA 5EJGA 4OJMX 4D6YA 5KTKA 2FW6A 3EXHB 4X66B 4Z3DA 3S70A 2AFIB 3IHKA 4AXBA 1V3TA 3BFKA 4Y2TA 2M9MA 1GPJA 1ZD4A 2JIZD 4HYTA 4OQQA 3VAAA 5G3YA 1J8FA 1PT9A 4AMVA 1FP4A 4P08A 4HQ0A 2IWRA 3ASZA 3RUEA 3G9TA 4B9AA 1VZ3A 1QONA 821PA 4HNQA 3TEFA 4OXNA 4GMHA 4GU5A 1TKRA 2PE5A 1G59A 4BN4A 1U0FA 5IAOA 4JNCA 1SKYE 1AUOA 5CK5A 2DWUA 4S24A 1ZM9A 2E6UX 4Q7KA 5I48A 3WDSA 2Q5EA 4FFVA 2E4ZA 1OI2A 1L5RA 1WPGA 2FVYA 5FXMA 2NU9B 1XV5A 5H59A 3GLHE 4QD3A 5TRTA 2FI1A 1NVGA 4M9RA 4TYMA 5CJJA 1AUXA 1HOTA 1SOVA 5A7HA 4CLRA 2ZWVA 1NTOA 3KSMA 3SF8B 4EUSA 3PX7A 1TFUA 1MP0A 2WIDA 4JI7B 3DMHA 1Z37A 4OJYA 3TBHA 5K7SA 4OFXA 1E3QA 3KBOA 2WU3A 3H8SA 3HU2A 4DC0A 3FGNA 4KN6A 1UJCA 3DHEA 1ADCA 1JDJA 1ZISA 4OXKA 4RTLA 3W6ZA 4DJEC 4HS4A 2A5YB 3OIDA 1INLA 2XDAA 4HGOA 3ELUA 3SICE 1QGED 1XNHA 1U9CA 4GI2A 1IBRA 4P3PA 5BV1A 4JC5A 1FYFA 2WJ4A 3KKNA 3ML1A 4U6QA 1CQJA 1PUJA 5JPDA 2A1UB 1MX5A 4M1WA 4ILKA 4DV5B 4WXMA 3G0DA 1AMNA 1KTVA 4DCJA 4E5YA 3B85A 5FLYA 1L5HA 3CLRC 4I3FA 3CVUA 3ONVA 2HM7A 4YAIA 1T2FA 1H2BA 2OV3A 5B1EA 3D3WB 3KB1A 4RTKA 1NBMD 4NZ9A 1CY7A 3I9KA 3VKGA 2PEZA 3QVTA 2GZHA 2VT2A 1BVUA 2JFPA 4OTZA 4EUFA 5IDWA 4ZTUB 2R84A 4H0FA 5JNTA 2ZTUA 1PR2A 4TT3D 3I1IA 2HH9A 1TVMA 1KBZA 2J3HA 1VYUA 3HUFA 4HXFB 4PO1A 3EGIA 1U2EA 1Z18A 2XXAA 3QEMB 3QH4A 1MEOA 3QJYA 2BSQA 2GBPA 2V54A 3P96A 1QCZA 2QVGA 4JCCA 3W1WA 4IJUA 3TMAA 1BKYA 5LA6B 3PX2A 1XTVA 3HNOA 3P9XA 2DHDA 1TM1E 4C4SA 1LQTA 3PHBE 5A3SA 4D5EA 1GNTA 3F4LA 1UWKA 6Q21A 1THGA 1K5GA 4N5HX 2P9BA 4I1VA 3F3YA 3QE4A 1HURA 1XZGA 2R8YA 3Q85A 3B8HA 1NVUQ 1GIAA 1UBFA 2XUAA 4CG3A 1J0DA 1P1BA 4MJLA 2XCLA 1CK4A 2PDAA 3FPHA 1KI9A 4FC7A 1ZZGA 2VLBA 4GRAA 5G1PA 3VFDA 3EHDA 3NRJA 3NCTA 1TW2A 3HLKA 4I1YA 4WXYB 3SBEA 2F1IA 2XUQA 2AWOA 1NL3A 3MWFA 4WGGA 1U2DA 3FCEA 4RWZA 1FX0B 1WTAA 4TWZA 2FKAA 2I6GA 5KX5A 2TMYA 1DT3A 1SCAA 1YBFA 3EOZA 4OSPA 4X3OA 1HDZA 3WJAA 3QJ5A 2I80A 3IVXA 3VR0A 1E1KA 3ZTYA 3BCSA 5LBIA 1NQUA 4PQFA 3AL0C 3MJVA 2HV9A 2JFHA 4US0R 2YZKA 1QDLB 3AR9A 4X00A 2JLAA 1QANA 2F4NA 4KTTE 1VFNA 3INGA 4PCUA 5EGNA 3WBKA 4TWAA 2WIJA 1PVVA 3MINA 9ATCA 1N6NA 4WDQA 4K2AA 5FNVB 2PT9A 5FLEX 1QIGA 1JG3A 4G97A 1XTQA 1KGDA 3CT4A 1PP4A 1XZPA 2BBOA 4GD3Q 1M2JA 4RJ2A 3RTAA 2ZSAA 4BNFA 3E8XA 2FSSA 2P27A 1IPFA 3MBKA 3OTIA 1PI3A 2JF0A 4Y2QA 3SMVA 1AKRA 1DRWA 2J30A 3ZHRA 1OR8A 2JDID 2WKQA 3UHOA 5EKDA 2NX2A 3SX2A 2RHBA 1W94A 1R3UA 3AR6A 4ZVNA 3JR3A 1NMEA 3U62A 4K40A 1GFIA 1MA0A 5CFOA 3QMWA 1KIMA 2Q5LA 1AX9A 4HWPA 4L5AA 4EL5A 4NCNA 4CKYA 3KU1A 5L3ZA 4D4MA 4EZEA 5MN6A 1NLMA 3PJFA 1QIEA 1TECE 1V9LA 4AMZA 3IP5A 4CEIB 3LO8A 1NX9A 1GGHA 3PIRA 6YASA 2PL3A 3V4RA 2GZSA 2W2KA 2XHEA 2EFYA 1ZI9A 1K8QA 1EJ2A 1YE5A 3BXGA 4IQ0A 1JHXA 3K2IA 5DBOA 5BV0A 2PVCA 4QTXA 2FOIA 3KOWA 2LCIA 3CX8A 3H7AA 2VF5X 3GT3A 3OAAA 4M87A 5EVCA 4WN9B 5DCLA 5AW7A 2JG3A 4A2WA 3SC6A 1L5YA 2HMAA 1STOA 4PGFA 5F33A 3AH8A 4O33A 1UIRA 3V7YA 1Y8QB 3THXB 1UZUA 1P7PA 3G1UA 3BSWA 2YY5A 3JATB 1H2ZA 3WADA 3Q88A 1YL5A 5EMKA 3M34A 3ZCUA 3PC3A 1AA9A 3KLBA 1GQSA 3R5HA 3SX0A 2CXXA 4BBPA 4JI5B 3F9RA 3KQPA 2BMEA 3GFFA 3M6VA 5CP8A 2MSCB 1ABFA 2ZJZA 3L0OA 4D82A 2RHOA 2YHSA 3E3OA 3L1UA 5I6DA 2RCNA 3B3JA 2XVYA 4LQLA 1QAQA 2BFBB 4UOQA 3WLPA 5TE9A 3FI0A 2XA9A 2ZE8A 3AG5A 1XZ8A 4ZXFA 2ATXA 2Z30A 2YWXA 4PCAA 2C9DA 1AO0A 1Y4ZA 1QV6A 1YS1X 3PIDA 5FO0A 1A2BA 2X8JB 1XTBA 4JC8A 4IP0A 4LQCA 2XMGA 2VJNA 1LH0A 3TQQA 5JQGF 3FE2A 3P71T 1F0KA 4MQFB 1MENA 5KTPA 3D9QX 2CV2A 4NXNB 2QD3A 1KOJA 2PZMA 1QGAA 2M2IA 2XLBA 2AN9A 2H1IA 4KLAA 3VTFA 4CKZA 1E98A 1YZGA 1RM0A 2ZWPA 4KO4S 1AXRA 5KU7A 2ZJ4A 2V6JA 2EX1A 1C29B 1FMLA 2WSSD 2H3EA 3JQFA 4FYKA 4XZ3A 4HDKA 3SS7X 4CMIA 5GADl 1B6RA 4BV3A 1T0UA 2Z6QA 1E32A 2RBKA 5FO1A 5FUYA 3H16A 2NYRA 3AEXA 1E9DA 3Q1LA 1QQTA 4OHYA 5FYQA 2A0UA 3NHLA 3OO1A 2ZBGA 4OBEA 1L3CA 3K31A 4GLLA 3W8FA 1DEOA 1JHQA 5D6NA 5LWQA 3R4VA 5DWDA 1WHSB 1YB5A 2DLNA 3DKPA 4M1KA 5TJ9A 3N2EA 3ROMA 4B32A 5JJBA 4EVRA 1QZZA 2OZKA 4BO2A 2KBEA 1KEZA 2H59A 3EIWA 3NV7A 4PF1A 4WLFA 5TX7A 4F3NA 1X87A 4OXYA 5K6TA 3Q6IA 4OAPA 4GXNA 4FJ0A 3SCZA 4E5SA 1CERA 4YWJA 2HJWA 1SOWA 4Q01A 4W5QA 4QE3A 4MHTA 3B1XA 1ODCA 1NQWA 3LKZA 5EXPA 4ERXA 2WZCA 2FFRA 4TTJA 1D4FA 4C0SA 5LPNA 1ZCAA 4DMMA 2R0QC 2J5RA 2V7UA 1DB3A 4JUCA 2BR4A 4ASUD 1E4EB 3KOMA 4IJVA 3BMNB 2PQ2A 3OO0A 1LW6E 2H3HA 3H42B 1G6OA 2IFTA 3LD9A 4DB4A 1RAAA 4K26A 1KFKB 1U0GA 4JLWA 3UBTA 1PFUA 5BOSB 2NU6B 3MAAC 3I62A 1V7QA 3RR2A 4UM7A 1KVUA 2GEUA 3IUNA 3NBQA 4MV8A 3EZLA 3DV9A 2G70A 3QKIA 4L95C 2CD9A 1RJ9A 3BXHA 2NPIA 2ZRQA 4UW9A 2ECOA 3H1FA 2NU8B 2ATCA 4BVJA 3TGLA 3ZEIA 1P9OA 3GJYA 1YULA 3LZDA 4RULA 4TYWA 3AERA 4XM1A 5AI5A 1XWWA 2O8VA 5DNUA 1J2TA 1YZHA 3K16A 4CDGA 2HWXA 2H57A 5HJ2A 5JBQA 3O3MB 2GKGA 4Y2HA 3UAWA 1G291 1QH9A 1XMSA 4KB5A 3ILSA 3BFPA 4KU4A 5K3CA 3T52A 3UWDA 5LZ2A 1UPCA 1XX6A 3HXPA 2I2DA 5KDLA 2HNKA 3UBMA 3V1UA 1NPTO 2F17A 4E5NA 3D5EA 3KYDB 1COZA 4M9SA 2FMXA 1GP2A 5CM9C 4QLAA 2KBFA 2VTEA 3ZZ1A 1W47A 1VBFA 2BMVA 2NTYC 4WOJA 4RTQA 2IIBA 2KLBA 1QH1B 1ZCJA 4D02A 1SVLA 2W0MA 2XZPA 2FUNB 2P6OA 4OPMA 2RAPA 1XMOB 1VPEA 4CEJA 4BFSA 2IRWA 2PKXA 3WP0A 3ZV5A 4L8WB 5BP7A 3GNQA 3PQ5A 2G63A 1L6IA 4CM7A 4PHHA 3TDKA 5JJCA 4LCEA 2GBGA 2QGNA 1IRIA 4J0EA 4IICA 4XPIB 1I3CA 1X7ZB 3G9UA 1EFKA 1MA3A 1PW5A 2ZZNA 4B6PA 5JH7F 3ADCA 1BG6A 1LJ8A 5EJIA 1M0TA 3OWXA 3V6MA 2WSSA 4XWOA 5J23A 3WGIA 4J9UE 4M1SA 3IMFA 1DS6A 4WMLA 2AVDA 4JJIA 3DZHA 1GKKA 1NULA 4PU0A 4P4SA 4Q3OA 1I5OA 2PANA 2RG1A 3AWDA 3GPDG 1JHZA 1RQLA 2ZTVA 3QK7A 1VG8A 1FNBA 2H2DA 5A5FA 3GG2A 5DV9A 5CA1F 5CD1A 4JI0B 3JALA 1A96A 1NQAO 2CL6X 2IX9A 3ZIUA 3MS2A 1W0JA 4H7KA 4QXPA 1R6VA 3FVQA 2C96A 4OI0A 1GUAA 1MHPA 4FWBA 4Q0MA 3CLTC 3JRWA 1G5TA 1V9SA 2CBGA 4PZ0A 1KOLA 4LBVA 4J0HA 3VC3A 5ADVA 1Z8DA 1EFHA 4DLLA 3LW8A 5CFLA 3AUKA 4KG7A 4DWOA 2BCGY 2A7XA 1A82A 2BW0A 1ZVMA 4RGYA 1P1CA 1R0YA 1TXGA 5E95A 1FXWA 3V8MA 5H3HA 1DWQA 1ZESA 3OQPA 3VAZA 3DJYA 1U7OA 4WUVA 5C5IA 2XCIA 5P8WA 3R7LA 1O03A 1E6MA 1HE8B 1SKUA 4AJ2A 4YRNA 5B1YA 7YASA 1VLZA 3H2BA 1XAJA 1VCNA 5ALNA 4D74A 5DTQA 2QVBA 4PINA 4Y2GA 1H2EA 5M29A 4I5DA 2H1RA 4H3SA 2X58A 1E92A 1RHKA 1RI5A 1V4VA 2D1QA 5AH0A 2FRDC 4Z5XA 1VKRA 4BGIA 1P8JA 2QTVB 2ZLBA 1Y8AA 1M10A 5LOVF 3INYA 4YCNA 3IDZA 2YUTA 2FJPA 2J6BA 3ZDYB 1FF9A 3PFGA 3KLPX 5JS1A 2ZETA 4C89A 1Y9ZA 4RACA 3S29A 4DQXA 3BT7A 3K5IA 4Y98A 4G0YA 2XRYA 1DRUA 4X8LA 1W2HA 3M6LA 1BHQ1 3S5JA 5IAGA 3A10A 3VSAA 2Q6TA 3KTDA 3IJEB 3LRPA 4NFHA 3UHAA 3WI7A 2IOFK 5J2UF 4AZTA 3P0FA 5A7GA 3IL2A 1IIRA 2HGSA 3K6KA 2ZULA 1XCLA 4ZVLA 4RL4A 1KHHA 5G4KB 3L41A 4Q12A 1NYQA 5TARA 1Q0PA 1S4MA 1PFVA 3BB3A 3HC7A 3RBVA 2WJVA 4CL3A 3SHTA 4RVSA 4BP3A 1IQ0A 5CT4A 5JW6A 1RJGA 1MD9A 3ACDA 4JB3A 1DKOA 3I8OA 4N0PA 2PL9A 5AVJA 1O6ZA 1R3DA 4EGFA 3FYUC 4CM5A 4EG4A 2I67A 5C2JB 5KVSA 1W29A 2PL5A 1RBYA 3E9MA 4FCTA 3EEOA 3SFZA 3JU3A 4DV0B 3WGNA 2IOYA 2VDOB 4OLBA 4L9WA 1XZMA 3C5EA 2VK1A 3ZW7A 4C0WA 1QH0A 2A7QA 2BHRA 1Y7TA 1UFRA 4ONEA 2QT9A 1ZKDA 5TF4A 1KDOA 1HFKA 1AN9A 1CXZA 2AFRA 1OU4A 2GCPA 2UZAA 3DMPA 3L4BC 2QD1A 4V2UA 2INGX 1X80B 2YNMC 3LNCA 3U3OA 4D8VA 5HKOA 5LIRA 4DUZB 1P5JA 3OTHA 3WKDA 4CMIB 3D8NA 5A06A 5F77A 5HUHA 3HACA 4C7MA 5IC4A 2CE2X 4FYWA 1RTKA 2TECE 1Q0QA 2XZOA 1OLUB 3PXBA 2QV0A 1UJMA 3N53A 1YU6A 5EPUA 4RJIA 1BX3A 3E9ZA 1Q20A 1GCUA 5DHSA 4PLFA 3D6JA 4RTJA 3K5HA 1NY6A 5BVHB 4PHFA 3W2TA 1OT3A 2X14A 4L16A 1N4DA 1M6VA 2Y1KA 3E3LA 3Q3JB 1PL8A 3V8RA 3ZJYA 5IVPA 2AV6A 5JQGB 2FSVC 2V6MA 3BCHA 3NDIA 2ZE5A 3LSTA 1CQXA 2PQMA 4XIIA 4B3JA 4OHPA 3OJLA 4DSZA 1L7QA 1U2TA 4K03A 4C29A 4G8JA 4CCYA 3B1VA 1FXWF 2MMGA 1N0VC 1Y4SA 2ZVJA 4GXQA 2J46A 5GOZA 1NQ5A 3FW1A 3G82C 4QOIA 3M9LA 4C76A 1QVZA 4I1RA 4PAMA 3OU7A 2MSKA 1L9XA 1LPPA 2W7TA 3D6UA 3RIXA 5C4GB 1QRTA 5FA8A 1QK4A 2H4HA 2PFGA 1RWOA 1JKFA 1DUIA 2YC2C 3BDIA 3OQ6A 4G07A 1HQYE 5U4XA 4HEHA 3HR4A 3R8CA 1EX9A 2O19A 4DSAA 1ZJWA 2AF3C 3CCFA 3V4ZA 4PQGA 1UZMA 5LMCA 3PCRB 3QLUC 1Y3CE 4AO8A 4MSUA 1EVEA 3G49A 2AN5A 1UXKA 4HAOA 5EP4A 4M0DA 3VZRA 4C3UA 3LL7A 2EBWA 2IHKA 3DXXA 1ODJA 2XKAA 2IUUA 2D1RA 1C9EA 1MABB 3ZXIA 5CNIA 4DC1A 3V1NA 4GWKA 4YJ2B 3WL4A 3IDSA 3B1JA 4NKRA 2ORED 4HYYA 4P22A 1QJ4A 5HIJA 3W8NA 1ENOA 1DX4A 3Q2OA 2OGZA 1XO1A 3HSSA 4J3FA 2HDOA 1DV2A 2JGJA 1WMAA 1T9GS 1O9HA 1TM7E 3ZLUA 2WHRA 4F5YA 3ZVKA 3DDHA 1WUHS 2G06A 4LHEA 1DOAA 3RVMA 3AHDA 3LF1A 4OHBA 1BGXT 1P75A 4JZYA 3RJ5A 3WO0A 2Y93A 3GYBA 3WYEA 4ALNA 3WHPA 1EDBA 4HQFA 1PS0A 1RKBA 1UIMA 1GU7A 2GK6A 4OK5A 4OU4A 3PKJA 4HS9A 4KIFA 1VLLA 2H7VA 4PR0A 3UZUA 3ZD9A 3MWJA 2DQ4A 1RYYA 3D59A 5REQA 2J3DA 4H59A 4HGPA 3DVLA 3L8CA 5CVCA 5EOVA 2PUFA 2H5LA 3I2HA 3G0HA 4F92B 3DXFA 4U8HA 3O4HA 2Q49A 2QN7A 5EGSA 5KDDA 1GPAA 3IAEA 4H1TA 4FW9A 1A8HA 4FX2A 3LWNA 1TCVA 4LNAA 4Z9FA 2WM8A 1JEYA 2ZIGA 4G9EA 2FP4B 3KJNA 3B3QA 4H7IA 1JEEA 4PFQA 2FPSA 2ZUBA 4R5MA 4ZPXA 2CLDX 5A4AA 2C9CA 4J1NA 1U0JA 3EISA 5CUQA 4G1BA 3P4XA 3JQGB 4IHJF 1YR2A 3FYUA 4POAA 4YY3B 3GEIA 2WICA 2WIKA 2WT9A 4MPRA 2J7PA 4CMCA 2BGTA 1TYCA 1AQLA 1T5IA 2JBAB 1O5OA 3HSYA 3LC0A 4KW7A 5JS2A 1KPIA 1KP9A 1M33A 3DHWC 3I9V6 3K9BA 3LY7A 2ADMA 3OE7D 4RFLA 5L53A 1PFGA 1Z4OA 3TAXA 3GOQA 4RJKA 3TFQA 3UH1A 1G2OA 1QGZA 4QUKA 3DVSX 2V03A 3WLTA 2G1KA 4Q7LA 3VNAA 4CQMB 1BU8A 1PDVA 1G8FA 4XSVA 2WIBA 4KFCA 4KR3A 4XCQA 3GGPA 3OY7A 5I9IA 5BW4A 9GPBA 2QRPA 1LW7A 1N1DA 3LUGA 2V6GA 5AM5A 3RTCA 3TW6A 4BQPA 3ZGNA 3A6LA 3LS2A 5AI4A 4EH1A 4ZQEA 2PCJA 5IDVA 3V4LA 2PLWA 4OP2A 2FN3A 3VZQA 3PYXA 4ILEA 4OQNA 2CXQA 2H7YA 2QZJA 4YR7A 4W5WA 1D1SA 2BJVA 2HKIA 4NRDA 1L7OA 3OPMA 4TQAA 3EULA 4UNSA 5AHXA 3MUOA 4CM8B 1FZQA 4BN0A 1L5QA 1P8AA 4LW8A 5B57C 1PWYE 3AXTA 1YE8A 3SEFA 4HAYA 1PEDA 5JYCA 1JUDA 1V3UA 221PA 2ILVA 1HYHA 3A0RB 3ROEA 2JLCA 3EDOA 3MD9A 4TZKA 1N2ZA 2FAXA 1WW8A 1R8XA 2AQKA 3RVBA 2Q3CA 3UKJA 2J85A 4O29A 3I45A 4F85A 4ZYXA 5HKBA 1E2BA 5SYNA 5BN5A 4HNTA 4CU5A 1U04A 3NG1A 4UJ3A 2EKLA 1K6EA 3QP9A 1OAOA 2VWQA 4TL6A 5HM8A 3S2YA 4GL2A 4YV0A 1C3LA 3E2IA 4LJ4A 1F7UA 4O0LA 3WP1B 2IY7A 2VCYA 1DFIA 3Q40A 4NEHB 2R1UA 2OBLA 3BTOA 3OOEA 2ES4A 3HI6A 3MUNA 3QBVA 2B8NA 1XDGA 2Q6VA 3N0WA 4K8RB 4DJFC 4NG5A 4R4JA 5AJXA 4DCOA 3UKDA 3F1LA 4G5GA 4M46A 4O2BA 4F2PA 4M54A 1VB3A 4CMEC 3KT8A 4FWIB 4PGGA 4P32A 1I36A 4KL8S 4TKZA 5TNXA 3T5GA 1BSVA 1MFPA 2H1SA 2I7DA 2QA5A 1LK0A 2CNWD 4RCYA 4X92A 2FVXA 2QLTA 4NICA 2IC5A 3NTXA 5COAA 2OV2A 3K70B 1I3OA 1QFYA 1QDUA 3AFIA 1OGYA 1YI0A 1V1JA 1NRIA 1X8JA 3A6KA 3F7NA 4UUNA 1Z0DA 3OM8A 4BRZA 1G8YA 2C98A 2WNIA 2GLXA 2OMEA 1OXKB 2XPCA 2XYPA 3P9RA 3G2IA 5CX1B 5IM5A 2A8YA 4J7AA 2VHWA 3LUFA 1ZXLA 2I6TA 4L0CA 4ML3A 2OLEA 4HG2A 4J6FA 4XGRA 3KC2A 2DB3A 1OQAA 3AOEA 3QF4A 1S2LA 4Q3EA 2Y05A 3MSXA 5AXDA 4DYVA 4R16A 1NBIA 3KKEA 1Z7GA 3AB7A 3LY5A 2A78A 3IAUA 4DLVA 3BA6A 3PICA 2Q6IA 1I9CA 3FYHA 4C5CA 4CKBA 3C8HA 2NV0A 5D86A 1XRNA 1JVNA 3NGMA 5LN1A 2GEKA 2JZCA 3IBSA 2HRZA 2WYHA 4JUIA 5EQJB 5K3EA 2WHEA 2R79A 1RYZA 3DF9A 1J25A 3CCBA 1NBHA 4F46A 3VM6A 3I9FA 1XLVA 2H48A 2WD7B 1E1DA 4YVFA 3GCWA 1WNTA 2IE0A 2HIAA 1GNLA 3E58A 3FWPA 4EPVA 2WWGA 4OEHA 1J9GA 1M2VB 3AQIA 5D3QA 1A5SB 4PHGA 3GRCA 3RRBA 2B4KA 1VXOA 2OVFA 3H5NA 3HA3A 4AUKA 1E9FA 2CUKA 3OFND 1AMOA 2GYYA 1JMKC 3SF8A 5IKPA 1I2CA 1AHHA 4NBKA 2C7VA 1XNGA 4HGYA 4JQSA 4P80A 1U0HC 4KXVA 4QICA 4UAVA 4V0OA 3FXAA 5HHTA 4ZTZB 1PGJA 3I2YX 3WLOA 1GCGA 1AS2A</