1BGXH

Taq polymerase in complex with tp7, an inhibitory fab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
209
structure length
209
Chain Sequence
QESGPGLVKPYQSLSLSCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGTTDYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARYYYGYWYFDVWGQGTTLTVSSAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Taq DNA polymerase in complex with an inhibitory Fab: the Fab is directed against an intermediate in the helix-coil dynamics of the enzyme.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Complex (polymerase/inhibitor)
molecule keywords TAQ DNA POLYMERASE
total genus 22
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 1998-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxH02
5E8DL 2AJ3B 3BKYL 1HXMA 1Q0XH 4PJGB 4PJDE 4JN2B 4L8BB 2DWEB 3ULSB 4I3SL 3O4LE 3ZE2F 5CZXC 1JWUA 4U1NB 2JCCA 1CF8H 2ZUUA 2IGFL 1UB6B 3TF7C 5INCA 4R90H 4U6TA 4JY5H 5C6TL 1S7RB 1P2CB 4M6OH 4S10A 1RK0A 3GSUA 5HY9A 4OF8A 5GQBA 3BX7C 3WIHL 5DJDB 5JOEA 4QHNB 5IKCB 3ESVF 5FYLH 4EN3D 3QR2A 3NZHL 5BRZE 1IGJB 4XWGH 4Z8FL 5D1XA 4KGLA 4R0LA 3P4OB 3FRUA 5F9OL 3NFPB 5A2LH 1L0YA 4PGCB 4ALAH 5TFSH 2IADB 3EDEA 3S34L 1Z9MA 3CD4A 3RFZC 3HC0B 5A3IC 1IGYB 3V52H 3GKWH 4GAJL 4OCXL 1KC5L 2EXWC 5D1ZC 5ADPH 5TDPB 3DO7B 4HEME 4K9EL 1OGTB 1A9EA 4C4KT 4N9GA 4QXGL 4MYWB 3OJDA 5HVGB 3S3SA 3BH8B 2VN4A 1WFUA 2DQDH 4R26H 2H45A 5HDQL 4C57C 5KAQG 2EDKA 3L3HB 1LO2H 4MQXD 1ETZA 1LO4L 5IMKA 4PRDA 1F4YL 2ATPA 2V9QA 4PYGA 2Q7YA 4NJ9H 4X7FC 1A6PA 5CSGA 4IM8A 5EN2B 4QOKE 4GXVH 4A2MA 4S1QL 4MD4A 3KNBB 3QO0A 3TNNA 3WFCL 1KJMA 2ZNXA 3RX5A 3FFCD 1BWWA 5DLML 2MNUA 2E9JA 3T77B 8FABA 4P5TC 2NMSA 4X6DB 4ISVA 4HHAB 2VXQL 1G84A 3CXDL 3L7FA 4I5BA 1S7VB 2WWKT 1T1ZB 2XTJE 4BSWB 4PJBF 5E0QA 3FKUS 3PIQB 5HD8D 3WS6A 4S2SA 5H8DA 4GMSL 1I4FB 2GK0A 4OF5A 5DJZB 4L9LB 1S7UB 5D2NC 4Y5VC 4MZ2A 5SWZD 4KWUA 2YN5A 1NBZB 4F7MA 1OTTC 3VWJD 2X1QA 5FDWB 3NABL 4D8PA 1XF4A 5HHOE 4FXLA 4W4OA 1PKQE 3O6KL 5KG9A 2V5MA 3D25B 1D9KD 3H7BA 3MV8E 2PTTB 4XP5H 5BJTB 4OGYH 3BPOC 2EYTA 1OAKL 1G9NC 4JHWH 3W11D 4WHCA 4XGZA 1DBML 2E3VA 2QQQA 3BZFB 4EVNB 3A6OA 1XGQA 3OF6D 1G0XA 2VDPH 3LMJH 1AD0A 4LCWD 3SGKA 3MJ7B 4FQCH 1DVFA 2YWYA 2A6IA 4A6YL 3CXHK 3BO8A 4PJDA 4P2QE 3T0VA 3T65A 4PJ9A 5DA0B 1MVUB 2EDJA 1UCBL 4POYA 4E41D 1UEYA 1YEEL 3MOBH 1HI6A 4OCYL 1QSEB 3BP5A 3GO1H 3W0WD 1JHTA 4UNVA 1ZTXL 2G75A 5EU6D 1AHWA 4MLSA 3TVMA 3BQUC 3EHBD 4PJBB 4B53A 4HIJB 4IEFB 3ESUF 3QNXB 4XNYH 1JGEB 1U6AL 2CKNA 3B8YA 3MV7D 4IRJC 3MV7A 5ERWB 5IK3A 5B39B 3NIFF 3VI3E 1J5OL 3EZJB 4LVNB 1T89C 3SDYL 4YNYB 3MXWH 4QRSA 1NEUA 4Z0XA 4E0RB 3ARBB 2GKIA 4FN0A 1GAFL 3PE9A 3IXTB 1AGEA 1GCFA 1UWEL 3BAEL 1L7TH 2ADGA 3WLWD 3QIUA 5DTFB 3GKWL 5FM4A 2ESVB 3QCVL 3IDIA 4PRDB 1RUPL 2LV4A 1EA9C 1X5HA 1ACYL 5IGXL 5D7LA 3MRIB 2APTA 2PCPB 5BV7H 2DMKA 1C5CL 1CGVA 4MHHI 3OKKA 2MCG1 1ZA6B 2NY3B 3FT2A 3MJ6A 4P46D 3O3EB 1IAIH 5D93C 4M48L 5ICZA 5AZEL 4MXQC 4JKKA 3BKYH 3O11B 4JFDE 4FFVC 3V4UL 3BKJL 1U8QA 3BGAA 3U46B 4M1DH 4PGDB 5T1DL 3VXSE 1H8NA 1IAIM 4XTRD 3MLVH 5GRYA 4FA8A 1G7LA 5JW5A 1OSPL 3O8XC 3I02A 1GZQA 1HWHB 2JJSA 3FZUC 2FH6A 1QEWA 5D1XB 5DMYA 5CGTA 3SE9H 1RQ5A 4PRAB 2UVFA 3TN0B 3X13A 3VFUB 2P8LB 1RZJL 4JHBA 5HHNB 3WIHH 1FNEA 2YD5A 5E4EC 5FGCB 2CRMA 1A4KB 2C3VB 4S1DC 3ZZ1A 2VDKL 4YHOL 4MSWB 4NQVA 1PG7X 1VPOL 4ALAL 4P5MA 1KB5H 1KJ2H 3QHTC 4XCFL 5E5UB 4ZDHA 3TP4A 5I76A 4OD1L 5J3HD 4F9PC 5HI3D 5C09A 1TIUA 5I19L 4OV5A 3F8UB 3IXAA 2OSLB 2BHYA 3SDXF 4XP5L 4XB8A 1FRGH 4HS8L 1SJXA 5DFTA 1LEGB 3QQ4A 1QEWB 4L4TB 5KSAB 3IAPA 2YEZA 1JHLH 4M43H 1UXWB 1TNNA 1HILB 3G5VB 4DVBA 4MNQB 3T0DA 3EW3B 2V2WA 3IJSB 3LMJL 4AL8H 3MRNA 5D9SA 5DRNB 5MP6L 3MRJB 2O26U 3K1DA 5H2BB 2DF3A 5DF0A 3JTTA 5DVMA 1AJ7H 4F3FB 3O6ML 1P5VA 3PV6B 1UXSB 4NM4H 3PABB 3RDTA 1V3MA 3STLA 1YEJH 1QBAA 4LHQB 3VRLE 1K8DB 2GCYB 2DQCL 3KS0J 3PDGA 5E8PA 5GISH 1B0WA 4J8RB 4K7PX 1N2RB 1A7OL 2IEPA 3QIWD 4Y2DD 2BNQE 5H94A 4F7TA 4KV5E 1WTLA 4YEFA 5DMGD 1C5BL 1DQQA 3OKOB 4FQIL 2MFNA 1LWRA 5D72H 2E9IA 5E9DB 3UO1H 2XN9E 4OLUH 2IQAA 5JIHA 3QRFM 3ARED 5IB3A 1SJHB 4OAWB 3VFUA 3MNWB 5C08E 2ED7A 3PGDA 5C0DA 2FGZA 1T4KB 4XCEB 1F6LL 3GFUA 5IB4A 5A1AA 5CHNB 3N1PC 4JCLA 1AD0B 2JJUA 1FAIH 4Y4KB 1LQSR 4NC1C 1J8HD 1E28A 1YECL 5JQ6H 4YDLB 4I2XB 4Z7UF 2ESVE 2VLJB 4OLVH 4MD5A 3OAZK 2J3SA 1I1FB 3VXQB 4NFCA 5MEQB 3FN3A 4G9FD 4HG4J 3O0RH 1SYSB 4NN7C 3REVA 3VXUD 2XZQH 3MLTA 3VFTA 4LCUB 2HN7B 4JKWA 4A6YH 4FRWA 3DVNB 5IFAH 5SV3A 4H8WH 2WIMA 3TYFA 2PW1A 2VXTL 2X40A 1WWAX 1MCOH 5D70H 3SDAC 1SYVB 1IAOB 2P5WD 3HPJB 4ZQKB 4F9LA 5I1IL 1S9VA 5C0IA 4DW2H 4PYHA 3MRNB 4NQCE 5DDHA 2IQ9H 4O2CB 3BT2H 1I8KA 3U4BL 2BC4A 1MY7A 4YK4C 5ICXB 5HHME 4U3XA 5IBUG 3QZWB 4N8VB 5EOTB 4PGEA 5T33H 4KK9C 1BQLL 1T7ZA 5DO2C 2D4FA 4HH9A 3BN9D 1S9WB 4JRXD 3F7PC 1IKNA 3VGBA 5MEQA 3MMEA 5D7LE 1YYLH 3WEXB 5I76B 3HAEA 4P0DA 1IGIH 4ZUSA 2DIJA 1E27A 5EBLA 4QXUL 4FQQB 4JM2F 3GM8A 1FYTE 3DYOA 1QPPA 4G3YH 5H94B 4F7TB 1KIRA 3L5HA 1UWEH 3L9RA 3VRIB 3QIWB 4LSVH 4MA3B 4HIEA 5GGVY 3DBXA 3RVVC 3HHRB 4HMDA 1VGEL 5D5ME 4JLRA 5I19H 5I1LA 2WBJA 3WKML 4XBPB 3EDFA 3G6DL 2VDQL 1ODAA 3C5ZA 3RWHB 2R8SL 1EHLH 1TXKA 3Q5OA 1FFQA 3HI5L 4LP4A 5DUML 5IR1A 3TO2B 4ZO6A 5D96C 3TBWA 1RUKH 1AC6A 5I1DA 1ED3B 3T4YB 1QFUH 3CFDA 1X5GA 5KVMC 4EI5A 2V5SA 5DURD 3CSYA 3ZTJG 4FFZH 1BF8A 1ZHNB 1VFAA 5DVOA 3PDDA 5IBTH 4I0KA 4F2MB 1YJDC 2AXJA 4G8GD 5B4MD 3MRFB 4XH2B 3D1MC 4OLEA 5KOMC 5E2TL 2DWDA 3I75A 2OYPA 1OSPH 2IFFH 3RWCA 2E27L 1T3FB 2OL3B 2BSSB 3OB0H 5FB8A 3VRJB 4Y5YC 3QCTL 4G9DB 4RMVA 1JPSL 3GSVB 3UBXG 3E2HC 4MCZA 4LHUD 5DVNA 2FHCA 1MIEL 4GS7B 1RZ7H 2Q76B 4JRXB 4R9HA 1DUYB 3ARVA 4PJ8D 4GLRI 5SV4A 1NC4A 4RX4D 1NC4D 2ZWLT 4R0LB 3C60A 1FZMA 3QIUD 1EGJA 5ACZA 5JLZA 4PLKC 4CUCA 1AI1H 3PG2A 3SJVE 4NKIH 5F7KC 5CEXB 2BCKA 3EYVB 4PJ7F 5DUPH 4LEOB 3SKNA 2NY6B 2DMCA 3UPCA 3MGAA 3R06B 1ZGLP 1ZEAL 3T1FB 2WIIB 1YECH 4H26B 1S78C 4H20L 1F2XK 3WKNA 4NZTH 1U3YA 1S7XB 3GIVA 1IAMA 3F6IA 4YDVB 4G6JL 3C5JA 3O41B 2Q87A 5TDNA 4ZFZB 2YWZA 5FUZH 3TJEH 1CQKA 3LKPB 4YR6A 2ZG2A 1B3JA 2IC2A 2SEBB 4ZUUB 1JPFB 2DJUA 4NJAH 1CT8B 1MCKA 5TDOA 1N5YH 1NLBL 2C3XA 5GISL 3GK8L 3OWEA 1QNZL 5K9OA 3ZSSA 1OTSC 3HZMA 3GMRA 1NCDL 4NWUL 5IHUH 1M05A 2D7NA 2LTQB 2GTZB 1NGXA 3L3KA 5E9DD 3LD8C 2MJWA 2XN9A 5JHLH 3H7LA 4NO0B 3PDOB 3DBXB 1YEKL 2QQLH 4OLUL 3SDXB 1RJLB 3V7AE 3D87B 3PHOB 3UJIL 1YYMH 3CFBA 1EDQA 3VI4F 4LASH 15C8H 3SJVA 3SOBL 4WWID 4ODHH 4WWKD 1NCUA 5D2NE 1Q94A 4JG1H 1BBDL 1R3JA 3WHE1 2EKJA 5DK2A 3RNKA 3WCYA 2V7HB 2FB4H 3HZMB 1FZKB 3EJZD 4WW2F 3RNQA 3S37X 1NC4B 1N0LA 3O3DA 1QPXA 3VWKA 4DZ8B 3QDJA 4EUPH 1E4KC 2NNAB 2XY1A 4JFYB 3ZYZA 2AAVA 4NWTL 4EDXB 4CGTA 4WUUE 1KEGH 3NIDF 1HHKB 4PJXB 5F6IC 4G42A 5JIIA 3AXLB 1RFDL 4L4TD 4G8IB 4NN5B 4V1DB 5D70L 1L7IL 1NMAH 2JLLA 1ZHLA 3U9PH 4QO1A 5CD5C 3NIGF 4N1CA 2GITB 5SWZE 5E2WH 3TNMA 5KW9H 4JFZH 3RWFB 2VDNL 4EKXA 4YHPA 4NQVB 4ODSL 4MJ6A 3VG0L 4JZJB 1B4RA 1T2QL 5GJSH 4JM2B 4U1KA 3V5KB 4U2YA 3QCTH 1G7JB 3JUYA 5D7SL 3MV11 4P2RE 4JVUA 1BJMA 3GNML 2BZDA 1QOKA 4TYUA 5E9DE 1DBBL 3B9AA 5C0NC 3V0VB 4GMTL 5DEGA 1MCHA 5C08B 3UTQA 1JZ6A 3PWPE 1IZKA 8FABB 4L9LA 1JMXA 4JY4B 4K3EL 3UTOA 5DZOA 4WWKC 1J8HA 2MHAB 1JN6A 4KGJA 2A1WH 2QR0A 4OTXL 2FZ3B 1ZEAH 3U9UA 1P6FA 1CFTB 5SX4H 2X05A 1YEIH 1T0MA 2X9XA 4AIXA 2FEEI 1T1ZA 4BM7A 4TTGA 1T6WA 4KRPD 3L3IA 4J8RA 1ZVYA 2X4SB 4UQ2B 4K8RH 3MRIA 4MCYA 3UXFA 5BO1L 5CEYA 5C07A 2W9DH 3T77A 1C1EL 1F90H 1NCAL 3D85D 1D7FA 4FFZL 5C0CD 1H3UA 1T5WA 4P23D 4JQVA 2RBLA 3GSWB 5EU7E 5F21B 1BEYH 1H3PH 2EICA 3SQBA 2H1PL 1BM3H 2MHAA 5BZDB 3IJYA 2IFFL 5IEHA 5DA4A 4GAGL 2LU4A 4V2BA 3O4OB 4L3ED 3HZVA 5D7IF 3HNVH 3D3VE 5HDBE 1KUMA 2Z91B 4GXUM 3DX6A 4WUKL 4IJ3C 4EN3C 2FX9H 1IC5L 5DHYB 4IRSC 3MV7B 4TPRL 1T89A 1LK2A 1M7IB 1YEKH 3NH7H 2BNRE 5IV2B 4G7VH 4CU8A 3K2MC 2D2OA 3EYOA 1GGUA 4U1KB 2LQRA 4NKMB 1Q0YH 2OR9H 1IAKA 15C8L 3SOBH 1E6OL 4OLWH 4D0DA 3CCHB 1P4IH 3X12A 3P9LA 4HUNB 1C7SA 1U41A 4WEBL 3CFCH 1A3LH 2VLJE 1FVDB 3V0WL 5I8CA 2CLRB 4YUEH 1JK8A 5D2LA 3TT1L 4Z78B 3AREB 4JFFA 2ATKA 5EU7C 1XZ0A 3JWDH 3EOTL 2NY5C 1JGLH 3ARSA 3NCFB 3O3AA 4J4PC 5GGTA 4J6RH 4H5SB 3O81A 4X6CB 2NY1C 1ZS8A 4MNQA 4IMLB 1PEZA 4MAUH 35C8H 5E00B 4I3GA 1FCCA 5E1AB 2B20A 4K7FB 4DGIL 5GS0C 3ULVF 3MLTB 4HGWB 4Y2DB 1YNKH 1J87A 1CF8L 3CC5A 4PJGF 2VJXA 4FS0A 3RDTD 3MV8A 3VWKC 3BMWA 3GK8H 5T5FH 1ZLUK 1NPUA 2I07A 3QUKA 1JI1A 4AY0A 1NCNA 4I13B 1CS6A 5ICXA 2OK0H 4C56A 2QHLA 3P0VL 1WZMA 4OFIA 1OM3L 4WIQA 4PBWD 1XF2B 2AJXH 3ABZA 2NZ9C 3AM8C 1UXWA 4KHXL 4R3SB 1X5LA 2BVQA 2XZAH 4YPGA 4C83A 1SQ2N 2CDGA 1M71A 3HUJE 3VFOA 2WP3O 3RVVD 4LCCB 1NGWA 4D0CB 4K94C 3HE6D 4ORGB 4BK4A 3G5YA 4L8SC 2ZOLA 1N5AA 4ZFOB 4IDJH 5ALCH 1NMCB 4N5UA 3RX7A 4F7CA 3VFGH 3U7YH 1N64H 5DJCB 3ES6A 1TETL 5E03A 2VKWA 2XTLA 3QPQC 4NWTH 4BYHA 4EBQL 1O5DT 3GBNL 2NY0B 3FFDA 1BBJA 2GCYA 1RV6X 3LSOA 4LPYA 2QQNH 2FX8L 2F54A 2CDGB 5FDYA 3S36H 4HV8B 2BVQB 2VABB 2ICWB 5IEHB 3UZEA 1F90L 1NCAH 2YBRA 3WIFB 1FFNA 1NC2D 1L7IH 1NMBL 1UJ3C 3MLYH 4U1LA 5D7JC 4LOUD 2CRIA 3ULUD 3CFJB 1NH6A 1GGIL 3ARPA 1UWXH 1FZMB 4NCC1 4G8EA 2LABA 1UB5A 4GBXA 4LLDB 4EN3B 4HDIB 3CCHA 5FK9B 5D1XC 3ZHDA 2JB6A 3F58L 1PX3A 4M9OA 1QFHA 2Q8AL 3ARQA 5FO7A 4MVBD 4OFDA 4WFGD 1CN4A 1ZT4A 1E28B 4JDVA 2DKUA 3LHPL 3RY6C 3GSXB 3BP7B 2EDNA 4PJCA 4XT1C 4IBLT 4M61B 5F1SA 4WY7H 2QADC 2QV2A 4K9EH 2O5ZL 4LVOC 1WIUA 4PJFB 4KMLB 5C08D 4JHWL 5ACZB 4PRAA 3HPLA 1Q1JL 5TQ2L 4MMXC 4YWGH 1KN2H 4LLMB 1BFOB 3LRSB 5HDOA 2DQDL 4DVRH 1WBYB 5LJYH 2HJLA 3MRRA 1AR1D 2YN3A 5FKAA 1KB9K 1PX4A 3HUJF 3GSVA 3MR9A 2CD0A 4ZS6C 1F13A 4HF5L 1OSZA 4HUXA 3DRTB 4MAUL 3GHEL 3SDCB 3EGSA 1U8HB 4MZ3A 4DGIH 4ZTPH 3Q5YA 3FQRB 4QRRB 4GRWH 5I74C 3PNWB 1A8JH 1ZTXH 1B0GB 3T4AB 1I85A 3FO2B 5EU6B 5ETUB 1YNTA 5H35B 2JK5B 5E8OB 5C0GA 3UPRA 1FL3A 1J8KA 1YZZA 1EFXB 3WNKA 4GAGH 1JNHA 1OCWL 3CZJA 1S7XA 2IAND 4XHQA 1HINH 4HZAA 1A14L 4XMPH 1SJEA 4NKOA 2W38A 2RFXB 1OM3H 5E8EA 1EERB 2D03H 4HWEH 4MWFA 1OSZB 3HNTL 3CVHB 4U1GB 2A9MH 4NN7B 1IM9A 5LXGL 2GEEA 5LQBL 5HHOA 4XBPA 4ENEC 5DJXB 3VXMD 3FOLB 1G7HB 2X4TB 2AQ3A 2HG5A 3PGCB 5SX4I 2AJ3A 3IGAB 3LVEA 2YK1H 1KBGL 3CFCL 4N0UB 3V0WH 4OFPA 5GRVK 1MIML 3SE4A 1NFDE 2F19L 4UDUB 1ZT4B 5FOBB 3M07A 1MFAL 3QI9D 1IAII 1WFNA 4Y4FD 5F7UA 5I1HH 1TETH 4FTVD 3C60C 2BVEA 3LEXA 1QUNA 2OJEA 4MA8L 3MRFA 2VRAA 1IARB 3C6SA 5BRZA 3NFSL 4KKNA 2F54E 1FNGB 5LGHL 5EUOB 1XF5B 3GJEB 4KHTL 4K55A 3DMMC 1IGJA 2Q8BH 3ARFB 5CEZD 1G1YA 4MNHB 5DK0A 4OD2A 1TVBA 1S7QB 2E7HA 5HI5D 5B3JF 4XP9L 4GRMB 3HG1E 1F6AA 1R3KB 3AU1A 4N8CL 3V6BR 3RTQD 4OQTA 2Z8VC 3QIBC 3SDAD 5MEPA 1GGIH 5DJAA 5C0CE 4P2RB 1CFVL 4IOIA 3NIFE 3VI3F 3NGBB 1LHZA 5J6HA 2AXGB 4Q9RL 5GSRB 5BW7C 5T1MB 5E6ID 3MXWL 5KG9B 3O3UN 2Z93A 3AROA 4JN2A 3QJHB 1U8NA 3P9MA 4KHXH 4XCFH 4G8IA 5CJXC 2X89A 4X99B 2MTPA 3D5OF 3R06A 3ULVE 1RJYA 4OGXL 4XXCA 4ZS6D 4DOHB 3SPVA 4LLQB 5F7EL 3TBYB 3RWCB 4WU5A 3TBWB 3IETB 2XWTA 4GQPH 4C56E 4YXKL 1ACYH 2BJMH 4QF1A 2GT9A 1FNAA 1C12A 2K7PA 1FZKA 1XIWD 2F54B 2EKSB 4HIIB 3GJFK 1R0AH 1KJVB 3V6ZB 1K2DB 4KMQA 5I1KH 2FO4B 1QRNE 5T3ZD 3U7WH 3MJ8B 4JFEE 2J88L 3MRBA 3NIDE 3L3IB 4QOKB 4PJAE 2RCSL 4ERSH 1NMBH 2HJKA 1FP5A 1RZ8A 3O8XB 4KK5C 3R0MA 4LDEB 3WFBH 1BIIB 4LKCA 1DBKH 2G2RB 5JHDE 3SCMD 2XQYK 1FCGA 3QULA 5C2BL 4U1HA 2BSTB 3TO4D 4BKLA 5F89B 1WT5A 4O00A 1OLZA 3MNZB 3MLWL 4OLYL 3UTZB 4XVSL 5JO5B 2XIDA 1GGCH 6CGTA 4CVUA 1VPOH 3H42H 1P1ZA 1MI5D 3PWVB 3MFFB 2D7QA 3G08A 3LHPH 4HS3A 3MUJA 4QWWC 2HJFB 3QDGE 2OTWA 1MCJA 1C5DB 4L3CA 2R39A 2DTSA 2OZ4H 4J2XA 1Q1JH 5CWSB 1HHIA 4LARL 1KN2L 3TFKD 3LKSB 4PGDA 4JZNB 4JO3H 5MP6H 4PP2B 3K4AA 4X0KB 3VFNA 1AGFB 4CVXB 4M1CC 5IWLC 1WWWX 4PTTA 1XR8A 5CSZB 2Y5TB 4EDXA 1IQDA 3BVNA 4OCSH 3HI1A 4M3JA 4HKXA 4NT6A 5GGSA 3FHQA 1RMFL 5LGHH 3PWVA 1K3IA 3U4BH 2V7HA 4P23A 1PZUB 2Y1VA 2P5WB 4MWFB 2M1KA 2DJ4A 3TPKA 5CSBA 4MJ4A 3B5TA 4TUKH 3V6OA 1N8ZB 3NN8B 3H3KA 4JZNA 2ZPKH 1A14H 4XMPL 4KKAD 3CK0H 5KSAC 5F1OB 3D48R 4KJPD 4HGKC 1QLEH 5FECB 5I1GH 2EEDA 3MRDB 3QG6B 2CO7B 4HUUA 4U3CA 3B9KD 1CDHA 1JNNL 5GGUA 1HSAA 2ITCB 1OAUL 2I26N 3MTRA 5K9OB 1NKOA 2XRAL 2X4QA 4P2RD 1YC8A 5C71A 4JY4A 1WJ3A 4I18B 1EHNA 4HFUL 4N0FB 4P4RB 2X9YA 3RPIA 5JA9A 4ODTL 3O0RL 3OJVC 4X5WA 4LSDA 2ICWI 4OM1L 4V2CB 3RGVD 3MREB 3OPZL 5EU5B 2A6IB 1UKQA 3CMOH 2VOTA 5MEND 1WIPA 3U48A 5FHAH 5MENA 5TQ0H 3NFSH 5DC4B 3DARA 1MCEA 2OQJB 3BH9B 3KYOA 3Q3GA 1HSBB 4FTVB 4PR5A 4LRIC 1HCVA 3VE0B 2VQ1A 4ERSL 5K9QG 1N6QH 1A4KA 2C3VA 1GGBL 4P5TB 2QSTA 4Q6YA 3RGVC 3KWWA 1LO3L 5JXAH 4HAFA 5CIPH 2YD8A 5AYUL 1T21B 3ZLQC 4PLOB 3BMVA 3U7AA 5DEFB 2R2CA 1D5XB 1TPXC 3BGMB 1YMMB 3GI9L 5I2IB 3SKOA 5KZCD 3CDGB 4NFBA 1ZLSH 5HGBA 1HHHB 3SE8L 5KSAD 5KSAA 3TFKC 1XGRB 3OKDB 2PN5A 3H2WA 1FYTB 1YDPB 4IRJD 4OZHB 3D18B 4JFPA 1HYSC 5IF0A 5K9KB 1AI1L 4AENB 4RGNE 3OR6A 4MJ5B 5E2VH 3EOYG 2BRRH 1AKJB 5B38B 3CSBA 4HWUA 1T21A 2IPKA 4ZO9A 3S3PA 1OOAA 4KKBD 5AD0A 5C8JA 5C0BA 4RGOH 1CTOA 1CFQA 4M03A 2AK4D 4XXDB 3RL1B 4HUWB 1P7QA 4WJ5B 2VZTA 1N2RA 4QRRD 3B2UD 4BJLA 1UVQA 1UZ6E 3QUZD 1CL7H 3SDCD 2NCMA 5FUOH 1MJUL 4P4KD 1HH9A 4U1JA 3S7GA 3QCUL 2VQUA 4N0YH 1AXIB 5DZLA 4NQUA 1W72A 1KIPB 1EO8H 2OCFD 4HV8A 4XPBH 4JFXA 1QNZH 4NGHH 3D39A 4P57A 1D5BB 4NWUH 2O5YH 4GKZA 4IRZL 3ROOA 3VFRB 3VRIA 1P7QB 4WJ5A 2DM3A 1JPSH 4B5EA 1HQRB 5C0BE 3RWJB 3IU3A 4UMGA 2JELL 2YMXL 1EFXA 4JRYE 1A6UL 1AXTL 1KPRA 1U8JA 2OX5A 3KPQB 1OAZL 1XF4B 5E6ZA 4WHDA 1YPZF 4NKDA 1Q8MA 1U58B 5J1AB 1VKXB 4DN4L 4HLZG 1NGWB 3MV01 4GQ9L 2GSGA 1AGBA 1W72B 1O7VA 3C87A 1ADQA 4EI6A 4JG1L 5IIEB 1F58H 4C83B 4L8CA 3LDBB 3TZVD 4NQDD 4NQDA 5FEBA 1A1OA 1NFKA 1BOGA 5BVJA 4G6FD 4JR9H 2Q20A 4P57B 1GHFH 2L4OA 4M61A 4NZTL 5T1LB 4PJ5E 3CLFH 4N68A 2AEQL 4FABH 5GZOD 5HHXH 4MNHA 1H3VA 4TRPH 1TJHH 2DB8A 2DLHA 3Q0HA 5GGRA 3W11C 2FWOA 4HS6A 4NZRL 1SMOA 4ZXBC 2XA3A 3MFGB 1ES0A 2O61A 1S3KL 4RAVB 5C86A 2BP3A 4D0DB 1A2YA 2MPAH 4NJAL 2JIXD 4L8CB 1NLBH 4P5KA 5MERB 4R4FL 5HI5C 5J6GB 4IHOB 3RUGB 1B90A 4ZMAT 3UYOD 4R96B 4U6HB 1D5MA 1NAMH 3EFDH 4KI5C 4U1LB 1NCDH 5IQ7L 5DK0B 5IHUL 3CSGA 2OBGA 1JTPA 3EOAA 1S7VA 3MBED 3C60B 3OL2A 3TN0A 3WFEH 2XQBH 2ARJB 1ERNA 1FIEA 3VU2A 1WBZA 3SDDA 5IF0B 5K9KA 2JJWA 3CK0L 1OGTA 1M71B 2IALA 2FD6H 2ZZUT 3CFEA 4PJ5A 3TEUA 3Q1SL 4ODHL 4MS8D 3HB3C 3MV9E 4JRYB 4R2GB 2V2XB 1TZGH 4ZFOA 3HMXL 5IFHL 3TESA 1YA5A 1TVHB 2OJZH 1EZVY 2FB4L 1EBAA 3MRLB 1H0DB 5D7LD 4NQEE 3WIIL 1RZKH 5IHLB 1EUTA 4TOYH 4XVUD 4GKNA 3E2HB 2A6DB 1GSMA 2YA1A 2XT1B 5E7FA 3PABA 1FG2A 1SVZA 4NRXB 3LKRB 5TE6L 2PR4L 2E7LA 3CFKB 1VFOA 1KSRA 43CAB 4QLRA 2W9DL 4UTBL 1DBAL 2HAZA 3CMOL 5E7BA 4P59L 4F58H 3E3QC 1ND0B 3STBA 5J11B 3VFSA 3SE4C 2EIEA 3KDMB 3ZKQD 4XC3H 2ZKHH 4JFZL 1EEYB 2V5YA 4FQXC 4HD9A 4HBQA 2D7TL 5DYOA 1MFNA 3PL6D 4Z7VF 4PJ7A 1KJ3H 4MQTB 3ES6B 4PS4L 4N90D 4IRZH 1DUZB 3KPPA 1IC7H 1NAKL 3EO0B 1C16B 3LIZH 1GZPB 3D25A 3ZSTA 1FZOA 4U6XA 4JFQB 1NCBL 4EOWL 4WHYH 5B38A 1JUFB 5IB1A 5CWSA 2IAMC 5C09D 3L1OL 3LPGA 4PRPB 4CU7A 1HHJA 2ENYA 1K4CA 3MV7E 4ZFOL 3H9YA 1BECA 1P4IL 1B9ZA 1BQHB 2VN7A 1P1ZB 1OD9A 2G60L 4LSTH 3WSQL 1OAXH 1PY9A 1T1XB 2H8PA 4M6NH 5L88L 3LD8B 4JR9L 4Z76A 3K8KA 4XCYB 3FN0H 5IT2H 2VE6B 2PXYB 3CDYA 4HZLB 1OWRM 1AR2A 4K3DH 4RGOL 5F7DB 4EXPX 1UYWH 3EOBB 5EZLA 4MDIB 3QUMB 1DLHA 4P3DA 3RA7H 5ICZB 1XIWA 1JUFA 2DDQH 2P8PA 1GL4B 1RK0B 4PY7A 3SGKC 4TVPL 4UBDD 2R0LL 1XCQA 4WW1B 4HC1A 4RRPG 4WO4D 3LV3B 1H3PL 3TYGL 3BP4A 4N0YL 1I1AB 1T2JA 4OB5H 1FDLH 3IU4H 3QXVA 3D9AL 4Z9KB 3KYMB 1RJLA 1F4XL 2OS7A 3HC4L 2AJZA 3UAJC 5J89A 5AG8A 1WIOA 2ICCA 2O5YL 1EEQA 3I6KB 2BNUB 4N5EC 2J4WH 4LQFH 3ARGC 3MNWA 4XAWL 5A2KH 4BQ6A 4NUJA 1IC5H 1ONQB 3IFNL 2XWTB 1MFDL 2Z4QB 2EDLA 3IKKA 3BSZH 5GGTH 1T7YA 1CDCA 1EUUA 2Y5TA 1D9KC 4L3EE 3LN4A 3BYYA 3SPVB 4WUUD 1QKZH 5JO5A 2FCBA 5JR1H 3Q1SH 1S9KC 1E6OH 43C9A 3CX2A 2WUBL 2I60L 3B3IA 4ZS7L 2OLDA 5E70A 1AXSA 3ULVH 1SJVA 1TMCB 3ARZA 4GT7A 2NXYC 1LILA 5HI4C 5DMJB 2IPUK 4PLJC 1QBLH 1YPZA 3B83A 3TT1H 3HLAB 3O9WB 4WU7B 3I6KA 1KJVA 5IVXE 1T20B 4NQEB 2CUIA 2OTWB 5MI0C 4I48A 1N59B 3OZ9H 2GITA 3NN8A 4AEFA 2YUWA 3RAJH 3GRWA 5IW1A 5KJRH 2YZ8A 3RVWC 4V1DD 2CLVB 4L4VE 4TVPD 4ODVH 5IG7B 3I6GB 1XF1A 4HC1L 1G7JA 1DL7H 2YD9A 5DRWA 4S1DD 1CVRA 5HHNA 2DQEL 2ZNWA 1F5WA 3IDYC 1NUDA 5DJ8A 3VFWA 3CU7A 4DQOL 3WV0A 3I6LE 5L8KB 2CIIB 1ACZA 4YHYB 1NAML 2VLKA 3EFDL 3RNQB 4X4YA 4TNWK 3ZT6A 1CR9H 5T1MA 5JOFB 1MFBL 5AWNL 4IDLA 4KV5F 2EDRA 2ZP0T 4G9DA 4RFNC 2APVA 4Q6IB 1MUJA 4WO4B 2FDBP 4X98A 4U1HB 1F00I 1JYXA 3QWOB 2Q8AH 5IM7B 1BMGA 4LIQE 2DTMH 1VFUA 1HXYB 1PYWA 3L1OH 1ZHLB 5FGBC 4L3CB 2P42B 1A1NB 2UYLB 2W0FB 2PXYD 1LD9B 3OF6A 1LE9A 2NYYC 3MRHA 4IDJL 5I1DB 3RWDB 3LN4B 4M6NL 5DQ9A 2F5AL 1JGDB 4IJ3B 5AUMB 2BSTA 4PLJD 2C7UB 4NRYB 4MNGE 4W68A 1QA9A 4U1SB 3N50A 1ZWIA 3MRMB 5CUSH 3WIHA 3UTZA 2R2EA 2PR4H 2LVEA 4P99A 4BFGA 4MJID 5CZKA 3HLAA 3O9WA 1B2WL 5KVDH 5D8JH 4ZTPL 1H8OA 3JV6B 1PVHA 2R0LH 5HVWA 4YHNA 4F58L 4GG6A 2DQIL 1XGYH 4JHAH 3IU3B 3FRPA 4JFDB 3B43A 4MQSB 2AEPH 1CGTA 3D9AH 5ID0B 4YDJA 2A74B 4JZOB 1NAMA 4KJQC 4PJAA 4LCWE 2G75B 3HC4H 5AUMA 5DQ9B 2C1PB 4ONFH 5EU6E 4NZUL 3DROA 2FL5B 3SDDD 2PF6A 3DUSB 4TUJB 2YRLA 1BD2A 4KJWD 4PJ8A 5JLZB 4E41A 1KC5H 4Y4KC 5K93A 5LQBH 4PJ5D 1FHGA 1HE7A 2XWJB 5DK2B 4HX1A 2XKUA 4U2ZA 2X4RB 4LIQH 3GJFA 2O5ZH 5LGJB 3TM6A 3MRCB 4JM2D 4BH7B 1F11A 1T7WA 5DJ0B 3FT4B 5TQ2H 3RI5K 5IBUB 2EDDA 1LO0L 3PJSA 4NJ9L 2BMKA 2HLAB 4OZIB 4HJ0C 1X6LA 3I50H 4KKCC 5GGSY 5BMFL 4UI2A 1T80A 2FBOJ 3V79C 4RMSA 5HYSG 3RUGA 1E4WH 1CDBA 1FYTD 4IRJB 1TCRA 5KJRL 1A1MA 1INDH 1NFDB 1P5UA 1ZHNA 3B4NA 1XCTB 3BKCH 4ELMA 5GZNC 4WHTB 5EU4B 3ZKMD 1YMMA 4J3VA 1CVSC 3MOQA 1SVCP 1R3LB 1PFCA 1X5YA 1FDLL 1G6RL 4O58L 2EYTB 1TITA 4HWBA 2GW5A 3ILQD 4KQ3L 3O2WL 4KRPC 2CLRA 3MRQA 4P46C 5MHSD 2XICA 3RVUC 3PJSB 2A9NH 2LU7A 2APXA 4GMSH 1HKLH 2J12B 1AR1C 4CMMA 1L0XA 1U2CA 3BP7A 4PJCB 3ZE1E 1HKFA 4OF6A 4ZPTA 4CNIA 4XBEH 5GS0H 5KAQF 4KXZI 3RWEB 1U92B 1HZHL 1KCSL 5DJ2A 3MBXH 4E42B 5MENB 1WEJH 4OGYL 3DXAE 4Y5XB 5ELIA 5IFJA 3U4EB 4PG9B 1W8NA 4YDIH 2J8UA 3FB7B 3VD7A 4Y2DC 3RPIB 3DGGA 1U8KA 2EC9T 4KJPC 4EI5B 5LCVL 1X6NA 5F7WC 1N8ZA 3I84A 5IQ9B 1LP9A 4JFOA 4NQDB 4XVUC 5F7FA 5IP4A 4QHKI 1A4JA 3WNOA 4RNRA 4YXLH 1CU4H 3C8HA 2QEJA 2P5ED 5HVHB 5I1KL 4Z0XB 4MXVE 1V3LA 1CE1L 2J88H 3CUPB 4Z7UE 5I6XC 1FL3B 4YHYC 1B2WH 2HN7A 5KVDL 4R4ND 3QA3B 1RU9H 4WW2B 3BRFA 5IB2A 2DLGA 4GBXB 4Y2DA 4XNYL 3BXNA 3X3GL 4C59B 3S88L 1LNUA 4K7PH 2YUVA 3VFRA 1CDGA 2OI9B 2NXYD 1JVKA 1N5AB 4MNQE 1QFOA 1OF2B 4CJ0A 5JMRA 4JFHD 1JRHI 1QBML 4IOFC 1RK1B 1YQVL 2GTWB 5AD0B 4YE4H 3X14B 1S9XA 4QGTA 3U0TB 1LK2B 2IFGA 1DN0A 4NZUH 4XVSH 4M6ML 3UTQB 1CZ8L 3S35X 4L4TA 3D3VD 4ONHA 2HYMA 2WW8A 1FZJB 1T2XA 4QYOB 3OV6A 3O2DH 1XF2A 4GRLD 4WRLA 2XWBA 5BQ7B 4P5TA 3P11L 1EPFA 1WBXB 3BEVB 3UAJD 1MELA 4OF0A 4BSJA 5FYKU 3DRTA 3AS3A 4ZNEA 2XZZA 4OZGA 4XNUL 3ARGD 3T09A 4H5SA 3QH3A 4ZPVB 1JYWA 4X9GA 4ZSOA 4G6KH 1LO0H 4ODUA 4TULH 5L9DL 1G9NL 3QHZL 1XT5A 3HC3L 4GS7C 3AREA 4APQB 5CUSL 1MAKA 2Y06L 4LSRL 5HYSB 1F42A 1XGRA 5I75C 1WAAE 4NUGL 1T04B 5HHMD 1LEIB 1ED3A 4JJ5A 3NZ8A 1OGAB 3GSXA 1BPVA 5E8EB 1WFTA 3MODL 6FABH 3RIAK 5IR1B 1SJHA 2HLFC 3G6JA 5HHMB 5T3XE 1NCCL 1T7XA 5ISZE 4KQ3H 3SKUD 1MCQA 5DHYA 3IFPA 2BVOA 5DHVH 1KB5B 3O8XD 3QXAA 4APQD 4N5ED 5DVKA 3ZDXE 4M5ZH 1FG9C 2AJZB 1Q94B 1DJSA 1AY1H 3OKNB 5C07D 4UTAL 4OZ4B 3QWRD 3X3FL 1I3VA 4HBCH 1HZHH 3OGOE 3PWNA 4FQXA 4LL9A 4UT7H 3RZCA 3UPAA 3ARYA 3TBTB 3W2DH 5GRXG 1FRGL 3O2DA 3G5YB 1AQKL 4M7JH 4NO2A 3LPWA 5HJ3A 1CCZA 1OAUH 1URLA 1YEGL 4M7KL 3PGFL 4H1LA 3QFDA 4MD0A 1MJ7H 4M5YH 2GHWB 5BS0B 3P0GB 2C4XA 4M3KB 4WTXA 4X5XA 1S7WA 4I0PD 4MB3A 3G5XB 5CBAB 5D71H 1NEZG 1CU4L 1F6AB 3FO1B 4WV1A 4ZAKB 1RPQA 1FV1B 4RFOL 4POZC 5JPNB 4ZFGH 5IEKB 1JZ2A 5IKCA 3NPSB 4ODUB 4M1GL 2EXYC 3ARFC 3QXDA 3EYFB 2P8PB 3MPCA 1IT9L 3KPSA 5KVFH 1UJ3B 1N6QL 1G1CA 3OR7A 3NACL 2E9BA 4WO4A 1G6RH 4O58H 1LO3H 1IGTB 2ZOKA 1WCBB 4DEPB 3GRWH 2VLJD 4P2OA 3OAUH 1WZKA 3CFJA 3QHFH 2XZCH 1RZFL 1HHKA 1CBVH 2H26A 5T3ZE 4K94L 3U2SB 3QFJD 4Y5YA 4G6MH 1IFHL 1V8HA 2R23B 5I71B 2O93L 1DTUA 1NGXB 3S4SB 3K2UH 3C6SB 2VDOH 3M1BA 3U30C 3KPRB 3TNMB 3DGGB 3MRPB 3N85H 3QNYB 1CYGA 3O2DL 5JQ6L 5I17A 3QDME 3VA2C 2WV3A 4LAQH 4OLVL 3QH3B 3DPBA 1BJ1H 2BRRL 5IROA 4JM2A 3V5KA 3KPTA 1UM5L 3DWTA 2BK8A 1PLGH 1FG2B 1ORSA 2XZQL 4X6EA 4YHKL 4XWOD 3FAWA 4YHNB 3K74B 3Q6GH 1F4HA 4PV9A 5GSRA 1H5BC 4HHAA 4X6DA 3T4AA 1CE1H 2AI0H 3KGRA 4LLAA 4FP8H 5MI0B 5F3BA 3RNKB 4PY8J 5HDLA 4YIQB 4OSUH 4Z7QE 2EH7H 3SDCA 1B6DA 5F8QC 1HHGA 3WUZA 4XPBL 2UZXB 5K33A 4Q9BA 1KJ2A 1MAML 1BZ7B 4X6FA 5T5NG 4LCWB 5AEAA 2BNRD 1CLOL 2YD1A 3N9GH 1LD9A 5AYUH 4ZG1A 3DETD 3LQMA 2ATPB 5J56B 4FHBD 2DKMA 4LLVB 3CNKA 4P49A 3BIBX 1QSEE 1OQXA 3D69B 4PUBL 4D8PB 2JELH 1SM3L 2YMXH 3DGCR 5KTEL 4LSVL 3SE8H 5I1JL 1CZ8H 4WDIA 3EYSL 1LP9F 5E2UL 2R56L 1KTRL 2F58L 1HHIB 5F96L 1ORQB 4YZFE 3LV3A 4XMKH 4L4VD 4PGZA 4D3CL 3IDJA 4ETQA 3OKYA 3U6RA 5ANMA 2FYYA 1WBYA 1S78D 2HG5B 4G7YL 4PJ9B 2WBJD 3EKCA 4GOSA 4HCRA 1OP9A 3K80A 3NGBC 1A1NA 2UYLA 3LRGA 4U6VH 1J0HA 4RMWA 3IVKA 1MHEA 3A67L 3DLQR 4WHTA 3UTTB 4HWBL 4G6KL 1U42A 1KEMH 4YGAB 1KCUH 1TJHL 1FN4A 3I3BA 2H6PA 4KDVA 2Z31A 5DHVA 2VWEC 5F88A 4X7CC 4NKMA 1DEEB 3RWFA 1CL7L 4NZRH 4OD2B 4DGYH 2LAGB 3U0WH 1S3KH 2BXZA 4PJXE 2X7LA 4JHZA 3UCRA 1HHJB 4Z0BH 4NSKA 1JWSB 3WD5H 7FABH 1EO8L 3QDMD 2IH3A 2NZ9D 3DMMB 4MJIA 2E8ZA 4X4YB 2GY5A 1G0DA 4S1SH 4UV4L 1T83A 4BH7A 4RQQB 3BO8B 5IQ7H 3CJJA 3ZE1F 4TSBL 3EIFA 4K23H 3I2CL 5TJWK 2P7TB 2H9GA 3QHFL 1NDGA 2UWEE 3TNNB 4FXGA 1Z5LB 1J1OH 2R1WA 1EO7A 5I8KL 1TQCB 3FQTB 4NHCL 4PJAB 4XCNB 5E5RB 3P73B 4UOW1 4MJ6B 3CLEH 3BW9A 3GSWA 5F89A 4RA0C 1CXHA 1RHHB 3K7UA 3X3FH 3FQWB 3DSFL 3W0WE 4TUJA 1M6OB 3DUSA 3MJ9A 2VDOL 4MQ7A 2PCPA 3DX8A 1OARL 3KPRE 4QCIA 1VHPA 2VC2H 3MLRH 4JREC 3WYRA 4M7JL 3DMMA 3TA3D 1SEBA 2OJZL 3C09B 2VDLH 5I8EB 5GS1A 3DV6B 4OM0H 2CLZB 2P45B 2FJFA 1GHFL 4JQVC 1QA9B 3GJFB 1PLGL 2H3NA 5FYKL 1S7TA 4MAYD 2F74B 1DBJL 2RB8A 4NO0A 1IM9D 4APQC 4OCLC 1A7NL 3QQ3A 4U1IA 1FNLA 2Z4QA 1VADA 1FLRL 4JM2C 1HDMA 3LRHA 4JO1L 1T1WA 4UINL 3FTGA 2X9WA 1M6OA 4L8DB 5C09E 4UILH 1RJZA 2XYCA 3WUWG 5D4QA 4DZBB 3GSOB 1IL1B 2MPAL 1IQDB 1BQSA 3R8BB 4UIKL 4ESKA 2EH7L 5GRUH 3AB0B 4R4FH 3ZE0F 5HGBB 4EXKA 2BFVH 1P7KA 1CXLA 3VXPA 1FORH 4KUCD 5GS1B 3UTPD 1KXVC 2IH1B 3QWQB 3OAUL 5ISZB 2HWZH 3MGTB 5IVXA 1P4LB 4G9FE 5IHBA 1YPZE 3MRQB 3SKJH 5E9DA 2BVPA 5IMOA 1UM6L 3ZDXF 2ADJA 4X4ZA 4XPTH 1IFHH 2W0LA 4AIZB 5EO1A 4EOWH 1M7DA 4Z7WB 1K3ZA 4HS3B 4Y16A 1BBDH 3S36X 4HFWB 5D1QB 2F58H 5JA8B 1M7XA 5TGBA 1MCDA 4MXVF 3BQUD 4XHJD 3KPRD 4R8WL 4JKLA 2DLFL 1MLCB 1RZKL 3F6LA 3E8UL 4R7NB 1CL7I 3ISWA 3QEQE 3WXVH 1BOYA 3FCTB 4RGMB 4QRPB 4M93C 2UZIH 1DN0B 3QUYC 1EEZA 5BZDA 3FFCB 1OHQA 2LTQC 1RZ8B 4X6CE 2PW1B 2FJFB 1I8MB 3S96B 2DQJH 3LY6A 4FQPA 1CE6B 4M6OL 3QBTB 4RBPH 2EIDA 2QADB 2VDNH 2DJSA 3QXAB 1PY4A 2C1OB 3SJVD 1JYNA 3IU4L 4FQHB 2ADFL 1MNUL 4JQIL 1HQ4A 4YO0A 2DIAA 3NZHH 5J57B 3CZFB 1UZ8A 4WHYG 3N9GL 4QRQB 3I3EA 4C58B 4YPGB 4EDWH 3HZKB 1ZWIB 1ZGLM 1MCCA 3CDCA 1NAKH 5IB4B 1E27B 1J1OL 1CICC 3V52L 4O5LL 1K85A 2R0ZH 5KTEH 5HYSA 4CADA 4Z78A 3DSFH 5J12B 1MHPL 2NY4C 3FB7A 2DQFB 3X13B 4MA3A 4ONHB 4YC2B 1J0ZA 2VL5A 2M8XA 4I1NB 4JLRB 1YEIL 5I1LB 3UTSB 4WGVB 5JNYB 2CDEA 4HLJA 1XH3A 2CRZA 2CXKA 1RUAL 3I85A 3FAXA 3S5LB 4HGWA 1IAOA 5F9DC 2NYYD 4P9ML 4MSWA 1MY5A 4GXVL 5E8PB 1NJ9B 2E5EA 4CMMB 1A6AB 5ICYB 2D9QB 2H2PC 5F93C 3KXFB 3KPMA 3P4MA 4R4NC 1I8IA 2XKNB 3OKKB 4TUOA 1MAJA 2P48B 2HJLB 3MRRB 3QZWA 4N8VA 4PGEB 3WO4B 2HKFH 5KBNC 3U36B 3MLSH 2F5BL 3BQUB 5FM5M 2HMID 2ARJA 3HPLB 1QACA 2IH1A 4O02H 5EZJB 2AABH 4BQBA 3DXAD 3IJSA 4OBSA 2DN7A 1LEIA 4H1LG 3LEYL 3VXRA 5F1NB 2BFVL 4OBRA 3U0TA 2ZG1A 5DD6A 2BSSA 4WUKH 2X1XR 3FHAA 1FFPA 5I74B 5HHVL 12E8H 2X6MA 1MCSA 3P40A 5T3ZL 3CH8A 1OTSD 4Y19B 3P4MB 5EUOF 1GOHA 1KB5A 4OGAC 2I24N 3CLEL 4OLWL 1TZIB 3CUPA 5ITFB 2VDMH 2YD2A 1UKTA 4WEBH 1QKZL 1WBXA 1DBMH 1GIGL 5C0CA 2VE6A 4JPIA 3EDKA 4FQXD 5D6CA 4R2GD 2R1YA 5EBMB 3EOTH 1K2DA 4PJFE 1OW0C 5EG6C 2DLFH 3D3VB 2F53E 4N0CC 4J6RL 2NY1B 5HJ3B 5IHZA 1LK3H 5GRWA 3OZ9L 4CMHC 1UCBH 3QDGB 3OKEB 3WNMA 1DBJH 4U1JB 3MNVA 3NMEA 3M17B 2C1OA 2X09A 4KKCD 4J3TA 2HVKB 5D9SB 4GUPA 3KLHC 3NZ8B 5E95B 1RJYB 2HFGL 1R3HA 2PO6C 4HC1H 1G6RB 4OCNC 5CBAA 1DL7L 1LVEA 2MSPA 1LDPL 3X11B 1NFDF 1RHFA 4QRQA 3QDMA 1XGYL 3HAEB 4JHAL 3VGAC 4GH7B 4KVCL 2BY0A 4GKZB 4D0CA 3KJ4C 1AHWB 1EHXA 1MNUH 4JQIH 5LWYH 1H0DA 4QXWA 4WI5A 4I0PC 3GSNH 4LF3A 5ACLA 2QTEA 2E7CA 4EDWL 1B0RA 3HG1B 2R4SL 4ZNEE 2XA8H 2QKIB 3TBTA 5KANG 3J7HA 1TZHB 4WO4C 5TGBB 4NFDA 3MA7A 4OIIH 4LEXL 3GEWB 2CKBL 1S7QA 1KG0B 1T04A 4ZYKB 1YUHB 2Y07H 2ERJB 4KI5D 3DMMD 4QHNA 3LEXB 3DHJA 1NJ9A 5DJDA 3JV0A 2IANA 3WLWC 4ZOEA 1RK1A 2EEAA 3IDYB 4ORZC 3E8UH 3OXSA 1A0QL 4KZEL 1Q9WA 3V4UH 1MHCB 3AS0A 4N0CD 4RAVA 3S36L 3UTTD 4A2LA 1F4WL 5DFVC 3IVKB 2DQTH 3ARWA 4JG0H 5HSFA 4LSUH 2QHRH 2EIZB 3LKOB 5EIIB 5CFHA 3H7BB 2EDTA 2JB5L 4E0RA 1G0YR 3H3PL 5EUKA 2WWMD 2C3WA 1RIUL 5JW5B 2AEPL 4DTGH 2IBGA 4X5LA 3GHBL 5KS9B 2AXHA 3SGJA 2E6PA 3MCG1 3AMKA 4M7ZC 5JPMB 4GG8A 3BESR 3LEVL 3FQUA 3AS2A 5CEZE 1A3RH 5EN2A 3NBNA 4K7PY 5T3ZH 3FRUB 4XBEL 2LFGA 4HUVB 1QSEA 3BP5B 2VLRB 5JORB 3DRQA 1TQBC 2W65A 1YJDL 1X44A 3NCYP 4YDVA 1VB9A 3DX7B 1FH5L 2YKLL 3TBSB 2B5IC 5CINL 3TWCH 2CIKB 3L3OB 4AENA 2VDRH 2QLVB 5ITBL 1KYOJ 2R2HA 4YXHL 4AL8L 4U05A 1WAAA 1JZ7A 1Z3GL 4Z5RB 2VTFA 1SY6H 1R6VA 4JM4H 3IJHA 5LCVH 1RUAH 1MCWW 1RZJC 2VLMD 3P4OA 4E9LA 2WP3T 1DN2A 4RGMC 3QEQB 3D0VB 3CAFA 4OV6F 3I50L 3W39A 5HPMB 5J1TC 5DEZA 2X4SA 5F71A 5ABDE 5DJ8B 5ESQB 4CBPA 4HUVA 4KY1H 1K5NA 3AB0C 5T3XH 1Z6JT 2RR3A 4IOFD 5B39A 1UVQB 5FGRA 4KROD 4L8SB 5M7QA 1F3JA 3WUWB 2VWEE 1RULL 4JAMA 4R7DB 3VXNA 3MA9L 3GI8L 4N9GB 5DFVD 5JUEL 1IEAA 3VDBA 4UQ3A 5DSCA 3BPCA 4MA1C 2EH8L 2WSKA 3X3GH 3S88H 5J11C 2VB5A 1XGTB 4K7PL 2C4FU 5DQJB 4ZXBD 4ZFZA 1UH4A 3UO1L 3KYNA 4AM0A 1UWGH 3BRGC 1YPZB 1Z0NA 4IIQA 3ZL4H 5ADOH 5LXGH 3T65B 5DMIH 12E8L 3DO7A 1J7VR 3BZDA 2VXVL 4F37F 1TTFA 1A02N 4MNGA 5JOPD 1NGQL 2CKBH 4K3JH 2VDML 3VMPA 1BP3B 4N9OB 5IG7A 4Z6AT 3PWUA 2CJUL 4W6WB 3GJEA 4YDKH 3B2VH 2Z35A 5K59F 4P2OC 3KPSB 3KLSA 3NFNB 3PQYB 4MB5A 4JRXE 5IMKB 1MFCH 2VLRE 1A7BA 2PYEE 4L8BA 3E6FA 5JXED 5DRXA 4XNZC 4D9LL 3KVQA 3IDJB 4ETQB 3TA3A 1BJ1J 1SBSL 3QO0B 5ALBH 4HPOL 4OQTL 2NY6D 5I8EA 1R3HB 4PPTA 2DYPA 2DYPD 4JFDA 2YC1A 1AP2B 1DFBL 2AXFA 2WQ8A 2ADGB 2Y06H 4I3SH 3OX8B 5FHBL 2XTJC 3QNYA 2UUDH 4JN1H 4WCYL 4XX1G 5J9PB 2E7LC 3UP1A 4BKLB 1ZLWH 1HDMB 1UT9A 5HHOD 3V6FA 4HK0A 5KN5B 2W0KA 3DXAA 1X7QB 2B8OT 3JV4A 4KVCH 4XPAH 2Y4SA 2VZVA 5D6DA 4NT6B 3DJ9A 3GIZL 3TJHC 2Y6SD 4KTDL 4YHZL 3GHBH 5B22A 2OTUB 4Z7WF 3H0TA 5H2BA 2R0KH 4A6YB 1BZ9A 5C0AA 1RUQL 5C0AD 5I71C 3AGVA 4LKXA 2W9EH 2X1OA 3U30B 3LH2H 4M5ZL 5EO0A 4FZEH 1X5KA 2R4SH 4ZUSB 1KT2A 4FFWC 4YHLL 2Y36L 4JEGB 4D0BB 4LEXH 5EULV 4HG4K 5DURB 3VGDA 3G6DH 3BUYA 1KACB 3QEUB 4X4XB 2X4NB 4F3FA 4QXGH 3BIAX 3SQOH 4HQQL 4PD4K 1AQKH 1C7TA 2F15A 1WC7B 4YHIB 4YXKH 5DUMH 3WJJC 4O2FB 5FM8A 2BNQB 4RDQG 4WI8A 5F7DA 4YDJB 3EJJX 1NFDA 1LO2L 4JM4L 3BZEB 2VL4A 3RTQA 4D9RD 3HUJA 5D7KE 1PG7W 2OM5A 4L3EA 2Q86B 4NQXA 4K2UL 4HJ0D 3HC3H 2FEDD 1D5IH 3FQXB 1N59A 3D2UA 4I48B 3WJJA 3WFCH 4LSRH 3MV8B 3O4OC 4H88H 4NNYA 2RCSH 3V4VL 3H9HB 3QPXL 1D5MB 4WEMB 4CMHB 3WFBL 1W0YT 4G42B 3LDBC 3D6GA 3ARBC 4ETYA 3L3GA 4PJIA 5E94A 2FEDC 4OKVA 5IB5B 1JP5A 3DUUA 3MO1A 4NRZB 1R5VB 3O6FA 3RGVA 3O6FD 1A3RL 2M2DA 4K94H 4LLUA 4PJHA 4AEHH 4UV7H 1MWAA 2HKHH 1MQKH 4YGVB 4Y4HD 5DUPL 1GC1C 4LU5H 5ECJE 1T0NB 1NGQH 1LP9B 4JFOB 4G6AC 4LKXB 4NNPL 2R29H 1Q9LA 3J8F7 4LAQL 1K4CB 2CLZA 1WWBX 4WU7A 3TH2T 4NRXA 3NCMA 3TLRA 2FIKB 3PGFH 3WFHB 4XH2A 1UH3A 4XMLL 5FUZL 1GVIA 1K5NB 1CWVA 1YN6A 4PRNA 3KLDA 4KAQL 1EEUA 2AJVL 3KPQA 5B3NA 1XMWA 1TFHA 4TQEH 2P5EB 1C08A 1Q72H 5E6IB 3MLUH 1UG9A 5SX5K 3M45A 5B8CA 2XI9A 3QUZA 4PJBA 1TQBB 4KY1L 1DFBH 2EZ0C 4HUXB 4RFOH 1N5YL 4ACPA 2FSEA 2WMPA 4Y88A 1OTTD 1RULH 3DVFA 3ME0A 4M1GH 5JDSB 2B2XL 5CKAA 2F8VA 4WFED 1XGPA 3HCVB 3U4EA 4PRIE 4KKBC 2H2PD 2YPLD 4TUKL 3RVWD 4W4OC 3WXWH 1U6AH 4HIHB 4XPAL 4J3UA 5E8OA 2Y23A 1BX2B 3L95B 4CN6A 3OSKA 3MX0A 2WUCL 1CGXA 2XOTA 4ZDHB 2W0PA 4X98B 4KQ4L 1RZFH 3SKMB 1RUQH 2W9EL 1KIUA 4JDVB 4WI6A 1V7MH 3MGOA 2G5BA 4QRRE 5DMIL 4LMQI 4W70A 1CIDA 3FFCA 1R3IH 4JJHA 3HFMH 2GAZB 5KSUB 2R69H 3VMNA 1T0PB 1WFOA 1FNSL 1JF1B 1MF2L 4S0TD 3E3QE 3V5HA 1VEOA 2GI7A 3BUTA 4KK8D 4ZSOE 5CJQH 1JWMA 3SBWC 5I15L 4YDKL 3B2VL 2PXYA 5SWQB 1MLBB 1PG7L 1Z9OA 4ELKB 3VXPB 1MFCL 2UZYB 1R24B 4L4VA 5TE7H 4KRMB 2OTPA 2CDFB 4GW5B 2DQUL 1E4JA 3QIWC 5ALBL 1H5BA 5AZEH 1G9MC 5IB3B 1X9QA 2OR8A 5EPMB 1JK8B 5D2LB 1KCUL 2C3GA 4Z7VA 3MBEB 2A6DA 5T1DH 1JF1A 1KPUA 3U0WL 4B7LA 2P47B 5F7NC 3Q6FB 4XP4L 4TSCH 1CXEA 2UWEF 4PJEA 3ZKXB 2NTSP 3T0EB 3VCLB 5JW3H 4U7MA 4X83A 3OKNA 5GJSL 5J7CC 1RZJH 3AU1B 3RTQC 4PJ5B 2FATH 4XPGH 3WNNA 1I8LC 4KRNA 4NKQB 2AV1A 5DS8B 5DJXA 3JVGC 1U0QA 1UQSB 4HEPG 3LH2L 1H3TA 4GMTH 1JF5A 4PRHA 1DEDA 4CADB 1BIHA 5E5MA 4FZEL 1HH6A 1JMZA 1KJ2L 4F7EB 5EU6A 4Q2ZB 2Q1EA 1CT8A 2MQCA 5B3JE 1C16A 4LU5L 2LVCA 3MRGB 2R2BA 2OP4L 4LSSL 4CN4A 1EAPA 2NY3D 4XC1H 4UDUA 4D3CH 3SE3A 1BLNB 2W65B 5ACMA 3VH8G 3KR3H 9CGTA 2F53B 2Z0BA 3UEZA 1AD9B 2D7PA 2O61B 5M94B 3OJDB 3IFPB 5FK9A 3RU8L 5BO1H 3A67H 2D3VA 2DI9A 4OZGB 5A2IH 2H2SD 4LPVA 3MRLA 4OI8A 4ODXA 1HQRA 2HTLD 1MJUH 4U1SA 1A4JB 1MCFA 1D5IL 2ADIB 5AZ2H 1MOEA 4UNUA 3T2PA 3S8WA 1Q9KA 4GW1A 3EYVA 4UINH 5F6HJ 3G9AB 2FHBA 2P1YA 1JGUH 3BOVA 2CK0L 4NKOB 5JOFA 3GB7B 1BJ8A 3ALPA 1H15A 2OXHA 4J3XA 1J0IA 4P4KA 3RKDD 4UIKH 4XNQA 1YY9D 4XPHH 3TV3L 4CW1B 2BY3A 2B39A 1KLFA 3C5ZC 1FFNB 2ILLA 1NC2B 3BEWA 3H9SB 4PRPD 3PL6A 4GSDL 2DKSA 3GSUB 4JDZA 3I2CH 1ZSDA 3E0GA 3V5DB 4NHCH 1AFVL 4GG8B 4Y4FA 1Q0YL 2OR9L 4RISH 1BFVH 1DSFL 3U79A 4AEHL 3L5XH 5AYQA 2HKHL 5K59E 1A6TB 5HD8C 2VLKE 2ITDB 1NBZA 4F7MB 4PGBA 1H15B 1NUNB 2X4PB 2LU3A 4QT5B 1INQA 3MLRL 2PO6B 4ZYKA 1PZ5B 2Z92B 1EO5A 3UX9B 5IHZB 4OZGF 4NO2B 3VXRE 1FVDA 1N6UA 2AJUL 4TNWF 2W9LA 3RKPA 3CVHA 4U49A 35C8L 5FYKH 4KAQH 2A2QT 4OUUB 4WI2A 4JRWA 4AYFA 5IFAL 2W60B 2UZIL 4OZHE 3AREC 5D7JA 4JKPH 1W8OA 1T20A 4NQEA 3TCLB 4R6UA 3MOAH 1TTUA 5E1HB 4KI1A 4PRPE 3W39B 3HI1B 3BVNB 1IE5A 4LLVA 1QHPA 4RWYH 3C08L 5I16B 3MUY1 3P2TA 3O3BA 1K8IB 4WUUB 1A6WL 3PWLB 3D0LA 3ZDYF 3L7FB 1N0XH 5FOJA 1ZA3B 1IGIL 2WUCH 4W4NA 3QJFB 2GFBB 2IF7A 1J1PL 3FO9B 2F8XC 2EDYA 2KZWA 4HKJA 1PQZA 5INDB 4AT6B 5J1SC 3SKJL 1FIGH 1EGJL 1WZ1L 1CD0A 4JFFB 3KPNA 1ADQH 1QFWI 3TZVC 2UY7A 3BE1H 4U0RC 3HR5A 1XFPA 4RBPK 2DM2A 4YBQC 5ALCL 4LSSH 1ETZB 1HCFX 4Q9QL 2X5PA 3N06B 3HI5H 4LCCC 1YEHH 3EYUH 3UBXB 3CVHL 3GBLA 3WXVL 2QJDA 5F7MC 3UYRH 3ILPA 1QFUL 3QUXC 3K3QA 1EK3A 5BVPH 3LKNA 2O5XH 5E6IC 1DBAH 1P9MC 1N7ML 3VFWB 3GB7A 3BZEA 5EO0B 1JFQL 4DGVL 3G08B 3HE7A 3SO3C 4JQXA 4L3EB 4OKVB 1KG0A 1RI8A 3BKMH 2D9CA 5ID1B 2CMRH 2DQJL 1KCVL 1F45A 3MRBB 2E27H 2GUOB 4TSCL 4EQ3A 4ZD3H 4KPHH 1I9JH 1AO7D 1DUYA 1VACA 2GJ6A 4IIQB 2EKSA 4HIIA 4J3WA 2KPNA 2DBJA 4F8TA 3QWOA 4RMUA 2KZ1B 4PBVC 5DUBA 1KLGB 4UQ2A 1U2HA 4XPGL 4HJGB 1NCBH 1QR4A 4CVZB 5HYFA 2ARWA 4PP1D 1E6JL 1A7PL 4WVRA 4Z18A 4PTUA 4RISL 2R0ZL 3PL6C 1F3JB 4OQ1A 1U8MA 2RAMA 1RD6A 2G60H 3KPLB 3WL9B 1MPAH 1J0JA 5F1IA 1JYVA 4X6DE 4HKJB 3W81A 1VACB 2GJ6B 3F7QA 2NW2A 5IT2L 5H37G 1HEZA 4O9HH 3ARDB 4G6JH 2Z35B 4K3DL 1GPOL 3I6GA 3AAZA 4HLZH 2DQGH 4IS6B 4DKDC 2I9TA 1VENA 2QQKH 3UC0L 2PW2B 5IB5A 3N1GC 1NBYB 1RZGB 2BNQD 2AQ1A 3VGEA 5C0EA 4DVBB 1NDGB 4PIRF 2P49B 3QNXA 2E8YA 4E42A 3L5WA 4OD3L 5C6PB 3MRDA 3QG6A 4BA8A 1ONQA 2ZUVA 3LKSA 4XAKD 4ZTOH 2OTUA 1NBVH 5T1KA 5EU3A 3TYGH 5CILH 5C0FB 2VLRD 3TBVB 1CIUA 1KIQB 3D2UD 4RGND 3STLB 1O0VA 1XR8B 3T8XB 1WQVT 4QCIB 3T0AA 1JGUL 2CK0H 4J23A 1QRNB 4WGWB 1C8PA 4U4BA 3VI4E 2J4WL 4LQFL 4J1UB 1DVFB 4YZFF 5IMMA 1YQ2A 4HWEL 3ARTA 2HFTA 3OKMB 4X6CA 3IFNH 1D6VH 3KPOA 1FVEB 1HSAB 2QQLL 4OGAD 5D7IE 5DD3L 1IZJA 3RZCC 3MO1B 4NRZA 2XA8L 2B0SL 4WNQA 5J13C 4NOBA 4M1CD 5FYLL 4X4XA 1OP5H 5TF1L 3OX8A 4AEIH 3CC5B 4Z7WE 3ULVL 5JZ7C 2N56A 1XR9B 5LBSL 3UBXA 3GMPB 3QQNA 1FGVH 1MIMH 3IF1A 1U8QB 5TFSL 2VSDA 2AW2A 2VAJA 2B1AL 2FR4B 1MFAH 3QZWG 4N8VG 5MENE 3OG6B 3GM0A 3QQ9D 2V7NA 3PIQA 5DJ6A 5GJTH 3G5ZA 4R97C 2Z31B 3MROB 4KXZH 4MA8H 3PQYE 1Q0XL 4AMKL 1LK3L 3TH4T 1BD2D 4NNYB 1NLDH 4UDTA 5IVXB 1DQLH 1FZJA 4QYOA 4J12A 3C2AL 3HZYB 5D5MF 1RFDH 4WFFE 3EHBC 1ZLWK 2Q86A 2DQEH 4MA1B 5E8NB 1J12A 4LMQE 5D7KD 3X12B 3VW3H 4LNRA 3BKML 3ARXA 4RNRB 2HFGH 4JREB 2X4QB 3GMNB 1CLCA 2EECA 4PJ7E 3QUXA 3RRQA 5DC0A 1KCVH 5FF6B 4Q97A 1ZLVK 5ENWA 4ODSH 4Z77B 2N7AA 1HH6B 5E2JA 1LEKB 1KXQE 2H32A 4Q9RH 3RGHA 3RIAF 4ZXBB 4Z8FH 1FE8H 1N0XL 2DQFA 4U0RB 2D0GA 4Y0GA 4NQXB 1KT2B 1EZVX 4QGYA 3WN5B 5ISZA 4NO5B 1CICD 1BREA 4OUOA 3EGSB 3BPLB 4G5ZH 1A7PH 4QRRA 4FQQA 5CZVH 4W6YB 3ZMRA 1N3NA 5C0BB 5IQ9A 4Y2OA 1QO3B 2ZSVA 2YKLH 3AAZB 4OCMC 3I6LD 1YC7A 4MQ7B 2HVJB 3PWJB 3ZHLA 4CDGC 5SWSA 2OMBA 4G80A 1HQ4B 1MFEH 4G8EB 1R0AL 3OR6B 4MJ5A 1YEHL 4C4KO 5ETUA 4OZFB 1A0QH 4HWZB 3QUZC 2E9WA 4RMQA 2DLEA 4CVWA 3HTLX 4MX7B 2PXYC 4BZ1L 5HHQA 5KVGL 4OLXH 3MV9B 2AK4B 3HA0A 2WINA 4OCRH 1QLRB 5FGBA 1EFXD 3H6JA 1BEYL 5C0ND 1YN7B 5EBLB 4LSUL 2ICWA 1G7PA 1I7TA 3MA9H 3QNZB 2JB5H 3VWJA 2R15A 3EOAB 3H3PH 3UJJH 1MWAH 4ZD3L 4L4TE 4LLMA 1AQDA 3L6FB 3HNVL 3OB8A 1JBJA 5HTSA 1MI5B 3MLWH 1I7UA 3CFEB 4MQXC 4JPKH 3P73A 4PJ7B 4LLQA 2ZCKH 1SY6A 3V8CA 1MLBA 1BAFL 4R4BA 3VFMA 4YDLC 4ZQKA 4LPCA 2VABA 1LO5B 4OFKA 3TO2A 2J5LB 2QBWA 3BHBA 2JB6B 3NABH 5E4EB 4LPWA 3L5IA 3O6KH 3SCMB 4UT6H 4LCUA 5C9KA 4Q74A 5TF1H 1UJ3A 1RIVL 4YHML 4FXKA 5JQHC 3QNZA 2GAZA 3W0WA 4P5TD 4BK5A 2I5YL 5JDJA 2XTJB 1I3RA 1JZ8A 3UDWA 4LARH 3TIDB 2Z9TA 3TO4C 3LKRA 4X7TA 1DQDH 2ZUQC 2WIIA 1NGPL 3HKFA 4O9HL 1EAPB 4KTEL 4PJHF 1GPOH 5GJTL 1G6RA 1MCWM 3MYJA 2QQKL 3QYCA 3UC0H 1E4WL 2A83A 1RZIB 4OQTH 5CLWA 4TNVK 3GUTB 4GAYB 1RUML 4L29A 4Y19A 5HHOB 1TNMA 3C2AH 4UZGA 3KDMA 5SWSB 3UZQA 4WV1C 4HKBA 5T3XL 4KTYA 3CSYB 2D31B 3NOIA 3DECA 3WMSA 4X6FB 1YNKL 5FHBH 3O45A 4WCYH 3QXUA 1BOGB 4KJQD 2XV6B 4PRBB 2EYSA 2NX5B 1A9BA 3JTSB 3RWIB 4HK3J 1K6QL 4Y1AD 3G5VA 2EDHA 4OCWH 2A9NL 3NCJL 4O4YL 4X99A 2COQA 2WK2A 3A6CL 1ITCA 3GSQB 1HKLL 4KTDH 4YHZH 5HBBA 4PRNB 2X41A 3CZFA 3ORJA 5IVXF 3DVNA 5JIPA 3ALWA 2A83B 5ADOL 4AH2B 1M05B 1U8PB 1U3HC 2N4IA 2IG2L 1X5XA 1BLNA 3U82B 32C2B 1TVHA 1WEJL 5FYLE 2B0SH 2CUMA 1RIHL 1FVCA 2BC4B 1J86A 2HT2D 4PJBE 2J6EH 4GRMA 1EXUB 4HQQH 1I9RH 2EDOA 5A2FA 1JPFA 2BCKB 5JXEC 4P2OB 3RI5F 5IGXH 3M1BB 4F57H 5BV7L 2YOCA 4WTWA 4JGJA 4WFEE 1G9MH 2GJ6E 3T0EC 4D9LH 4KI5F 1A6ZB 1L6XA 4NC2B 3RZWA 1T83C 3LKOA 5EIIA 3C5JB 1A64A 2EE6A 2XY2A 2X7LB 4EBQH 4OI7A 5IESL 2NTFB 5TQ0L 1QYGL 3BPCB 5DD1H 2V6HA 3ARDC 5FA3B 4BZ1H 5KSBB 5KVGH 4HGMA 4NM8L 1XGUB 3WNPA 5KS9A 3VG9B 1EAJA 4OCRL 4Y4KA 3O4LD 3QPXH 4ODWB 5FGSA 4PJXF 3F7YB 1JWMB 2HVKA 1UB5B 4WWKA 3GMOB 3O6MH 4MS8C 1VGKB 3OXRA 3A6BL 5EOCL 1BVKB 4PV8A 4ENED 1YEJL 3QDGD 5KSVB 4FG6D 1U3JA 3JXAA 1NDMA 2VR5A 2ZG3A 5KVEL 2ORBL 1MI5E 3QFJE 1ZLSL 3CX5K 4NIKB 2V5TA 2ZCKL 4KK5D 2BOBA 5FYJE 1S9VB 4LF3B 3F58H 2NXZC 4XX1E 4Z7NF 2A77L 4AEEA 4URTB 5HYIA 1HEZB 3QEGH 1QSVA 1L9NA 2XG4A 3UTSA 4EUPB 4Y8AA 5HGDB 3P4NA 1U8PA 1AD9A 1FL6A 1JE6A 1R3JB 3OHXB 4IMKC 5EB9A 4YWGL 4WTZG 4NBXB 1AP2A 5BCAA 3B5GA 4TULL 1UGNA 1NGZB 1JN6B 1T1YA 5D93B 2BOBB 4YIQA 1WISA 4GUPB 3QFJA 1CD1A 5D1ZD 4HF5H 3WJLC 1R5IB 1P84J 4LDOB 4H25A 2GTZA 2X4UB 1H3GA 1GJIA 3VDCA 2YD3A 3MFFA 5CEYB 4HWNA 3GMRB 3MUGA 3C8KA 5DC9B 4V1DA 2P5EE 1Y0LB 2ITDA 3QRGH 4IOIB 5F1NA 5ESVB 5KSBE 4NN5C 3U2SA 4NHUB 2VXTH 4OKDA 1DANT 1VEMA 1K6QH 5EORH 3GMMA 3L3DB 1INEH 2NR6D 4AQOA 3GSNA 2CH8A 4AK1A 3BZ4A 4WI9A 1HINL 4XXCC 3BWAA 1PAMA 4JZJA 2PTTA 4DK3A 4M62L 1TZIA 3WO3B 3V7AG 1BQLH 1J05A 1CICA 4OFYD 4NPYA 1R3IL 5IW6B 3ROLB 4NQCD 4F8QA 2AQ2A 1IILE 2A38A 2VISB 2R1YB 1F3DJ 2EE3A 4FTVE 3HE6C 4ELMF 1BVLB 4RAHA 4G3YL 4QRPD 4QRPA 5HYJE 3WFDH 5FCUL 4RMTA 2BDNL 4PJGA 3ZKXC 2YPKB 5HXMA 4RWHA 4XMLH 4IOSD 3I02B 2D31A 5J9PA 4JRXA 2DQUH 3DV4B 2NY0D 4LRNL 5HI3C 2ZSWB 5I1IH 3SJVB 3O8XA 1S7UA 5LG1A 1ZLVH 5GGUB 2IQ9L 3R8QA 1ZGLB 4IMLA 3BT2L 3RWJA 4YHPB 3R4DA 5SX5H 4X7SL 4KZDH 1BZ9B 4NDMA 4EUPG 3C6LB 3STZB 1M4KA 1ROWA 3QIBD 5IUSA 1G7IB 4Z95L 1AGEB 1D9KA 4OAWA 3BFOA 4DZ8A 5IBTL 3AS1A 3WFEL 2I9LB 2VAAA 4M8QB 2VZ1A 4KDTC 5L2KE 4GKSA 5L2JB 2NY1D 1RHHA 3U1SL 4E41B 5A40E 3SGJC 3C5ZD 3FO9A 2DLTA 4LFHD 4G6ML 3LQAL 5KVEH 1MRCH 2EDQA 3K8MA 5ERWA 5IK3B 2VXSH 5LKNA 5CLTA 4WU5B 2F8OA 4RZCA 3VDAA 3TBSA 1HILA 5GXBB 3ARBA 4PRHD 1RIHH 1ZA6A 3FT2B 4FQHA 1C12B 1YN6B 3WKMH 3TPUB 5CJQL 5BXFA 2M26A 2VDQH 1UZ8B 4AG4L 1D9KB 1UXSA 3RDTB 3HZVB 3VGHA 3VFNB 3C6LD 1L0QA 4R2GC 4Z7QF 3JVGA 1A7RL 3FB8A 1Y6MR 1RUKL 4ODBD 2HTKC 3SY0B 5CAYB 4Q6IA 5KSBF 3JWOC 4NO0D 5I1AA 4LPXA 3TA3B 3DSNA 1KFAL 1RVFH 2XKSA 3V0VA 3RVXC 1QYGH 4R7NA 4HSQA 4OZFA 2YXMA 4R97B 2FEEL 1BVKA 4PV8B 3SE3C 3NCCB 2Y9RT 2ZKHL 1R5VA 4U7KA 3HZYA 3TJEL 1JZ5A 3G04B 3ZKND 1CXKA 1DE4A 2W07A 5GS1C 1CLOH 1KULA 3F7RA 4XCNA 3DROB 2ED8A 4XAKE 1U8IB 2NX5E 4KUCF 4XPHL 3TV3H 5CP3A 3S96A 5HYJD 3PXJA 3SY0A 3GSOA 1BFTA 1U92A 3JWNC 2WBWB 2YXFA 2ZUYA 5IW6A 4OLYH 3ULUC 1FGNH 2BRQA 3KYNB 3UTTA 3C5SB 4UAOC 1D6EA 2P8MB 1JCKA 3G6JE 1I1FA 4XMKL 5EU3B 1BFSA 2FL5A 4G8FB 1G7LB 4ZAKD 1CFSA 3EJYC 1QSFA 3VFMB 5D2NA 4OF7A 4P4RA 3ET9F 1QR1A 1GC1L 4S1RL 5FV1L 4XC1L 5HGHB 4I0CC 1WAAF 1U8IA 3UJIH 1YYML 2B7DT 2OZ4L 3B5HA 3O9WC 4U6VL 1KNOB 3P30H 5CBEA 4K71C 5A16B 5BS0D 4HH8A 1QVOA 4M6AA 3T0XA 4HWBH 4DUXA 3PGDB 4PJDF 3SN6N 4PJ8B 3RA7L 2HVJA 3AFLA 3PWJA 5SWSD 2X1PA 5FO8B 3BIKA 3T08A 2PYEA 4FQLH 4NKDB 1VKXA 3QDMB 2FLRT 2QADD 3K0WA 5AZ2L 3MYJB 1G7IA 1UM4L 1MHHA 1ZT1B 7FABL 4I4WB 1G6VK 3WDHA 1ZHBB 5D6CB 3MRMA 5EH1A 3MV9A 5GZOC 1U8HA 2GJZB 4DJMA 4BQCA 2J2ZA 1Z9LA 3PWPD 1WV7T 3JUZA 2I25N 3IB4A 3PWPA 3C08H 4S1SL 5AG9A 3L7EA 4LNRB 1PW3A 3VGGA 1QD0A 4KK6C 4Z95H 2YHGA 4BH8B 4TSBH 4JFXB 5F7HA 5H35A 3VG9C 4IMKA 4HK0B 2NY2B 4GSDH 5EO9A 5F3HB 2V2XA 5JHLL 4ZO7A 5E2WL 2WBJB 1EJ6A 3VWKD 1ZVHA 4MLIA 3D18A 4FZ8H 4JFPB 4WNQB 4DWHA 4O2CA 3T1FA 3TVMC 1ZT7A 2VZSA 3UBXI 1T2QH 2BVYA 1QSZA 5EC2B 1SYVA 3BGFC 4L4VB 4KJYA 1NSNH 2WUBH 5D7SH 5EZJA 3OJ2C 4B0MM 3GJFH 1GGTA 3SCMA 4AG4H 4OLZH 1U95A 3DV4A 3MBEA 1S9WA 3KXFA 1FAKT 4F2MA 3PP3K 4PJIE 1J0YA 3O4LB 5GS0D 1I1YA 3EO0A 3Q3GB 1FVEA 1FQ9C 5TE4L 2A1WL 3C8DA 5HGHA 4ONGH 1IGYA 2C5DC 2DL2A 3KLAB 5F72S 1D5ZB 4X6CF 3RWGA 2RGSA 3G5XA 5CKGA 5HDQH 2H32H 1JFQH 4DGVH 1I1AC 3U9PL 1CFNB 2J8OA 3MOAL 1T4KA 4XCEA 1KCKA 3BPOB 5L2JA 4X7SH 4KZDL 1F8TH 4RWYL 2E6QA 4S1QH 2Q76A 4PJIF 4KPHL 3SDXE 3IDMB 5IB1B 1WT5C 3ULVD 4JY6B 4ZAKC 3AM8A 3GNMH 2DD8H 4LEOA 3GI9H 2GSGB 3LQAH 1SEQL 1P53A 2JCCB 5F8RC 5I30L 4P9HH 5GGQH 1HOCB 2VXSL 1MJ8H 1TLKA 2EIBA 3IS1X 1FJ1B 1WZ1H 4J4PD 2YD6A 1ADQL 1KTDB 1TJIH 3MYZA 3NIGE 1G7MB 3QWRA 1KIRB 1QVOB 3WDJA 4JO2H 1MPAL 4NQTA 1T6VN 3NH7L 4JCMA 1S7WB 1VFMA 4X5XB 2NX5D 3MR9B 3VRJA 5GSVB 2UV3A 3TBYA 1IM3B 1XEDA 5C0CB 2MQ3A 3IT8D 3VJ6B 5I8OL 2HRPH 1OAKH 3BQUA 4LK4A 1MEXH 4K8RL 1FC1A 2ERJC 1P4BL 2O5XL 4HMCA 4LPUA 2HTLC 1C1EH 4B50A 1T22A 4PV9B 2BY2A 5JTWA 4LVHC 5CMAB 3OB0K 5DJYA 3DX9B 4LLWB 4WENB 3QCUH 1H9VA 1GXEA 1Q9WB 1ZKAA 5KSBA 2VUOA 1MUJB 3QXTA 4NN6B 2DI7A 2VYRE 1XGUA 1UB6A 2H8PB 4NGHL 3VGFA 4I0PB 3S9DB 3VXOA 5FKAB 2KQNA 2HT3D 4LLUB 3H9SE 3QO1B 4EIGB 3KPRA 1YUHA 2BSRB 2AV7B 4HKXB 4XNXL 5GGRY 1A6UH 2DMBA 3GSQA 2VNCA 4PGBB 1BVLA 5T5FL 5DD3H 4B41A 4I8DA 3S4SG 3IDXL 4MNQD 1CD9B 5DRZB 1NSNL 1J1XL 2YA0A 1F2QA 3OR7B 3O45B 2OL3H 5GS2H 3MUGB 1F58L 3R0NA 4B7IA 1EH9A 1WCBA 2X4NA 1GAFH 3TN0C 1F3RB 4YUEL 3VFTB 1U91B 3MCKA 2XZAL 3VXOB 2AEIT 1KGCE 4KRLB 2HJFA 1FV1A 4UOJA 5J06A 3BZ4B 3KYKL 4LCIL 5IW3A 3FT4A 4YBLC 4OJFH 2NY0C 2Y25A 3BKCL 3IJYB 4ONGL 4LHUA 3PHOA 1OVZA 1NCWH 3OMZA 4Y4HA 1C5CH 3KHOA 4WUUA 1KPVB 2ZOKB 1A9BB 3MNZA 2FJGA 4WW2C 2KH2B 3O3DB 3VW3L 2AABL 5D1XD 4FXKB 4M48H 4BQ9A 2BOCA 2VIRB 3QFDB 4MD0B 2DM4A 1F8TL 2A6KB 1WBZB 3SDDB 5E24E 3FT3A 4EJ1C 1P84K 5C0BD 4WWKB 3T0BA 1HOCA 1OGAA 1IKFH 3P0VH 5EBWB 5HYQA 3ARGB 3U83A 4NQDE 3THML 2CUHA 3S6CA 3GMMB 5DZNA 1KCSH 1IMHC 1REIA 3MBXL 1FL6B 3OHXA 1U36A 1CGUA 1G7MA 2FZ3A 3VFPA 2QR0B 3GKZA 4PG2C 1WLHA 2ZSWA 1GOFA 2XG5A 3AY4A 2K7QA 4WW1A 4GRLB 3JWDC 3TCLA 3TIEA 5HGDA 4OZIA 5FKPB 5CEZH 4Z7OE 3FJTA 4RMRA 5E5MB 3E1F1 3FQWA 2BOCB 3P3YA 1IM3A 3HMXH 8CGTA 5IFHH 2IBZX 4YHOH 2NR6C 1AO7B 2E6JA 4Y5XC 3ZDYE 2B1AH 4OD1H 4LDLB 5F88B 1T5WB 1NL0L 3DVGB 4KK6D 1N64L 1UA6H 4P3CL 1K8IA 4XPFH 5IWLA 3IXTA 1I9EA 3MBEC 3EO9H 4HKZA 1DQJB 3VXTB 3TVMB 1XGQB 3CH1A 4HS8H 4O51A 2EDXA 3GSRA 3G04A 3HI6H 3RUGF 3EJZC 1HWGB 3QJHA 1DQLL 32C2A 3JV5A 4XBGA 2QQNL 2FX8H 4GBXD 1Q9OA 3QQ3B 4GFTB 3T3MF 2GJJA 3BWUC 5E94B 2Z31D 3GMOA 5ANMB 3BWAB 3NFNA 3PQYA 1CFTA 5GHWL 5JIKA 4FQ2L 2B4CC 3GSNB 4JDTL 1J8HB 3LQZB 3NCEB 2OQJA 4PY8I 2V2WB 4GAFB 1IC1A 1TJGL 2K3TA 3M8OH 2QSVA 4Y1AB 3NPSC 5IB2B 4DKFH 5C08A 3QIUB 1KJ3L 4PS4H 2EO9A 5EC1B 5BOPA 1NUGA 1FE8L 2VZUA 4GRWE 1HXMB 3WNLA 4HW6A 2WLYA 3V2AR 1OQOA 3IDIB 5JW4R 1SEQH 2ARJQ 1CLZH 2YUZA 5I30H 1KIPA 4P9HL 4N0FA 4PJXA 5CBEB 2MKLC 4HUKB 2VITA 5D7IA 4HXAH 2Y07L 4G5ZL 5KSUA 2P44B 2ZCHL 3P11H 1DVFD 5CZVL 1ITBB 4QTHA 4YHMH 2V5RA 2Z8RA 1OL0A 1M1SA 3SO3B 2I5YH 3WSQH 1MCLA 1OAXL 3EFFB 3LKPA 1JHTB 3IAQA 2EE2A 3TPUA 2DM7A 5BXFB 1MFEL 3TJHD 1CFBA 4QHLB 1CXIA 1QHOA 1GZQB 4UAOB 2HRPL 3BN3B 3VD9A 4HIJA 3CDFA 4JG0L 5EPMA 1ZGLA 1L9MA 4NOFA 4OUUA 1EEZB 4BSWA 3WE6A 2F19H 5CIPB 5C0JA 1A1OB 3V9FA 1SEBB 2YEZB 1JI2A 1TDQA 5F9JB 4TTDD 4OB5L 2W0FA 1T03H 3D39E 3DX7A 1NCCH 3VA6A 2VAAB 4M8QA 1H3XA 3QG7L 5DI8B 5JXEA 5F1IB 1PKOA 2VLME 4F33A 1FBIL