1BGXH

Taq polymerase in complex with tp7, an inhibitory fab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
209
structure length
209
Chain Sequence
b'QESGPGLVKPYQSLSLSCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGTTDYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCARYYYGYWYFDVWGQGTTLTVSSAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAQ DNA POLYMERASE
molecule tags Complex (polymerase/inhibitor)
source organism Thermus aquaticus
publication title Crystal structure of Taq DNA polymerase in complex with an inhibitory Fab: the Fab is directed against an intermediate in the helix-coil dynamics of the enzyme.
pubmed doi rcsb
total genus 22
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 1998-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bgxH02
5B39G 1YY9C 4TUJA 4MA3B 3G5ZB 4PJFA 3WJJC 2F74A 3V6OE 4FABH 1JGLL 4DVRH 4PJCF 1JUFB 5IM7A 4P2OC 1OP5H 4R4BB 6CGTA 2VDPH 2XZCH 4XI5C 3UTTD 5DMJB 1CDCA 4XWOC 1VADA 1U8HB 3ARBB 1S7RA 3WNLA 4HUKB 3QWOB 4NC2B 4P46C 4H20L 4G9DB 4MGXA 1ZA6B 1J1XL 2NNAB 3SDXE 3D48R 3TO4D 3WIIL 4UQ3A 4L4VD 2C3VB 3MJ9H 5T3ZD 4NN6B 3MJ7B 4WU5A 4G7VH 5CKAA 1LVEA 1NBVL 3EYFB 1KPRA 4DEPB 2BVPB 5E56A 3VH8A 1OAXL 4Q2ZB 4UB0H 2WP3O 2HTKD 4LARH 4MJ4A 4XP5H 4KZEH 3AU1A 2IG2H 5GS0L 4Y5YA 4PRIE 4LSRL 2BHYA 5GRJH 5BJTA 1AXSA 4PTUA 3RWFA 4GFTB 3O6FB 2BOCB 4X6DA 3ZL4L 1I9RH 5D7JB 4KK6D 3N50A 3G6DH 3CPLA 3ULUD 5D9SA 5LXGL 5E5MB 2EIEA 4R9HA 4P2RE 2YD4A 3FCTA 1EGJL 2ICWI 3DI2B 1ZGLP 2YRPA 1V8HA 4YDJA 2PYEA 4FA8A 4LL9A 4PLOB 5C07A 5ICZA 4GG6A 1ERNA 3NCBB 4DCQB 1FORL 3VDAA 5J6HA 1NCWH 3SEPA 5CWSA 3VCLB 4J3UA 4BFIA 5ISZA 1CR9L 5DVOA 1R24B 4UOJA 4PRHA 6FABH 2Q76B 5IHZB 4Y4HC 1XGRA 4F80A 5J9PA 1FV1A 1U91B 5DGQA 5I16A 2R1YB 1V3LA 3V95A 1BEYH 3B9KC 3HS0B 3V8OA 5EZLB 1XIWD 2GW5A 3S37X 4C56E 1OAKH 2HVKB 1OM3L 4G6JH 3K1DA 4R26H 3LRSA 4YDVA 5FDYA 2NY2C 4O02L 1H3UA 2IQAB 3K4ZA 1I1AB 4FTVB 5GGTH 1ACZA 1KPVB 1MWAL 4Y2DC 2BDNH 3WFCL 2QR0A 4MNHB 5ESVA 4J1UA 3FO9B 2OI9B 1PKQA 2WW8A 4HPOL 4LEOA 1KIRA 1F00I 3MA9H 2L7JA 1IMHC 1UXWA 5GRXG 1A22B 4QOKE 3SO5A 5I66A 3V9FA 3QUYA 2B8OT 5ENWA 3SPVA 3T0DA 1MRFH 2YUWA 4GG8B 5DFWH 4XPFL 4N1HB 5LCVH 3QPQC 2AKRB 3MRKA 4R2GC 1I9IH 4NZUL 5FKAB 3QO1A 4KK5C 1ZTXH 1IFHH 2DQCL 2A6KB 1DBAL 2JCCE 4S1QH 3TBYB 4BH7B 3KPMB 3SDCD 5HHNB 2P46B 4R90L 4X98A 4JDZB 4PJDB 2P45B 3PHQA 1CK0H 4JPIB 3RZCA 3QUZD 1B6DA 3QZWG 1MIEL 1QFWH 2DJSA 1RUMH 1YYML 3FTGB 4P4KC 3QR2A 5ID1B 2XA8H 2IMNA 2PO6D 5JW3H 2VR9A 3ARFD 3BD4A 2VLKA 3U0TA 3L5WA 1K4CA 3EOTH 1NCAL 4OCXH 3QDJE 5EUOA 1G9NL 3AB0B 5MHSE 4UDTA 2A38A 4Y8DC 4HIIA 2B1HH 4IM8A 3MBEA 1OF2B 5GSVB 4YK4C 5KW9H 5F70A 3W9DA 2XWJB 5DJ2B 4PJ9B 1WITA 2R29H 4I3RL 1AO7A 4LGPB 3B43A 4PREA 3QCVL 2E9WA 4U6HA 2JB6B 1VFAB 4L8SB 5DT1L 1QUNA 3BN9C 2UY6A 1MIML 3MNVB 4Q9BA 5HYSG 5D7JC 3OXSB 1P4LB 3BX7C 2PR4L 3MUZ1 3GSWB 5HJ3A 3BXNA 3ZDXE 1S7WA 3TA3A 1QLFB 3WD5H 2GSIA 3SY0A 1MCWW 4RAVB 1EEQA 4K9EH 4WHTA 5IROC 4PRBB 5D7IE 3HC4H 2ID5A 2P24A 2XWBA 5E8EA 1QKZH 1JPTL 2G5BB 4P48A 3WIFB 2FHCA 2GTWB 4LLQB 2GTZA 5IWLA 3I2CL 1MFBL 5D1QC 5M95B 4OLWH 1N8ZB 2ZUTA 4JFYA 2FHFA 1GC1C 1GOHA 5I74B 4QT5B 2CRYA 5FM4A 1A6ZA 1MVFA 3HR5B 4KRMB 4R7DB 5KSAB 2X4QA 1OOAA 3TF7C 3VXRD 1I1CA 4NBYB 2CO7B 4F15C 2XA8L 1KTLB 2BHUA 3C6LD 3FFCB 3PV7A 1D3CA 3IFOB 1PFCA 2BNQD 3NZ8B 4QHUA 2HLFC 1K5NB 1UH4A 32C2B 3CXHJ 5CS7A 1MWAA 4ZXBD 1MSPA 4MQ7A 1WEJH 1EHNA 1EZVY 2CKBB 2FECI 2ARJQ 3DBXB 1D7FA 2O5YH 4NQCE 2YZ8A 1A7NL 2B1HL 4J4PC 3U30B 4HS8L 4MVBD 2IBBA 2O5YL 2YOCA 1FZOB 5GRZA 1IAOB 5DMIL 1FSKC 1JF6A 1KFAL 3S35L 5LXGH 1I7RA 1ZSDB 3E2HB 5C2BH 2NX5E 2ICWA 1NLDL 4XMPH 1AD0B 1IM9D 4Y19A 3BYYA 1IAKB 2IFFH 5DD5H 5KVEL 5F96H 2WIIB 1JGUL 4JO4L 1QRNE 3KVQA 3DUUA 5C3LD 3C2AH 3PGDA 3SDCB 5EO0A 3QEUB 5FO9A 3GI9H 4UTBL 1I8IB 4N8VA 2EIBA 1BBDH 1JPTH 3P11H 3HZYA 2X89A 3T4YB 1KJ2B 3OG6B 3IDNB 3RY4A 3T04D 1A2YA 5IVNA 5C0EA 1JF5A 3CMOH 4JFHD 2CXGA 4JZJC 3VXRA 3RDTC 4G43A 2AJSL 4BKLA 2BSSB 1WBZA 2EC9U 4ZPVB 2J1KA 4JG1H 5IQ9B 3LS5H 4HAGA 2F54A 4XPHH 1F13A 2OZ4H 3P4OB 4JFPA 4D3CH 2E7BA 3OKMA 3UTSA 1I85A 3DYPA 1I3RA 1UACH 4G8GE 1JZ3A 3AVEA 4X4ZA 5D7SL 4PGBA 3HC0A 3VI4F 4YHLL 1QRNB 3GMRB 4MDIB 5I1EH 1DZBA 1GZQA 3RGVC 4MMZC 3KPOA 5TH2A 2N4IA 2KUTA 4NOBA 2DQUH 4OZGA 5DMGD 4W68A 1RJZA 3MBXH 3K74B 5FO7B 2CO6B 4QY8A 3RU8H 4C56B 5JPMA 2VZUA 3T8XA 4JCMA 3KYMA 4CNIB 4M00A 1KJ2H 3LKSA 1DUZB 3T4AB 5IB5A 1F4XH 1T2QL 2F5AL 3D39D 3H2WA 4B0MM 4DGYL 2AJUH 3TN0B 3TT3L 1MCBA 3ZTJH 2VISA 4LNRA 2XOTA 3V7AE 3IJSB 3RFZC 1WVZA 2MQ0A 3D0LA 4XAWH 5F7HA 1UB5A 4BK4A 3MV7A 3ES6B 1D6EB 1T7XA 4AH2B 1CGVA 4QOKB 3DVNB 1FNSL 3LZFH 4NQSA 2FYYB 3KJ4C 1YMHA 4Y5YC 3FOMA 5CD5C 4HQQL 1FFNB 5C09E 1FVEA 3LAFA 3OR6A 4NM8H 2A9ML 1EGJH 1EJOH 4KY1H 3O41A 5T5FL 3Q5OA 4JFFD 3HPJB 2DYPA 4NRYA 5IEKA 1FPTH 4ODSH 5TF0A 2R1WA 1QR1B 4J8RA 3WUWG 1R3JA 2JE8A 4FQXD 3EZJB 2NW3A 1MJUH 4HD9A 1LO0H 2BSRA 2XKUA 1UM6L 2HLFD 4QRSA 2BRRH 4EKXA 5FCUL 4WI3A 1GGCL 2V2WB 4XH2A 3OGCB 5IT2H 3FB8B 4PS4L 1R5IB 2OR9H 2IPKB 5D5MB 5IMLB 1F4WL 1QA9B 2R0WL 3ZHLA 1KULA 3SJVD 2AI0H 3JWOH 4OKVB 5JDSA 2WUBH 2P42B 3WO4C 3FN3A 5BS0E 5GS0D 3FB7A 4LLVA 3GMNA 4OD3L 4LCUA 4OCYL 2HT2C 1JTPA 3WDHA 3B9AA 4Y5VB 4PRAB 1EJ6A 4RMUA 3VFUA 4GBXC 4XCEB 2X4UB 3VG9C 5JTWA 1D9KD 3T0VA 3BEWB 2GK0A 2B0SL 2X4SB 3EFDH 4E0RB 2C4FT 4M6OH 5HHQA 5C0DB 4M93B 4XVJH 3LN9A 4L8CB 4ZQKB 2NY6D 3DI3B 3VXMA 4WRLA 1G7QB 2MPAL 4L29A 1JHKL 4WVRA 5IV2A 3JWOC 4D9RE 3V7MA 2RIKA 1WQVT 4JY6A 4U2YA 4Z8FH 2KQNA 4LRNH 3G5ZA 4WI2A 1AC0A 3OX8A 2HH0H 5LG1A 4CN6A 1MNUL 4Z7UF 4NO0B 4PB9H 2Q7YA 5IMKA 3WXVH 3QP3A 4L9LB 4P4KB 4ZNEA 1CICD 3SHSA 1EEYB 2APBA 3BP5A 2XZQL 1NDMA 1TTFA 4MSWB 1LP9A 4LFHG 3U4EB 5LAXB 5IG7B 1AR1C 1DSFH 2GJ6D 4YHNA 2BVOB 4XX1E 3ZL4H 3IRPX 4Z7WA 4ONHA 4PGZA 3HAEB 4CKVX 4KJPC 5FOBB 4CVUA 3AS1A 4N90E 1QBAA 3X14A 1IAII 1MJJA 3RIAK 1L0QA 4E5XA 3BN3B 2IPUG 3EYUH 5I0ZA 3L3DA 2K3TA 3L3GA 3DJ9A 3FT2A 1HSBB 1EO7A 3EDKA 3LH2H 4MA3A 4P57B 4DOHE 5C9JA 4LNVA 1EPFA 3UXFA 5D7SH 4LK4A 2ICCA 1S8DA 1MFAL 5EZIH 3LQZA 4U33A 3KYNB 3D85D 4P9HC 4OCMC 3V4VH 1EMTH 3H3KA 4ODTL 3UJIL 4K3GA 3EYSH 1RZIB 1WWWX 3SDCC 4PYGA 12E8H 4C59B 4XNUH 2O5ZH 3QDMB 3VU2A 3IXTB 4F2MB 2BRQA 4PG9B 5MENB 4UQ3B 1R3LB 4IRSA 5EU6E 2R0LH 4NKDB 1NMCB 4YIQB 4QO1A 4AY0A 3TNMB 1T89C 4DN4H 3KLHC 2QQLL 2DD8H 5ICZB 4GG6B 4BJLA 1ACYL 3NZHL 1HH6A 3DWTA 4NKIL 4U1LA 4Y4HD 4YBQD 3FJTA 2CUMA 3VWJB 1GYAA 1A4KB 1OAZL 3KJ4B 4JRWA 4Y5YB 5J56B 1WWCA 3BP7A 3RIFK 5DRWB 3I9GH 1X4XA 1WBXA 3IF1B 1DQDH 1KEGH 1U41A 3HG1B 3HAEG 3MGTA 2IFFL 2XZAL 1HOCB 1CFSA 1MCFA 3MGOA 4M7KH 4WEBH 1CFNA 1YEKH 4HC1H 4KJQC 2VQTA 2IH1B 1EJOL 2VJXA 2GFBA 2MNUA 2XPGA 4AQOA 4DAGH 4YR6B 3L3OB 4LIQH 3IDIB 1A14H 5CD5D 4MWFB 3AY4C 4QWWD 3JV6B 3CSBA 1P4IL 2FIRT 3DX9B 2WINB 1Q9LB 4PJAA 1OVZA 3D1MC 5DD3L 1UJTA 2CDGB 1G7LB 3QHZL 5F7EH 5A1AA 4XP6H 1R24A 1X5KA 3QQNA 3O45B 2AJVH 4OM1L 5MERA 2QSCH 5E03A 3WFZA 3C6LC 4K8RH 3MMEB 2VXSL 1I8MA 3G5VA 1F3DJ 2AJXH 3RHWF 2XXMB 3MXWH 4GKNA 3HS0A 1NQBA 3O3EB 1N7ML 4U3HA 5EWIH 2PNDA 4WCYL 3MRQA 1L7IH 1TJGH 2NXZB 4LCWE 4U6VH 2Z35A 1WIOA 1FH5H 3BQUA 3TIDA 1S7UA 2IAMC 3GJEA 1M71A 4NT6A 5D71L 4HAFA 3W81A 4S2SA 2IQAA 1H3PH 2VN4A 3S3PA 4X0KB 3H7BB 4JREC 1HE7A 3P0VH 1CVRA 2K7PA 4NQUA 2D3VA 3PDOA 5I71C 1YPZF 3NH7L 3QO0A 3MXVL 1INDL 2F5BL 5F89B 1AQDA 4P59L 4OLZL 3DRQB 3IRZA 5ALCH 1P69B 2Z31C 1TJHL 2AQ3A 3T0EA 2VLKB 4O5LH 1QPPA 2XNAA 4RMRA 4HFUH 5MP6H 5EUOB 1JWUA 4IS6A 4LCCB 2J8HA 3MNZA 5JORA 5CILH 1UCTA 3N1GC 3GSOB 4LSPL 3LB6C 3WUWB 1QFWM 2A6KA 2QKIB 1T3FB 3IU4L 5JO5B 2R69L 5EO9B 4AEEA 3UTPE 4PJDA 1X5IA 4JJ5A 3LN5B 5KN5A 3SQOL 3MREA 1FL5A 2WWKT 2RCSH 4L9DA 3TEUA 4J4PA 1VFAA 4L8SA 4ZPTB 2ZUVA 2CJUH 1ADQA 2YKLH 2FX9H 3C8DA 5F8QC 2IF7A 5CHNB 3HCVB 3MNVA 5DHVH 2YKLL 1BP3B 1ZLWH 3UJJH 2AABH 2HG5B 2HN7B 1CK0L 4YX2L 3RNKB 1CU4H 3R06A 1FFQA 3GSWA 1G0XA 1NFDF 3I6KB 3EO0A 1DUYA 4PJEB 4CW1A 2VDNL 1F42A 4RMWA 3RL2A 3EYQD 5GQBA 2QQNH 1T1YB 1QLEH 2ED7A 4XNQB 3O4LD 3ZE0F 3AXLB 1U92B 4HIEB 2WP3T 2NR6C 1MVUA 4PREB 1KBGH 2P24B 4HUNB 4WWID 3Q5YA 4LASL 5DGRA 3U36B 2XG5A 3PV6B 2DLEA 5D1ZC 3REWA 3GSUA 5CSZA 2JJTC 2B2XH 3TBWA 3ZKSD 5TE7L 3HZVA 4QTIH 1N5AB 4XPGH 2K9UA 1N4XH 3GHEH 1U8OB 3LDBB 1J11A 1RMFL 4PJFB 1NMAH 5C0BE 3QDME 1B6UA 1JUFA 2P5WE 4JRYB 4PJ5E 4MQXD 5EA0L 3PGFL 4YFLI 1BD2E 4A2MA 1UJ3B 3U1SL 1ULVA 4GG6E 5DVLA 1U8LA 4WGVB 3T77A 1MQKL 1F90L 4LLQA 3N06B 4P9ML 1JF1B 1CVSC 4U31A 1ZHLB 5JOFB 4U6TA 5DRNB 4JFYB 5C7XH 3S96A 4U6VL 1MIMH 2C3VA 2V2TA 3O8XA 5JHDB 4G7YL 2NXYB 2YD9A 2XY2A 5F7NC 4XTRD 3WFBL 1QNZH 1SMOA 3I02B 5HDOA 4HXBL 2JIXD 2I5YH 5DZLA 5DYOA 5IJVB 2VR4A 1MELA 3IFOA 1X6NA 1JL8A 3QEUA 4N8VB 4QRQB 3CLEL 2MJWA 1U8NA 2XZZA 3ZKXB 1NCDL 2IAMB 1QSVA 4JZOA 1XR8B 2DLHA 3IDNA 3BE1H 1OTUD 1DQTA 4JPWL 1IGML 4PLJD 1RIUL 1QVOA 3VRJA 3FCTB 5T1KB 2NX5B 4G43B 1I7RB 1ZSDA 3SDYL 4KKAC 4BKLB 1BVKB 4KV5E 4ZTPH 1YEKL 3VWKB 4PJCA 5E2TH 2VMFA 3KGRA 3QDGD 2MHAA 2E27H 1RUPH 4PJHB 4QLRA 5SWSA 1XAUA 1Z5LB 2OLDA 5DXWA 1VKXA 1L7TL 3FT3A 3QUZC 3Q3GB 4ODUA 3ARYA 1YEEH 4EI5B 3IGAB 3U7AA 4G42A 3C5JA 2NZ9D 2P44B 3FQTB 4MJ5B 2R69H 2CIIB 4LCWB 5TH2B 3HG1E 1MRDH 4EDWH 5I16B 2AEQL 1IFHL 2DQCH 2GY5A 3DX6A 2DQGL 2Y72A 1J8KA 3GSNA 3MJ9L 2C7UA 3VJ6A 1SJHA 2DD8L 2P47B 4IOIB 4ZD3L 3KPPB 4ODHL 3VXRB 3ALXA 2FO1A 3KYMB 3LSOB 4UTAH 2IQ9L 2Y36H 1MI5A 2DJ4A 3T4AA 2EIDA 4GW4B 4AIZA 2NLJA 3F7YA 4ODVL 3P2TA 2K1MA 4RISH 5GS1C 4AENA 1ZWIA 4JFQA 4CN4A 2R9HC 4AEIL 1LMKA 4Y4KA 3L5JA 3L3JB 2EDQA 2G75A 1G84A 2VLKE 3C87A 4OGZA 1KIRB 4F7CB 1LDPL 1QRND 3LH2L 1BLNB 3TYFA 3RVTC 5JZ7C 3S88L 4OTXL 3DVNA 5GJSL 2BY0A 3TV3H 3RTQB 2BVUA 3CU7A 1S9WA 2RFXB 4I0KA 2HRPH 3QRGH 4OQTA 4FQXC 1DLHB 2IGFL 2MTPA 3D69B 1P7QD 4B50A 4UU9B 4MD4B 4X9HA 1JMXA 5IEKB 2UV3A 3BZFA 1H3GA 1H3TA 1NPUA 1YDPB 5EORH 2QQKL 1YY8B 3QO1B 3WHE0 4HH9A 4JY5H 4KJQD 4R8WH 3G9AB 2ZPKL 4BH7A 2IANE 5HHNA 5D5MF 3GO1H 3GM0A 3QG6B 1JV5B 4OI9A 4N0YH 3QZWB 4XNZC 3V5KA 4U1HA 4QOKA 5D1XD 4O2CB 3QWQB 1J7VR 1A7QH 5CP3A 4LQFH 1OW0C 1OTTC 4ELMF 2X4NA 4GRWH 1E4XL 1V7MH 2YRZA 2ADIA 3MLWH 1EO8L 4XAKD 5CLTA 2V9QA 3KPRA 4RGND 3NA9H 4XVJL 3TCLB 3BAEL 5KSUB 1YNTB 3RWIA 1XCQA 4WDIB 4MVBC 4PRDA 4D9LH 2OTUA 2EZ0D 2Y1VA 4J4PD 1U0QA 1EFXB 1KEML 5KSBF 1DQDL 1KEGL 3VXNA 4G3YL 2C5DC 2B1AL 5L88L 1VGKA 3QEGL 5DJAB 4LLYB 5A2KH 1IC5H 4Q6IB 5EU5A 3WXWH 3S4SA 1QA9A 5E24E 4F15B 3RX5A 2X4OA 3FB7B 4GT7A 3LY6A 1AP2A 1OP9A 1SY6H 2EDWA 4NQCA 4PRAA 3UZQA 2BRRL 3BGAA 3VXPA 1KLUB 1JPSL 4M1GL 1A6WL 5IFJB 1RURH 3BEWA 4P3DA 2DQDL 3U4EA 4ZFGL 3HZMB 5F3BA 3VFVB 1PW3A 5HHQB 2E7HA 4P2OD 5L9DL 4F7EB 3O6FC 4HDIB 4J7RA 2A9MH 3MRNB 4YHKL 2PO6C 2V7HA 8FABB 2SEBB 1J1OH 3DVFA 5D2NC 3LCYA 4K3JH 3RAJL 1AGEB 5C0GA 1LO4H 5KVDL 2ITDA 1KB9K 2D9CA 4XAWL 4YHZH 4M48H 5JUEL 4KKBD 5SX4H 1J05B 1S7QA 2FX8H 3KYNA 1B0GA 5IMKB 4DKDC 4GLRI 1IGFL 2ZCLH 4D8PB 1PSKH 4X7TB 1RIHL 3HUJA 1GSMA 5F21B 1RZIA 1XGUB 3DBXA 5E94B 4WFED 1CQKA 4G8FA 4YHNB 1MHHA 5E08H 1FL6A 5EU3B 4ERSL 4QHLB 3C5ZD 4RMTA 3E3QC 1CD0A 4PG9A 1MNUH 4LPVA 2J8UF 2HH0L 2OX5A 3VRIA 2EXYC 1N6QH 2XIDA 2CKNA 3RI5F 3MRDB 5B4MC 3I84A 3NGBB 3VXUD 5M94B 2I9LB 4FFYL 5JW4M 2L7UA 3L5IA 4N0CC 1GGUA 4XBGA 3SKNB 4J6RL 1WFUA 3OAZK 3GK8L 5FUZL 4NWUH 4YHKH 3U4AA 4OZHF 3K4DA 4YWGL 2M1KA 5GGRB 5HI3C 4QRUB 3S34L 2EH7H 1KIQB 4XPBL 3TA3C 2YBRB 4P2QE 5L9DH 2CMRH 5FYLH 4G8EA 4U1IA 3CFBB 1H5BA 3HLAB 4RISL 3QDMA 5MENE 2H6PB 1F4AA 4POZD 5ADOL 1JPSH 2EKSA 2YEZB 4G6FB 4S1SH 2LTQB 2Y4SA 5KVGL 1HIML 4H26A 3TNMA 4PJHF 4N8CH 1AQKH 4I18C 3GB7B 3RUGA 5EBGA 5KSVB 3OHXA 2Q8AL 5KG9B 3ZTNH 2R0WH 3HI1B 3DYOA 2ITCA 1CFQB 3TBTB 4FQQA 1AH1A 1EHXA 4Z7UB 3CCHA 4TOYL 1S9XA 1CFTA 3O3DA 4UTBH 4FQ2L 3PP4H 4QRRA 4PGBB 3QXUA 1LO0L 3PNWA 3KYOA 4X5XA 3REVA 4HPYL 4WW1B 4JO4H 5E99L 3ZE2F 4HLZG 1C5BL 1FE8L 5E2UL 2PXYA 1HOCA 1W0VB 4F57H 1RUQL 1I1AD 1EZVX 5GGSY 5C0IA 1G9NC 3ULVD 4PB0L 4YUEH 1MLBA 5ESAA 1QQDB 2GFBB 3BQUB 4F7TA 2AXHA 3ULSA 5F88B 1CL7L 1A7NH 4Q6IC 3O9WB 2DBLH 2WBWB 3H7BA 5GGTA 4PJCE 1F6LL 1ZGLM 3TPUB 3MRPB 2HFEB 5HGGS 3AUVA 4X7SL 4M1CD 3CLEH 5HGBB 3RGHA 5GXBB 2CXKA 4N0UA 3KWWA 4HX1B 2W9EH 3BKML 2GSGA 4RQQA 4YHOL 5ALBL 2FWOB 3O6MH 5TQ0L 4GRWF 3WS3A 3SDDD 2FSEB 3QHFH 5TDNA 5ISZD 3MLSH 4ELKB 5F6IB 1ZHBB 3BHBA 3GGWA 3MRQB 1YMHB 4DZBA 4IOFC 4BYHA 2P8PB 3OR6B 1U8QB 1OTUC 1QFHA 3S36X 3A67H 4MXVE 4TUKH 5DQ9A 5I8EB 1ZXQA 1NANI 5J1AA 4LPYA 2E9JA 4K7PL 1QR1A 3ULVF 3JV4A 3SE8L 4KK6C 1JNNH 3QO0B 4MB3A 1UEMA 5JLZA 2EDXA 3KPTA 1ZKAA 3LIZL 1FL5B 4PV9A 2Y6SD 3BP6B 4KTDH 4KH2A 4TN9A 4TRPH 5T3XE 1M7IA 1NGWA 3D87B 5GISL 4OLUL 1R5IA 3S4SG 2VC2H 4NQDE 1NFDB 4OCSH 1XGTA 4HK3J 3WN5A 1VB9A 3MV7E 2Z8SA 3GSRA 3CVHL 5EULV 3WMSA 1RSFA 5FGSA 1TZHB 1R6VA 2IQ9H 2BSTA 1I3UA 3SDAB 3D5OF 4XVSL 2BVTA 1FFPA 3WUWA 4RGOH 3QUMA 4UUJA 3HE7A 4JO1L 3ZDZF 4CADA 3MPCA 1GHFH 5EO9A 5HGDB 2WBJA 2AQ1A 2YXMA 2EDTA 3SOBH 1FIGH 5D2LE 4EXKA 1NAMH 4PJ8B 2G2RA 4JQVC 2DWEB 3RTQD 2Z8WC 3BGFC 4L29B 1NLBH 3BDYL 4ISVA 2J6EH 3TVMD 3VMNA 4G80B 5IV2B 2X10A 2YZ1A 3X11A 1N64H 2UYLB 3MOBH 3N9GL 4N90D 1IL1B 4WW2A 3ZKNC 1M7DB 1RUKH 1JFQL 4H1LA 3M17B 1ZMYA 2A1WH 3RNKA 4ACPA 4JDTL 5JXAL 1MEXH 5C3TA 1TZIB 4CW1B 1NAML 3RGVA 3AM8C 2EDKA 4JE4B 1XH3B 1XIWC 3MV8D 4I0CC 1T5WA 2X44D 3IU4H 5DF0A 1DDHA 4JGMA 2H2PC 5DI8A 2D7MA 3F58L 5IW6B 2BVOA 4EQ2A 3T77B 3CD4A 2CGRH 1E6OH 5SX5H 1NEZA 3LPFA 5M7QA 3GSUB 2HFFA 3PABB 5MP6L 1DVFD 3DMMC 4XB8A 3P30H 1H3WM 1ROWA 3QNXA 4JKMA 3JWDC 3U0PA 5TE6H 2AK4A 2DKSA 2O26U 5HYQA 5EDXA 3ARBC 3BPCB 4X6DF 1U93A 1AJ7H 3BH8A 4P2QD 4O9HH 1U6AH 3RWDA 5F7UA 1OPGH 2YPLE 4PJAF 3BGMA 1DFBL 3CDGB 3ULVE 2VE6B 1BX2B 4ZUVA 3EKCA 5KTEL 4LLMA 4M62H 3B8SA 3LD8C 2ZUYA 2E8YA 4Z7WE 4JANB 5F1KC 1MFCL 3VFNB 2QHRH 3ARDA 3PHOA 3HMWH 4U05A 2B4CL 5C8JA 1RI8A 2F54D 2OCFD 2W9DH 4PJGF 2UZIH 3VXUA 4K3DH 1HXMB 4GKZB 5KBNC 2FR4B 4XNMB 5IBUG 2FGWH 3FT3B 5J57B 2VH5H 1E27B 2DM4A 4DTGL 1U8NB 4NNXA 3JVGA 2DLGA 4XNXL 4UIMA 5LQBH 5MEND 1HHJB 3PL6D 1AFVH 5KSBB 3DX6B 4UAOB 2IAMD 3QDMD 5HGHA 4ZODA 4JZNA 1R5WA 4O2FB 5D2LF 5GIRB 3QRFM 2VDQH 4LVOB 1SJHB 5CBEB 4KXZH 1HQ4B 1YC7A 4JHWH 1KC5H 3ARGC 1I3GL 1UCBH 1SMAA 1RZ7L 2HT4D 4JAMB 4PJCB 2APXA 3DIFA 3VXSA 5HYSB 4PJHA 1N64L 3MOBL 1Z5LA 3MCKA 1KELH 4JFED 4QGYA 1KB9J 2CKBL 5F93C 3Q3GA 1P2CA 3L3IB 1W72L 4ALAH 2R2EA 1O7VA 3CFDA 1AHWA 4EVNB 3B4NA 1T04A 4MJ5A 2FLBT 1HN1A 4XP4L 4F33A 4LHUB 3SOBL 4YK4B 1PKOA 3MCG1 2QTEA 4PTTB 4OFKA 2ZKHL 1BQSA 3TYFB 1L0XA 5B8CA 1N0XH 5GGQL 1KACB 3QUXA 4YHML 4EUPA 2ZG3A 3MGAA 3CUPA 4GH7B 4JQXC 2C1OA 2D9QB 3KPPA 1A5FL 3MOQA 1CTNA 3MA7B 5L8JB 1M05B 1BZ9A 3EJYC 1NUGA 3OWEA 4HIJA 1UZ6E 4X6FB 2DQFB 1PDKA 2OI9C 4H1LG 4RFOH 2N7BA 4TSBH 4X0KA 1X5GA 5IR1A 4NYLA 3PWPA 1MFDL 4G8IB 4FP8H 5K59F 3HZKB 4OGXL 1M6OB 3LKNA 2CMRL 4LLWA 2YK1H 1J0KA 3QEHB 4CVZA 3QXWA 4MMXC 1CD9B 5C6TH 4XAKE 2PETA 5HI3D 3V4UL 1BLNA 4U1HB 5DQJA 4U6XA 4BQBA 1LK3L 4IHOA 5HY9B 3IJHA 1RAMA 4YAQA 2XICA 2AXFA 4NO3B 5GGVH 5INCB 2ADIB 4NJAH 4OSUL 3T3PE 3KPRB 4TNWK 3P9MB 5C1MB 1A1MA 4LSUL 3SKJL 4PJGE 2D7NA 5DSCB 1YDPA 4MCYB 3H7LA 1NCCL 1QFWI 5HDBE 1ZANL 4MCZB 2FEDC 3QJHA 4Q9QH 3UTZB 3C6LA 1KV3A 4NHUB 4L4TB 5L7XL 4BSVA 4ZXBA 3O2VL 4FQLL 2E6PA 4LVNB 1EXUB 5EU5B 4XP9H 3V5HA 4PRPD 3CX5J 4Y4FB 2EDBA 4XTRC 5MI0C 3BYTA 1VEOA 3G6JA 3GSVA 4YH6A 5I1AA 3PWNB 3BO8A 5EOCJ 4MZ3A 3MRJB 4JM2D 2ZUUA 3QH3B 2WLZA 4ZFFB 5CIPH 3R06B 4FZEH 2APVA 3CFIC 3I6KA 2DTML 4HC1L 3RVVD 3WNMA 4PJEA 1S9VB 4X7DC 3EW3B 5DK2A 4XMLL 3W11C 4CMHB 1JWSB 3RZCD 3FMGL 2IGFH 3AXLA 1ZS8A 4IJ3C 1CQYA 3QXDB 5CGMA 4LF3B 3MCLH 4ZUWB 3RKDC 5DJAA 3U36A 5JPNA 5CMAB 1DL7H 4ZAKC 3WKNA 1U8KA 4URTB 1ES0A 3IDXH 5IHUH 4M4PA 3DV6A 4MJIE 3PGCA 4JFZL 4K3EL 3PQYB 1A0QL 3MRLA 1CWVA 5CEZL 2BMKB 1I7UA 3GI8L 4V2BA 4CVXB 3CFCL 5L2KD 4D8PA 5IFJA 3CDFA 4S1SL 3EHBC 2XTJC 4PY7B 12E8L 3FQNA 1E28B 5EU7C 1VFBA 4Z77A 3OZ9H 5ADPH 1D5ZB 2D4FA 4ODSL 4NZJA 1KENL 4JM2A 1MCRA 2IBZY 4U1JA 2AEQH 3D0VB 4ZSOA 4LKXA 1FNGB 2DMBA 2H9GB 2I9LA 5L6YL 4B7IA 4XBGB 3LEXB 5D6DC 1JP5A 3QUZB 4KMTL 3HMXA 5I1IL 4WFFD 5CBAB 5KSBE 3JBG7 4OQTL 5HI4D 4KFZC 3KPSD 3ZDYF 1HINH 2NR6D 4ZTPL 1FL6B 1XR8A 2HVJA 5FYJU 1NDGA 4Y88A 4Z76B 2X4PB 4U7KA 1MF2H 4MA8L 1FDLH 5H37H 2IJ0C 1BQHA 1XMWA 3JWDL 1KB5L 2FNBA 4G6MH 5KSVA 2GJ6A 1AGCA 1QZ1A 4XVUD 4AG4L 1LO4L 4HBQA 1WFOA 4NFDA 2VXVL 5L2KA 5DRZB 4FQQB 4ETQB 2ZUWA 3S88H 3T0EC 4FQLH 2AXGA 1ZEAH 5TE4L 1S9XB 3A6BH 5GGSB 3P0YL 1JRHH 1MCNA 4HXBH 2YBRA 5FHAL 5DLMH 3KYOB 4G8EB 1P4BL 3OKLB 4U1NA 1J0JA 5EPMA 2FZ3A 2BCKA 4DGVH 5ACZA 1T4KB 2B4CH 4JRXA 3RVXD 3SGKC 4UILL 4P2RB 4H26B 4C57C 1QQDA 4I0PC 3BQUD 1R3KB 2ICWJ 5TQ2L 3TBVB 4WHYH 3S5LA 3QI9B 3RUGB 1MFEL 3LSOA 2FD6L 4DCQA 3CFKA 1FCGA 4KI1A 4N9GA 4L4VA 5FYKH 5ISZB 4GKSA 2OR9L 4EI5C 5JMOC 1OGAA 4Y4KB 1V7NH 1XGRB 4ZS7L 4LRIC 3ARBD 2GSGB 3H0TB 5B8CC 2FWOA 4WW1A 3QIWD 4MLIA 5L88H 3VW3H 4Y4HA 4G8GB 4G3YH 4FFVD 3MCLL 1W0VA 3ESVF 2AJ3A 2DIBA 5DEFA 5ID0A 1INQA 2AEPL 4FQJH 4HUWB 3WEXA 1R3IL 3MOAL 3QFJA 3HN3A 2HKFH 3H42H 1TIUA 4OFPA 2P8PA 5BS0D 4RNRB 4MAUH 2NY6C 1KFAH 4QGTA 4TVPH 4FZEL 1DLHA 3D69A 1MCJA 2ATKA 5F1NB 3GMMA 2DN7A 1EUTA 4HT1H 4ORGB 4CJ0A 2CLRA 2PXYD 2I25N 5DD0L 2JIXA 4HKJB 4YBHA 1YNKH 5E7FA 1G9EA 5AD0B 4YO0B 4HWEL 1VERA 3DTXB 4RQQB 1R0AH 1MREL 2J5LB 4NHCH 2XN9A 2HFGH 2C3GA 1JNLL 4PJBB 2AJUL 1MCCA 2Q3AA 3HB3D 4DZBB 5ERWB 2X9YA 2UZYB 1KC5L 5DJDB 4YJZL 1RZKC 4L3CB 1YEFL 3SKJH 2EKJA 5HYJA 2Q6WA 1T7YA 4WV1A 5GRWA 4PJGB 3WHXA 5FKAA 3RU8L 3UTTB 1YJDC 3IDGA 2ZUQC 1QLRA 1XF3B 1DN0B 3LEVL 2OTUB 3NAAH 5DDHB 3MFFA 4PRPA 4XVSH 4X98B 2WSKA 2IC2A 1MCWM 3HI5L 2IANA 5FA4A 4CMHC 4DN3L 3TN0C 2ZOKA 5E00B 4C55A 2A83B 4WUKH 4OUUB 1HNFA 4D3CL 1RMFH 4C83B 3WN5B 1IEHA 2PKDA 5C0ND 4D0BB 4XPGL 1BM3L 3F7RA 4HWBH 3LS5L 3QQ3A 1LP9F 2GY7B 1NFKA 4Z78A 5J89A 1TZIA 3PUCA 5BS0B 3CMOL 1RD6A 4X4YA 2W0KA 3BWUC 4M43L 1T5WB 3W9DB 3E6HB 4PJ9A 3O6LH 3OAYH 5CJBA 5DI8B 4TUKL 3VFVA 4HIHB 4M5ZL 3G08A 3U6RA 1XF4A 4Q7DA 3WBDA 3QCUH 4YHIB 2X09A 4HLZH 1ZHNA 2CUIA 2OTWB 5MEOA 1WZKA 3NN8A 3VGAC 1JGUH 4YE4H 2SEBA 2PYFB 5E6ID 1MAJA 3FOLB 4NJ9H 3V5DB 1EH9A 3MO1A 5A40E 2UYLA 4XMKH 3V4PH 3NCJH 4CMMA 2QSCL 1NLDH 4XMPL 2W9EL 3CLFH 5E2TL 2Y06H 3K0WA 1F58L 5KAQG 4I0PD 4NP4H 4KKAD 5FKPA 3OF6A 1S7WB 5AUMA 1BQHG 3TA3B 3SY0B 1RIUH 5GGVY 1QSFD 4JY4A 1O0VA 3G9VA 4HMCA 1BJ1J 4NZTH 4Y5VC 4NKQB 2EXWC 4MJ2A 4G9DA 4PV8B 1JFQH 4K2UL 1AY1H 4N8VG 4PB0H 2N1KA 1G6RL 3CLFL 3MLPA 3CJJA 4WHDA 3MOAH 2MCPH 4P4KD 4UI2A 3MRDA 5C71A 3NPSB 4OIAA 2I5YL 3W9EB 4HZLA 5IFAL 1LDSA 3LRHA 1BQUA 1FAIH 2Z31D 1GH7A 3OKNA 4GXUM 4BH8A 3QCUL 1D5MA 5D8JL 1RZJC 4PLKC 4IBLT 4F37K 3TIEB 5SWZE 1LD9B 2HMIC 3HUJE 1QPXA 4ZUVB 3BDXA 1OLLA 4MAYB 1H3PL 2OXGA 5CZKA 5SX4I 3D25B 3RJDA 4ELMB 1JI2A 2PYEB 1IGIH 4PIRF 1OM3H 1OPGL 3GB7A 2EDOA 5AEAA 2I9TB 5EFIB 2HJKA 5IMMA 2NZIA 1JZ4A 3IAGC 2D0GA 3FT4A 2WBKA 3HRZB 3W39B 4CU8A 1A3LH 1T6WA 2EEDA 4X4ME 4YWGH 4OD1L 4U1KB 1X5XA 4PRHB 3QQ4A 2VITA 1TNMA 2WWKO 3BWAA 3QCVH 2BSED 5DJ0B 2R29L 4I3RH 1FLRH 2RB8A 2R2BB 4K3HA 4W4OA 1R5WB 4YXLL 5EZLA 4V1DD 1NGPH 4P49A 3QNZA 3NCYP 4UMGA 1A6AB 4NNYB 4V2CB 2BFVL 3OJDB 1BAFL 4HS6A 1QO3B 1Q94A 2XZQH 4HKXB 1CG9A 5EU6A 5C6PB 3UJJL 3BKCL 4FTVE 3V6ZB 3IFNH 4M7KL 4WEBL 4TUOA 2X1WL 1FNFA 5DHXB 3CMGA 2FX9L 1I3RB 2J6EL 4G8IA 1BD2D 4NQDA 4WWKD 4U2ZA 3I6GB 5D6CA 3NIGF 2NMSA 5C07D 5CGYC 3JV0A 1H15B 4KROD 1WBYB 1JIBA 3IFLH 3MV8E 1GHFL 3C09C 1REIA 5ENWB 3NCYS 3T3ME 5FO8B 3H9HB 3MACH 1VGEL 5T3XD 4QRPE 5EU4B 5HHPB 4OZ4B 3CFJB 5MEPA 4EDXB 4X6CB 2CLVA 4JM4H 4DN4L 3ZT5A 1OAUH 5DSCA 2O5XH 2DQFA 5DHYA 3DURA 4R97C 1TVBA 3BQUC 2GT9B 5D96C 4MCZA 3BJ91 2IBGA 4NHUA 5FUCC 3EYSL 2VC2L 4KMQA 1KB5A 5E8DL 5SWZD 4HK3N 1WK0A 3O4LA 3P9LA 4EI5D 2NQCA 3BP4A 1T7ZA 2AJYH 1KCRH 4KUZL 1YY9D 5FYJE 3P0VL 2FEDD 1NFDA 4FFWC 1JNNL 5ILTL 3IDXL 4KQ4H 5JHDD 3CU1A 4K7FA 2FJGB 4YXKH 4Y2DB 1JYXA 3U0TB 2NY7L 5IB3A 4I48B 1C12A 1GPOL 1O7SA 1TZHA 2B1AH 1JTOA 2UWEA 1A1MB 3ET9F 4LSSH 1BF8A 1DJSA 5E5UB 4JR9H 4MLSA 4NKOA 4M02A 1C16A 4NRZA 1S7XA 4KK5D 4KHXL 4YZFE 4UDUA 1A21A 5DLML 3VD7A 4G6AC 3D39E 3D3VE 4LF3A 4KRPC 3GK8H 4X5LA 4ZUWA 4XH2B 1ZEAL 1XGPB 3AREA 1GVIA 2CUHA 3VXMD 1YQ2A 2NPLX 5D5ME 4AG4H 1NAKH 3VXTA 4XC3H 3O8XD 1U2HA 2Q86B 2BNUB 2ICEA 4C56D 3PQYA 2WANA 2MPAH 1QSEA 4LOUC 1GIGL 5D2NA 3B83A 5AZ2L 1K9TA 5E08L 3O0RH 1P6FA 4JY5L 4KUCF 4WO4B 5DK2B 1QLFA 3OKYA 5J12B 3VRLE 3GIZL 4EI6A 3ULVH 5L2JA 5AWNL 5IF0A 4LU5L 3KPLB 4OLYL 4RDQG 5IROA 4JKWA 4ZQKA 1MCLA 4XZUB 4PBWD 2NY5H 5LGJA 4M8QA 1ES0B 2DQIH 5D2LA 4YXKL 1OAZH 3VFSA 5HVFB 1Y18A 1FNGA 3WFEL 1K4DB 1VEMA 2H9GA 1NBVH 4P23A 2DRUA 5DFVD 1VENA 3T2OA 5HYQB 1NC2B 4OJFH 4PS4H 3BH8B 4I9WD 2YMXL 4NO0A 3FO2A 1I8KB 4YDIL 3LV3B 5I0DA 3IFPB 4JG1L 5D7IA 5I15L 1CN4A 1HWHB 3GZKA 4KTYA 4X83A 3BD3A 5KSAC 5FOBA 2YA0A 5BV7L 1EEUA 4OZFA 4H0HB 3MACL 5ABDE 2A6IA 1A6UL 3MLVL 5D7JD 5JMRA 4GKOA 1D5IL 4HBCL 1EHAA 3CX5K 2Q8BL 4JQXA 4FMKA 4DKEL 4ETQA 4BQ8A 4YGVB 5EZJA 2X70B 4ONFH 1S8DB 2NY5L 1XGQB 4HH8A 4JFHE 1Q9KA 3AM8A 4OLYH 5SWZB 4X5WA 4Z7NF 4JLRB 2CDFA 3BGFB 4KI5F 3ZT7A 3IFNL 3TNNB 4JFOA 2BCKB 4FXKA 4RX4D 3SGJC 1TDQA 1T4KA 2JF1A 3ZE1F 3FHQA 5I2IB 4YIQA 5E6IB 1JPGA 1AGFB 3DNKA 3QI9A 2DWDB 1A7PL 5IQ9A 3MBEC 5F6HI 4J2XA 1HH6B 3P4LA 4XC3L 3VXUE 5C0CE 5L2KB 1EX0A 3VWJA 5DUMH 5JXEC 4XI5D 1MAML 1J1OL 1F6AA 2FIKB 1GZQB 4GRLD 2R2HB 3O2WH 3RL1A 3RZWA 5CEXA 3UC0L 3ZYJA 1FYHB 3IDYB 5EC2B 5T3XL 2XY1A 3WDIA 1F02I 1ORSB 2H2SC 4QYOA 2VDML 4LPTA 3WL9B 4FZ8L 2ZNWA 3LQMA 1YN6B 3L3OA 1YEGL 4M4RA 4CNIA 4HK0A 3RDTD 3CFKB 5A3ID 2ATKB 4QXGH 2WINA 4GRLB 2GJJA 3PWUA 4NFBA 1CXIA 3V4UH 2BY1A 3QEQE 4LRIA 1PZUB 3EOAB 2BVEA 4KKLD 3O45A 3GM8A 1MY7A 1OB1A 1AKJA 4Z95H 1KN2H 3ECBA 2Y07L 5F9WB 1M6OA 3LKNB 4LLWB 1I8MB 3GHEL 1MFDH 5E6ZA 5FCUH 1WV7T 4G8GA 4ZAKD 3NFSH 1FYTE 1UYWH 1WZMA 3INUH 5IMOB 5DD5L 4NSKA 3KXFA 2Z35B 1OAQL 1WTGT 2HYMA 1WLHA 3QG7L 5DJDA 4PG2A 3U0WL 5C2BL 5F7MC 5C0AB 2PYED 2DYPB 3TFKD 2PO6B 3P9MA 4HIXH 3M07A 2M26A 5EO1B 1XF3A 5J13C 4V1DE 4XXDA 4YPJA 3PDOB 2VERN 4NBXB 2E9BA 1VHPA 5AG8A 3EOTL 1FNEA 3DTXA 1IILE 5I8OH 3E6FA 3FO0L 3KG5A 4TULL 4MYWB 3NCJL 4WUUB 4JFFA 2YUZA 2CR6A 1QYGL 3M1BA 4PJBA 4YBLC 3PWLB 5EBWA 43C9A 2CJUL 3MRMB 4D0BA 4M1DL 4FN0A 4YE4L 3G6JB 1U3HC 1TQBB 5JDSB 2AK1L 1RZ7H 2A74B 3SJVE 5IUSA 2BFVH 1BBJB 5FB8B 3BESR 3DHMA 5C09A 4TTDD 1K8DA 5FGBA 2VLLB 1AIFA 4MZ2A 3QB7C 3QRGL 4NZUH 5J7CC 4OCRL 1IZKA 4ZTOL 5E2WL 5HI5D 3IVKB 4GW5A 5KN5B 5J12C 4YHIA 5E00A 4H25A 3SKOB 4U0RB 2UVFA 2P8LB 4Y4FC 1J0HA 2UVEA 3MNWB 3SCMA 3UPRB 5ESQB 4PYHA 3DV6B 3MO1B 1CDGA 3U7YL 2AP2A 1UFUA 4CMMB 3MYJA 1NBZB 5D7LA 5DT1H 1HHKA 4DN3H 5MI0B 2MSPA 2P49B 2HFTA 5FKPB 3EO0B 2NY2B 3GEWB 3NBNA 1DUYB 5CZXC 2FJHA 3MR9A 5KJRL 3Q2CA 4HJGA 4L9LA 4ODHH 3PGFH 3BP5B 3T09A 4JY4B 4YC2C 2XWTB 2DIAA 5TFSL 1D9KB 4WI8A 4JFXB 4AIOA 1E28A 1TZGH 3U6RB 2PUQT 2NY3D 4QRRD 3H3BC 1NMAL 3KYKH 4Z7WB 2VRAA 4Z7QF 2NY0C 5CGYD 1T83A 2X41A 3GBMH 1MJJB 4OZHA 2AK1H 3G6AA 2BVQB 3FOLA 1I8LC 1UA6L 2EE2A 4NUJB 1OQXA 3QUKB 3QUZA 5J3HC 4YHOH 5ALBH 2H1PL 3CVHA 1CXEA 3S35H 1HQRA 2EDJA 3TIEA 2VXQL 1FVCA 2D0FA 3QWRA 4KJWD 2RR3A 4POYA 2OK0L 4XXCC 1BD2B 4ZO9A 2OK0H 1HYSC 1AO7D 3TZVB 4XCCL 4NQVB 1JF1A 1IM9A 1DE4B 3QDHA 2Y06L 4L4VE 4ENEC 2H1PH 1KGCD 4NCC2 5HVWA 1V3MA 1HDMA 2P5EE 3DXAE 3PP3H 3QQ9D 3UEZA 3UBXI 5J3HD 4FFWD 5J6GA 5T1KD 3I02A 1OGAE 2QJDA 1NAMB 1AC6A 1A64A 3LMJL 5DYOB 3SDAD 3MTRA 5DRZA 1L4IA 1CE1H 1D5MB 3OB0K 2C3WA 4KZEL 5I1HL 2E8ZA 3QQ4B 3QCTL 3I2CH 1OQOA 3BWAB 5DRWA 5IKCB 3ZKMD 3L1OH 4CAGA 4MS8D 4Y16C 3C08H 5GGUB 1BFVH 4HUMB 2FZ3B 2CK0H 1RUAL 5IW3A 3ULUC 5F9DC 5BV7C 4NQEB 4L8DB 4NC1C 3STZA 4DK3A 2IH1A 4KKBC 1LEIB 2V2XA 1R3KA 4O5LL 5DVMA 3U4BH 3S5LB 2PR4H 4NIKB 3TO2B 3IDIA 3WV0A 4DZ8A 2V5MA 4FZ8H 2OL3A 3U9UB 3B6SB 4JVPA 2AV7B 1DANT 4HUXA 3L95A 4DGVL 4ODBD 2YS4A 5GISH 3NABH 1U8IB 4ODTH 4WWKB 4JHZA 1T03L 1N6VA 1H5BC 1JRHL 3I6GA 4OCNC 4XNYH 4J6RH 5K33A 1U58A 4NDMB 2YPVL 4Y4HB 2IPTL 2R2BA 4O2EB 2H8PB 4GKNB 2C7UB 3GRWH 2WLYA 3VFGL 4JFDD 3OKKB 4LSTH 3A67L 2OXHA 1U9KA 5BVJA 5E9DD 4NNYA 4EN3C 1L7IL 1TJGL 3R0MA 4V1DB 3TVMA 1YNLL 2LE9A 5B3JE 2PW2B 2EE9A 3UYOD 1U8MA 4KRLB 1U42A 1JVKA 5F1NA 1VACB 3FQRB 2OSLA 5EC1A 3B3IB 2JIXB 4XWGH 1IGFH 3WNKA 3RVWC 1I1AC 4LPCA 4OM1H 5FDWB 1IGYB 4LHUD 1JE6A 4YO0A 4Z9KB 1IC7H 3K7UA 3EDFA 2NCMA 5D1QA 3IAPA 2P5ED 4FQ1L 4KV5F 3WLBA 2GK2A 1VESA 3KPRD 1ZTXL 3SKMA 2AAVA 1A6UH 3FO1A 5HHPA 4X8JB 4EDXA 3D18A 3R8QA 1JWUB 3V79C 3U0WH 2ZSWA 3BZFB 3VG0H 4HGWA 4JRYD 5LCVL 1U3YA 4UT7L 2C4FU 1JZ7A 4MQXC 4NKOB 3Q1SL 1C5DA 1CDBA 1K2DA 4E41E 3EOYG 1KYOK 4KQ3L 5JO5A 4B41A 1IQDB 3BPLC 1IQWL 4ZUTA 3I85A 2Z31B 3O3UN 3S37H 2Y5EA 1NSNL 4YPGB 3V5KB 1FIEA 1KT2A 4GW1A 4LDEB 2ZCKL 4N0UE 2ADJB 2X6MA 2X4NB 1DVFA 1I9JL 1P53A 3W0WD 2HG5A 5H8DA 1J0ZA 5E95B 3GKWH 3U30C 4NC1E 3E8UL 5TDPB 1IQWH 1C08A 2X42A 3S3JA 1YNTA 4WY7L 1NCTA 1YJDH 2JELL 4UQ2B 3FMGH 1WSST 4BZ2H 1TQCB 3NIGE 4QHMB 43CAB 3E6HA 1UQSB 4WCYH 3TJHD 2YD1A 1EVUA 3DHJA 2VUYA 4EUPG 4TPRL 3O2WL 1H3XA 3O0RL 3ZKMC 5JDJA 5D7KE 3GHBL 1KIUA 4JQIH 1GC1H 3RWHA 1A1OB 1SVZA 4KJPD 1CD1A 1ORQA 1A7PH 1OHQA 2EYTA 1L6ZA 1QSEB 5J1TC 1H0DA 3MZGB 3RP1A 2F8OA 3S5LG 1SJXA 3PL6B 3GJFB 3OAZH 1QEWB 5JHLH 4PGCA 2V9RA 4PRHD 3HTLX 3HZMA 5F3BB 2F5AH 5GJTH 3TYGH 1NCCH 5IF0B 5L0QC 4XCFL 4OZGF 2FJFB 1BF2A 5I19H 5E1HB 3PQYD 2Z92B 5JOFA 3J7HA 5IVXE 4M8QB 5JW4Q 5LKNA 2R23A 4YQXL 2QLVB 1J1PH 4K3JL 1KTDA 2IG2L 3FONB 3TV3L 5C0NC 4IRJD 2EH8H 3KHOA 1LE5A 4GQ9L 5IIEB 4Y4FD 2F74B 3D85A 3Q6FB 5IJVA 3CH1A 3FAWA 1A7OL 3IKCB 3CSYA 1GOFA 1OL0A 1ZOXA 3RPIB 2DQJH 5C0BA 3D2UD 5FV1L 3FN0L 4L4TD 2BNQE 4HC1A 4PJ5A 5D7IB 1DQLL 4JFOB 3FQUA 4GMTL 5HYJD 5C70A 2LVCA 5T33H 4RZCB 2NX5A 4HZAA 4RSVA 2IMMA 4OUOA 1BVKA 1BVLA 4LKCA 1J10A 1KLGA 2LU7A 2VO5A 1EK3A 1MPAH 3IT8D 5EUKB 3WXWL 3VH8G 4P2RD 2IADB 5IHBA 4YGVA 4EIZC 2X70A 2KZ1B 5I1GH 4UAOC 4K71B 4IIQB 1OT1A 3IGAA 1KXQE 1IC7L 2VITB 4KQ3H 2W0PA 4PTUB 1JWMB 3VGAB 1UM4H 1H5BB 3WNOA 3MUGB 4XCFH 3WLWD 2OQJA 4TNVF 3QQ9C 1W2KT 4S1RH 2E3VA 1Q38A 3GSNB 4JRYE 4UT9H 4Y5XA 1TCMA 3NA9L 3WL9A 4DFIA 5INDB 4IOIA 2DLIA 4F7MB 5AZ2H 2VAAA 4WFHE 3ZKXC 1BFTA 5C07B 2ADFL 4U1SB 4GW4A 4JKKA 2YXFA 1NUFA 1UM5L 1VA9A 2HT2D 2FL5A 4WI9A 5ICXA 2D2OA 2Q76A 5T3ZH 3F5WA 4R0LA 1G7IA 1IGTB 3UTSE 5EZOL 4NQDB 3SDDB 3UX9B 3UTOA 4N0RA 2FGWL 5BW7A 4DGYH 5F9OL 1QRKA 2BNRB 5K9OA 2HT4C 4CRPA 4GBXB 1BJMA 2VSCA 2UWEE 4KK8C 4HXAH 4PJIB 5IB2A 5CJQL 4MQSB 2H3NA 1FNLA 4YHPB 5IEHA 5EU4A 5I1JH 2QHRL 4LSSL 1Z9SA 5GS2H 5I9QC 3RQ3A 2VIRA 1BWMA 1XIWB 2IPTH 1WT5C 4JRXD 4DUVA 4GRLA 3BKYH 2ENSA 5FUCE 3DURB 1MJ7L 1X5AA 2NTFA 1UXSA 5H2BA 1HKFA 4XCNB 5KS9F 4KDWA 4YHLH 2ZCKH 4H8WC 2W60B 3FQWB 5ITBH 3BMWA 3MRRA 4N0FA 4WUUA 4YFEA 1EERB 2UUDH 2PW1A 4JEGB 3KXFB 4U7MA 2IBZX 1JCKA 3DGGA 3UMTA 4YHYC 1U8QA 3F12A 3QULB 4AL8H 4NWTH 3ARFB 1AY1L 1DN2A 2CK0L 5KSUA 5K9QI 5EO1A 3QXAB 4KVCH 1HSAB 2VLJD 2I24N 3RA7H 4H8WH 4GS7C 4HGMA 3D2UB 1EFXA 1MCEA 4G9FD 4Z18A 3T2NH 3S98A 3GBNL 1IEBB 1WFTA 4XVTL 3RZCB 5F96L 3KJ6H 4M6ML 4MNGA 3GMPB 4JFFB 5DD1L 2P8LA 5ID1A 5DD6A 5BRZD 1B2WH 3WFHA 3MV9E 3NOIA 1CFBA 4OM0L 1SM3H 4HWBA 3Q5TA 2EO1A 4YDKL 3JTSB 2DLFH 3GSNL 5DFTA 5JIHA 1RK1B 5HPOA 2UY7A 1TVHB 2F15A 4MB5A 5TFSH 3IVKA 1IBGH 3EFFA 2VDOH 5KJRH 4PJ8A 4WFFE 4XPAL 3H9SE 4IMLB 3VXME 3X17A 3PWJA 4I9WE 4DVBA 2F9BT 3W5MA 1UACL 1W72A 4OZHB 3G6AB 3VGFA 4LCWD 4OCSL 4JN2B 2JCCF 1X9QA 4HWNA 2ITDB 4KTDL 5EBLA 1N2RB 3LN4B 1HHKB 5IJKA 3BXNB 1MQKH 1NC2A 1S7QB 5D2NE 1SYVB 1A6VH 4R2GD 2APTA 4XP1H 3FO2B 1KSRA 2GSIB 1MJ7H 3BISA 2ESVD 1DDHB 3F62A 3FZUC 3HE6A 5FYKE 3ZDXF 1RZGA 5EN2A 1I7TA 4GG6F 3HAEH 4ZO7A 3GMQA 4IJ3B 1DFBH 3QIUB 1N8ZA 4WFGE 5D8JH 5CJQH 1CXFA 2G9HA 1FZJB 2J8UA 2AV1A 4HHAA 4OAWB 5TE7H 4OD2A 1A3RL 2X4TA 1SY6A 2G5RA 2EDLA 4HKBA 2BXYA 4XPAH 1LO2H 4MDJB 1JHTA 2MCPL 5IM7B 3CXDL 1HQRB 4R4BA 2CGRL 3EO9H 1BJ1H 3ABZA 5BJTB 4OZIF 1BX2A 3OTTA 5DMIH 3D3VD 3QWOA 1P4IH 4HS8H 2ADFH 3LRGA 3LHPL 1Y6KR 5BQ7B 3VFNA 4UOW0 1DE4A 1IKNC 1NCAH 4S1DC 1LEIA 4WFGD 3LB6D 3QFJD 3CFEB 4WEUD 4DZ8B 3N9GH 4M7LL 1JZ5A 2BVPA 4HUXB 1MCPL 1YYMH 1NAMA 3RUGF 1NLBL 4PR5B 5DMKB 5D1XB 3GBLA 1RZJH 2NYYC 3OV6A 1QHPA 4NQDD 2CPCA 1NEZG 3BPOB 2HTKC 1FV1B 4QNPF 1AXTL 3KYKL 2XKSA 1KJ2A 1CD8A 4MAYD 3RIFF 3HC4L 4P2QA 2H8PA 1XCTB 3GIVB 2FBJL 5GRVL 4JGJA 5E5MA 3OPZL 2NY1B 1WGOA 1FGNL 5KSAD 5BVJB 4I2XE 3C60C 3LRSB 4X6CE 2DTSA 3RNQB 4HK0B 4NKMB 3X3GH 1P7QB 1IGCL 2EIZB 4PJAE 3VXSB 4OCLC 5F9JB 2CR3A 1FYTD 1BM3H 4OGAC 3MCKB 5ANME 1FO0H 3KS0H 3A6OA 1P1ZA 1P2CB 2LTQC 2GCYA 4YBLB 4GQPH 3CDCA 3CFDB 5JIPA 1AKJB 1IGYA 2DQHL 5CSGA 5ISZE 5J9PB 4NQXA 1WJ3A 5I6XB 4M3KB 1VFUA 3KPNB 4ZUSB 2NY2D 4RFNB 4O2EA 1A6TA 4KRPB 3QIBD 1LEKA 3QUYB 1T0MA 4JKPL 2V5RA 4H0GA 1ZHKB 3P3YA 1D6VH 2L4OA 3MA7A 3B5TA 4QF1A 2DOCA 4FNLH 1IRAY 1OAKL 5I1JL 4HIJB 5GRYA 1JK8A 3O9WC 5FA3B 1CCZA 3LEYH 3RIAF 5C0AA 4HV8B 1GCFA 3MXWL 3DMMB 1I1AA 1Z9MA 5EOTB 1TTUA 1IQDA 4K23L 4K8RL 3JTTA 1P6AB 2HJFB 2D03H 3BKMH 1SEQH 3AS2A 3PHQB 4AIXA 4E41D 1KNOA 4OZIE 4GS7B 3I50L 4U0RC 5KS9A 1D6EA 4PJXB 1P7HL 3KLSA 5DRXA 2F53B 2DBLL 5HY9A 1BJ8A 2FYYA 1MCDA 2NW2B 1IKFH 1DBAH 5EBMA 1XF1A 2Y6SC 3CC5A 4X8XA 1I9EA 5E6YA 1KCVH 5LGKA 3T1WA 5JOPE 4HS3A 4YUEL 3ARPA 1I9RL 1SYSB 3BPNC 2VNCA 3QUMB 4OIIH 4P0DA 5JA9A 4QHMA 4LQ1A 4CADB 2J2ZA 1T2XA 2WBJC 1SJEA 3P4NB 4GXVH 2WMPA 4DW2H 1R3HB 5J13B 4QNPE 2H2SD 1HEZA 4XP5L 2CIKA 2I07A 4ZMAT 4LBEA 3WIHL 3WNPA 4H25B 4NUGH 5KVFL 4JFFE 4J3XA 1NFIA 4PGDA 4G7VL 3SCMB 4HULB 3UPRA 2CLZA 2CSPA 3GSVB 4N5EC 3MV9B 5DJYA 5IP4A 4PFEA 1KIPB 1EHLL 4KMLB 1WFNA 3WIIH 4H1LB 1T5XB 3M17A 3MX0A 5E2VL 1DEEB 2R0LL 1HIMH 1ZVHA 4DW2L 1MCOH 2W0FB 1DQLH 2P1YA 4UILH 4BQ9A 2WQRA 2WWMC 4A2LA 1I1YB 1OAUL 4E0RA 1J8HD 3C8KB 4JVUA 1M7XA 3UJIH 4KDVA 3OL2A 4WFEE 2CQVA 1CL7I 4KY1L 3P0YH 3QDGB 2XG4A 5GZND 3PABA 4K7PY 1RHHB 2RGSA 3RY6C 5EIVA 3FONA 4FXGB 2XXCB 2VDLL 2PCPB 5HHOE 1UWEL 1NAKL 5CP7B 5JIKA 4Y16B 2XTJE 3BPCA 1FBIH 3TP4A 3FFCE 3N1MC 3NZ8A 4MXWL 3BGMB 3CDGA 3EGSB 1EEYA 4GJTB 3RPIA 3MRBB 4PGCB 1FVCB 5I1CL 5LAXA 4UNVA 5GRUL 4Z77B 1BD2A 1GAFL 4PB9L 2GTWA 3IXAB 1T7WA 1KUMA 3CH8A 4NQVA 3ISWA 4Y19E 5I74C 2ZCHL 3GMOB 4PRNB 1GXEA 1KTDB 1BVLB 2ICWB 5IOPB 1FLRL 4LKXB 1YMME 1KJVB 4NO5A 4UB0L 5C9JB 2YWZA 3D9AL 4MQTB 3UYRH 5LVEA 1BIIB 2HP4A 3SDCA 2AJZA 3LPWA 4QHUB 3EJZC 1I3VA 3RJQB 2A9NL 3K2MC 2MOVA 2B0SH 5DZNA 5DS8A 4UIMB 4W81A 2CDEA 3UBXA 4IRJA 1YJDL 5CIPA 5GGUA 3IXTA 4NGHH 2EDDA 4XHJD 2EEAA 1FZOA 4LHJB 2NY4D 3STZB 5FK9A 2OP4H 3FZUD 3BIKA 2R1XB 1AGCB 2P5EA 5DEZA 4Z7UE 4LCCC 5HVGB 2HMID 4P2OA 1A4KA 5A43C 2BJMH 4U1GC 5IESL 5IT2L 2E7LA 4P2YA 3FFDA 5JXED 3F5WB 1YEJL 3ARDD 3MJ6A 2DQEL 1OSPL 1CF8L 1T22A 4F37F 4MDIA 1YEEL 2YR3A 4KKLC 3K46A 1S5IH 2EEBA 3MGTB 4A6YA 5EOQL 4HEME 5HPMA 1NC2D 2FO4B 4OCWH 4P2CG 5D7LD 3T0XA 3ULUH 3PWVA 1ZVYA 4PJIA 1WIUA 2C26A 4F7MA 4XCCH 3B9KA 4AMKL 5D7KD 3KLDA 4ZPVA 1GGBH 2P43B 3ARGD 3FHAA 4GXUN 4IRZL 5FOJA 3JUYA 4IOFD 5ANMB 1G7LA 1SVCP 1VACA 3TLRA 1JPST 1NCDH 4WU7B 3BPLB 5LQBL 5CJ5A 3EO9L 3PP3K 1PLGL 5HHXL 3MMEA 1FZMB 4XWGL 3O2VH 4EOWH 1WZ1H 1B90A 4X4MA 2BNRA 3BKCH 2ATPB 5CGTA 4N0FB 5DEFB 2ZPKH 4U6XB 1YEHL 2YUVA 4MNQA 3SKMB 1S7UB 4FQHB 2R56H 2VYRE 4CN1A 3BMVA 2JK5A 4HJ0C 2HRPL 4K7PX 4KTEH 4OSUH 1MRCH 2X1OA 4FQXB 2R1WB 4EIGB 4JKPH 3UTQA 1RVFH 1C5DB 4HKJA 4PD4K 4XNYL 5EA0H 1LK3H 1DBKH 5I1EL 2B5IB 1W0WB 1C7SA 5HHME 1LK2A 4MX7A 2I60L 2XN9B 5TPWH 2R39A 1UB5B 2P48B 3MV7B 3EJJX 3ESUF 2DF3A 3QYCA 4E9LA 4QXUL 3AAZA 3TWCH 3WFHB 1FO0L 3DVIA 1FFNA 3DUHA 2XNAB 1XEDA 5I1DB 3ARTA 4WWKC 3GMNB 3O41B 3VFRB 4RWYL 3SCMC 1XR9B 2Q6WB 4ZFFA 4M7LT 4N8PA 3VFUB 1RUAH 1FGNH 2BERA 1G7MB 2G60L 4U4BA 1UADC 4NM4L 2X4SA 1CYGA 2FATL 4QRSB 4DGIL 3O9WD 2Z93A 1RZFL 2IFGA 3FQXA 3GUTA 3ZE2E 4Y7MA 5GSRA 4Z0BL 3DRTB 1JNHA 2KDGA 1W72B 5C08E 3ILQD 4KVNL 1YECH 2Y7QA 3ZYZA 2X4RA 5F72S 4JN2A 4NJ9L 1HCFX 4JFDA 3IDMB 1R0AL 4LCUB 5I8OL 3GFUA 5EBLB 5E9DA 3MLRL 3MRLB 3QNYA 4F9LC 3RX7A 1RZFH 2HTLD 4X4YB 3LQAC 3GDBA 3FB6A 3DROA 1LP9B 4NM4H 4ONGL 2JJWA 3SDXB 1QSFA 1KN4H 1WEJL 5DMGC 4ZXBC 1CTOA 3H9SB 1P9MA 3ROLB 3HAEA 3WNNA 4KWUA 2OTWA 4IMLA 1T0NA 1ND0B 4PG2C 5D6CB 4PY8J 2J3SA 3RDTB 4JY6B 3VGDA 1NC4D 1U8JA 3KPSB 3B8YA 4LPUA 1VCAA 2YPLB 3MA9L 2PTVA 3QAZC 5EIIA 3UTPD 2OMBA 1G6VK 2XTJB 4M5ZH 4P9MH 3T65B 4TNVK 3NH7H 2Q7YB 4JRYA 4ZNEE 4QCIA 1N3NA 3W11D 1EBAA 1YMMD 5L8LB 4DUXA 2GIYA 2HVJB 3RWCB 3LEVH 3FQUB 3SBWA 1Y6MR 2HA1A 3H3PH 1S78C 4WI6A 4PJ9D 4NZDA 5IVZA 1FZJA 2Y5TA 2J4WH 5T3XH 1KG0B 3L3DB 4OD2B 4GLRH 4HKBB 3W0WA 3QHFL 5DMKA 1JN6A 2FH8A 4QRQA 3SN6N 1QBML 3MLTA 4PRID 1FC1A 3NAAL 3PG2A 1WIPA 4I3SL 4NZRH 4NPYB 2YC1B 4G6ML 1IJ9A 3MGOB 3MUJA 1CE6A 4MA8H 1MLCA 3CZFA 5HVHC 2XPGB 1PGRB 3P73B 4GAYB 3WYRA 1JYVA 3JV6A 5DA0B 3C8HA 4S1RL 1LQSR 1OTTD 4KROB 3HRZA 3W39A 1F5WA 5K9KB 1BPVA 4ZDHA 1YMMA 4P9HH 4JG0L 3RY6A 1OSPH 1TJIL 3FQTA 3DPBA 4NQXB 4ZO6A 5B38G 4LAQH 1YEDB 2OJEB 4UV7H 4FQ2H 5D1QD 5B39A 2P7TB 4JN1L 3RA7L 2GAZA 3BZDA 1PD6A 3R1GL 4WI4A 3R4DA 2LU3A 4I2XB 5IB1A 3U46B 3QG7H 1A6AA 5AAMA 1DLFH 4H0IA 1AQKL 4ORZC 3T0AA 1JK8B 3OJDA 1OAYL 3SCMD 1J1XH 4R4FL 4CVWA 1CDIA 2JCCB 2EIZA 5F9JA 4HV8A 4OZFH 4PJ8C 1N26A 5E1AA 1WAAA 3UAJC 1Q9WA 5EOTA 5BZDB 4ZS7H 4HPOH 2FHBA 1LO5B 2F5BH 4I3GA 2G75B 1NJ9A 2VLJE 1TPXC 3HMXL 1PJ9A 1CT8A 2IH3B 4GQ9H 1FFOA 4AM0B 3UCRA 4Z7WF 1MFEH 3TZVD 5IBTL 5EBMB 3ZHKA 3RKDD 3P4MB 3CFJA 4R26L 1KXTB 4PPTA 1Q1JL 1QD0A 2NX5D 4XHQA 4UINL 2HKHH 4L3CA 4HS3B 4KKCC 5HD8C 1TVBB 5EWIL 5LBSL 1VSCA 1KXVC 3QXAA 2JB5L 1T21B 1DN0A 2LU4A 5TF1H 2N56A 3HG1D 1F11B 5DVNA 1F4YL 3VD4A 1KB5B 3A6BL 1JV5A 4Z7OF 2FB4H 1RIVH 3VD5A 3F6IA 3P9LB 2XN9E 4NHCL 1MCKA 1CR9H 2F53E 4Z7VE 3QA3B 4WEMB 3M8OH 4O2CA 4FFVC 4NQTA 1RK0A 4CBPA 4PUBL 3QPXH 1Y0LB 3UO1L 3WS6C 4I48A 4PJ9C 2W0FA 5DJ8A 4PJ7B 4KHXH 4MAUL 4JFEB 4L8SC 1S7XB 2EDFA 3UPCA 3DSFL 4KUCD 1T3FA 3S36H 3ARGA 3VXNB 4P46D 3PWPD 3D3VB 3F7VB 5E8PB 5IVOA 1X5JA 1I4FA 2YD5A 3GKWL 4DFHA 3VFPB 5HDBF 5CSZB 1IC1A 1U3JA 3HRPA 4TOYH 3CSGA 3B5HA 4LMQE 5IQ7H 2AJYL 4KUZH 2F58L 1BFOB 3HZVB 3HMXH 3MV9A 3NMEA 1N5AA 4HUUB 5DJYB 1KENH 4N68A 2GJZB 4LFHD 4PJBE 1J12A 1PAMA 5CJXA 3WE6A 3SDXF 2FDBP 3VXPB 1FG2A 4PY8I 4FS0A 4KAQH 4MNQD 2BZDA 1E6JL 5JR1H 2JKXA 4YDIH 3S36L 5EN2B 5LGHH 2BC4A 3BRGC 3TGXA 1CZ8H 2YMXH 1PY9A 5FYLL 2FCBA 5C92A 2A6JB 1FGVH 5LGJB 4E42A 3QDGA 2V5SA 1ZT4B 3S7GA 3AY4A 2V7HB 5DRNA 3JV5A 3I6LD 3QEQD 5EOCH 4MJID 3ZKND 3KDMB 4MD5A 1E4XH 1V7ML 4P3WA 5D1ZB 4GOSA 3UYRL 1WF5A 1KJVA 4P23B 4N9OB 4OF5A 5E8NA 1AGEA 5C0GB 4FFYH 5DA4A 1WWAX 3F6LA 1T1XA 3LKQB 1E4WH 5D1XC 4B7LA 2ZCHH 4BH8B 5C08A 3EOBA 2AJZB 1KLFA 1DBJH 3MODH 3MSPA 3PJSB 1UGNA 2X89D 2EYRA 5IHLB 3MRBA 1KCSH 2Q20A 1XGUA 3O3AB 2C3XA 3I75B 4JZOB 3WDJA 1F4YH 1MHHB 1HZHL 3ZSTA 1L0YA 1AR2A 5HSFA 3NACL 3VRJB 3MJGX 5E70A 4YFDB 1NGPL 1JPFA 3GMOA 5H94B 1AE6H 1IAMA 3BIKB 4G6FD 4FNLL 3ARUA 4KXZI 4YNYA 3NFPB 3QIWC 4XP9L 5I9QB 2VDKL 4ODXA 4QHNB 2DQTH 4MB4A 4M7ZB 3ZO0A 5HHVL 1T22B 5SWZA 1T03H 4LLAA 3T2QA 2WM0A 5DS8B 1CDYA 2UZIL 2H6PA 5DURD 1YPZE 1YZZA 1WZLA 1U3HB 4LHQB 3VMOA 4EZMA 3VJ6B 5C0FA 4ZG1A 4KI5D 5D4QA 1MCOL 2Y36L 3CFCH 3QNZB 4NN7B 3K2UL 4M62L 1IAIL 5I76B 4HS6B 3DO7A 4KJYB 4LVNC 5DTFB 3PIQA 1P7QA 2A77L 1CG9B 3CK0H 5EU6B 3O2DA 5F6HJ 5SWSB 1XGYL 3HFML 4OZIA 5C0CB 2VKWA 4AZ8A 3CCHB 3BVNB 4G8GD 5KVFH 2YK1L 3QIWA 1IEAB 3QCTH 3C5JB 2V5YA 2JLLA 4X5XB 2W59A 3REVB 1UM6H 4RA3A 1FHGA 2D7TH 4Z5RB 3DETD 1B3JA 4L9LC 4P5KA 3KPNA 2XA3A 3C5SB 4QYOB 4FRWA 3VFOA 4M3JA 4D9LL 3RTQA 5GZNC 3F65A 2E6QA 5BMFH 1LNUA 1UKSA 5BOZG 1UB6A 5T5FH 3F58H 1MAKA 4BELD 4MD4A 4ZYKB 4FQXA 4JHWL 3QUXD 1AHWC 4TTDC 5ANMA 1YY8A 4UBDC 2VDQL 1A6PA 3P0GB 4LVOC 4G9FA 5FAAA 2RAMA 4JPVL 3L3JA 3Q6GL 1FZMA 4WO4D 4FQIH 3ZE1E 1SEQL 3C09B 3QZWA 4F7CA 4LLDB 3FRPA 1IGJA 2VZOA 4G5ZH 4ELKA 3ILPA 4MD0A 5L7XH 3RTQC 1R5VB 2WV3A 5FYJD 1BAFH 2BK8A 2FRGP 3L7EA 4MNQB 1ZANH 4Z6AT 3OB8A 4DJMA 4LPWA 2W9DL 3CC5B 4WHCA 3WFDL 1HHGB 4XC1L 2DMCA 5I8EA 4YXLH 1MFCH 1AXIB 3MBXL 2G60H 5F7FA 1C16B 1CXLA 4EN3B 4XXDB 1LHZA 3LQAL 1DP0A 3RKPA 5F7WC 1OARH 3MV11 4F3FB 5BOPA 2GITB 3E6FB 2QADC 4IEFB 2F8XC 4LLYA 5C0BD 5KZCB 5HDQL 4FP8L 1HI6B 3I6LE 3WJLA 1WCQA 4RIRB 5HDQH 2CLZB 2MCG1 1I7ZB 5I1DA 2YD2A 4Y2DD 1JYWA 1KIPA 4EJ1C 4J23A 4RFOL 2Q86A 4APQC 2NXYC 1RZ8A 1XF2B 4RGNB 1OAYH 1RVFL 1XCQB 1G7MA 4WDIA 4ZTOH 4F7PB 4WO4A 1UZ8A 1Z2KA 3HE6D 2VN7A 5IW1B 1JHLL 1Q72H 1I1YA 3L5XH 5AG9A 4XHJC 7FABL 3C8KA 5BV7B 1NGQH 3DV4B 1FNHA 3DXAB 4OIBA 4UIKH 3KPLA 1JZ2A 3SKOA 3C2AL 1TJIH 1T0NB 4AK1A 2AABL 4ALAL 1RHHA 5I8KL 1RUKL 2QSTA 3EDJA 4ZOCA 4ZFZB 4EOWL 4FXGA 3O6ML 1A02N 5A3IC 1MREH 1W8NA 3FO0H 4NQCB 3KJ6L 4M6MH 1FRGL 3QNYB 5KOMC 4Z0BH 3U9PH 3RGVB 2VLMD 4JO2L 3EGSA 1WCBA 3LV3A 4PP1D 1U8HA 4L3EE 3SDXA 1D9KA 4JO2H 4HCRA 5ACMA 1TITA 2WWMD 4G8FB 4H5SA 1H3VA 1ZA3B 4X7FC 5JXEA 2ERJB 5B38A 4AL8L 4KVNH 2R4SL 4XPFH 1OSZB 4HW6A 1N59A 1RJYB 1S7SA 4PRNA 4RWYH 3QNXB 4HFUL 3VE0A 1FC2D 3MJ7A 3RDTA 1KG0A 4HPYH 3PHSA 2EDNA 3BIBX 5E99H 4NFCA 4M5YL 4K3DL 1CFVH 3TWCL 4BFBD 1U93B 4U1MB 4WGWB 3VFWB 2Q1EA 2ZUQB 4AT6A 3HMWL 4UT6H 2NYYD 1JHLH 2VE6A 3U82B 3O6LL 5GGTL 1VADB 3CFBA 1ITBB 3ZTNL 1Q0YL 4GUPA 2DKUA 3G5YA 4M7ZC 1T1ZA 5D9SB 3VDBA 1MQ8A 1CE6B 1RFDL 2EC9T 4S1DD 3LKPA 1RU9L 1A7RH 3FKUS 1SQ2N 2X9WA 1KPRB 4P5MA 4HXAL 4CL7A 2ITCB 3QHTC 1MOEA 1INEL 4PRHE 1NMCC 4QRRE 4X6EA 1OP3K 3MLSL 4W6WB 2WUCH 1F3JB 5I17B 1DBKL 5DC4B 3UJTL 1MAMH 1P84J 2VDKH 4ZUUA 1HHJA 4A6YB 5KSBA 3RL1B 5CEXB 3MJ8B 3QHZH 2VZSA 5F7EL 2FO4A 35C8H 2QQNL 1YPZB 1BOGB 4NQEA 2EKSB 2YEZA 5C0IB 5ICYA 5ACLA 2HLAB 1SHMA 1CGUA 1CU4L 1SJVA 5GZOC 3OHXB 4JDTH 3ULSB 4GAYA 2AV7A 3VG9B 5I1CH 2Z4QA 1WWBX 3C9NA 4UT9L 1JNLH 3VCLA 2ZCLL 3H6JA 4WWKA 4NN5B 1DTUA 4OQTH 1B2WL 3WLWC 1UENA 4F57L 4RMVA 1MIEH 3RY5A 3BPNB 3L6FA 1AHWB 4EVNA 5HGBA 1FP5A 2QR0B 3IDYC 4N0UB 3FO9A 2Q3ZA 4F33B 1JGDB 5F1OB 4LHUA 4R90H 4X99A 2B20A 5B39B 2R1YA 3BH9B 5I1GL 1FJ1B 4AM0A 4H8WL 5I66B 2IWGA 1T20B 4G6AD 1ACYH 5BMFL 3CZJA 1MUJB 3UP1A 2VLRA 3TVMB 4O58H 4JM2C 5DQ9B 1RUQH 1CGSL 5I15H 5FHBH 2MWCA 1QP1A 1MRFL 1OD9A 3OKOA 5DZOA 4NGHL 5BZDA 5L0QB 3SE4C 3HZKA 2DICA 1V7NL 4MNHA 2VDPL 2XZCL 4OLZH 5ESVB 1FNEB 4WW2F 3HUJF 4LVHC 2BDNL 3WFCH 1CT8B 3VFTA 4KPHL 3OJ2C 4GRLC 1AGDB 2FSEA 4IHOB 3FTGA 2R8SH 1G9MC 5T1LD 3IJHB 4NUGL 1XGTB 1ZHBA 3AB0C 3LD8B 2EH8L 4O02H 1FLTX 4F9PA 5INCA 2VABA 2QEJA 5KVGH 3QDJA 4D2NA 4TSCL 3KXFE 4KTEL 4Y19D 1V5JA 1FNAA 1DR9A 4ZAKA 2Y25A 2VLLA 2EYSB 4Z0XA 1HKLH 3I3BA 1UVQB 1OF2A 5GSVA 3RZCC 4WJ5A 3UTZA 1RULL 5DJ2A 5I73C 4U3XA 4K9EC 3S34H 4PJDE 1KCVL 1GGIH 3EYVB 4ZXBB 2AEIT 5C0AD 1CICC 1EO8H 4WTZG 3BEVA 4GW5B 4U6HB 2OR8A 5HI4C 5K93A 3GUTB 3HNVH 2Z9TA 5T1MB 3MLYH 1UM5H 1JNHB 2EECA 4ISVB 1J88A 3HPLA 4G80A 3HNTH 4R4ND 4Y1AA 3MLYL 2A6DA 3PWNA 4D9RD 4A6YL 4JFDB 1RIVL 1NBZA 3SDAA 3EJYD 1IVLA 4LIQL 4UDTB 1G7HB 3N1QC 5K59E 1JNJA 5TF1L 3FB5A 3MR9B 4QKXB 2JB5H 2K7QA 4TPRH 5EORL 1RULH 4WHTB 3V6BR 3B2UC 2XZAH 5HGDA 2HKHL 5IW6A 2DLTA 3K8KA 3E8UH 2VDLH 3PP4L 1V05A 1ND0A 4KQ4L 3H8NA 1BFOA 1TETL 4HUUA 3UPAA 3V6OC 4D94A 2ERJC 5KSAA 5C6TL 2QADD 5C6WH 4TUJB 5FECB 5EIIB 5GZOD 5E9DE 1ZT7A 1NSNH 5DC9B 4QRTB 2OL3L 1I7UB 2HRLA 3PL6A 4HWZB 4R97B 4JFDE 4YC2B 3WIHH 3CVHB 2EDYA 5KANG 1K5NA 32C2A 1FG2B 1MWAB 1QEWA 5GHWH 4HG4K 4PY7A 1N5YH 3PXHA 3ARBA 2NY0B 1S7RB 3MBED 2BC4B 2XWBB 2VR5A 1KGCE 3SGKA 3WIFA 4O58L 4FTVD 3UDWC 5FF6A 1IM9B 1MFAH 5H94A 3VRLF 5IVZB 4U1JB 4YHMH 5IQ7L 1A6ZB 3HR5A 4WU5B 1MRDL 4EDWL 5J6GB 2R2CA 3QWRD 4XPTL 3LKQA 2Z8VC 1A7BA 4ESKA 4XT1C 3AU1B 4P9HL 5DURB 3S97C 1QSZA 4PBXA 4NOFA 3PJSA 1I8IA 4MQ7B 2EYRB 1WAAF 4ODWB 2A2QT 3BRDA 1AI1H 2E27L 4NNXB 3O3AA 3I75A 2DM3A 3O6FA 1PQZB 5SV3A 1WC7A 1BMGA 5T1DL 3ZSSA 4OF3A 5DWUH 1J5OL 2C1PA 3E1F1 1JPFB 4GAJH 3ARDB 1BQHB 3EDDA 3PHOB 1IT9H 3PDGA 3V6FA 4JAMA 4L1HA 2F54B 4F58H 3P73A 3DO7B 5T1LB 4NZRL 2DKMA 4IDJL 4Z8FL 1D6VL 4RRPG 2IADA 4N0YL 3CXDH 2NY3B 3PGDB 4I5BA 1MY5A 5K9KA 1RJCA 2VH5L 1E27A 5ITFA 4WO4C 3NIDF 4K8RC 1QRNA 3MRGB 1T83C 3OGOE 5IHZA 1GGIL 5EIQA 5EPMB 4NDMA 4PTTA 2EICA 3WSQL 2GAZB 4JRXB 3QUXB 4ZFGH 5C0EB 5A2JH 5FO7A 1D5BB 1S78D 3OKKA 1Q1JH 1IGIL 2COQA 5CEZE 1NCBL 3H3PL 1M05A 4XX1G 4JHAL 1LNUB 4NJAL 1U3ZA 2BSSA 2E6JA 4H88L 4Z7NE 3TPKA 4W6YB 3J8F7 4FXLA 4OTXH 4FFZL 4LCYB 4JFPB 1Q0YH 5IJKC 3OPZH 4L4VB 1KCRL 3KLAA 4L3AA 3VI3F 2FGZA 4JZJB 3VXSE 2FL5B 3B3IA 5ICXB 1OGAB 4LOUD 3O2DH 3HC0B 4KROC 1H9VA 4Z5RA 3VDCA 5D1QB 4M5YH 5B4MD 1FZKB 1J8HA 2YD7A 1BECA 4AH2A 5C0JB 1OLZA 3C5SA 5IFAH 4MD0B 4HUWA 3WEXB 4EUPB 3O81A 5MEQA 1J0YA 4X7EC 1QBLL 2R4SH 2H3NB 4GG8A 4RNRA 4NO3A 1DLFL 3T8XB 1BZ9B 1G6RH 5CEZD 3P4MA 5C86A 3D18B 2FBJH 5IB5B 3OKEB 2DQGH 4OFVA 4MCYA 4RX4A 1MI5D 3LHPH 1ZT1A 2CLRB 4UV7L 1F11A 1ZE3C 2BSRB 1EFXD 4PJ7F 3STBA 3CIQA 1OY3B 4JDZA 3WUZA 1ZLUK 3OGCA 5DQJB 4M7LH 3V5HB 3E2HC 2DM2A 5CJOH 1UA6H 2JJVA 5I1AB 1DVFB 2EE6A 2ORBH 4G7YH 3QXVA 3KLHD 5I1KL 4OLEA 4RFNC 3ARFA 3QH3A 1HNGA 2NY0D 4OLWL 4JVWA 4LPXA 4NRYB 4PJGA 3WHXB 4RBPK 4J8RB 35C8L 5E4EC 3L5XL 7FABH 4UQ2A 1M4KA 1UZ8B 3MFFB 2YA1A 4JM2F 4E41A 2X1QA 3C6LB 3FFCD 3D2UA 5IW1A 43CAA 3D39A 1UQSA 4L4TA 3VGHA 5DO2D 4BA8A 3ARGB 4K94C 2IANB 5D6DA 5CZXD 5HHOD 4F8TA 2JB6A 5TGBB 4JO3L 1QACA 1NGXB 1FVDA 3BFOA 1HI6A 5DQDL 4ZFZA 3PXJA 3RWHB 3V8CA 3MRJA 2GJZA 2DAVA 1EFQA 5J8OA 3X3GL 5GS1A 1CD1B 2WBJD 1SBSH 5BS0A 3EAKA 2BMKA 4X9BA 5LWYL 3GJFA 5E2WH 3CGTA 3LQAH 1WCBB 1G7PA 3SE8H 3U83A 4RAVA 1ZAGA 1MRCL 2ESVA 4KI5C 4MA1B 1ZLUH 1VFBB 5BZWB 3DV4A 2P5WD 4PRBA 3X12A 4Z7QE 4XWOD 4LVEA 1V3JA 4L8CA 1L9NA 4Q97A 4HCRH 2YA2A 5MEOB 5B38B 2ORBL 1U8PB 4WV1C 1YC8A 1CXHA 3D0VA 1YQVL 4KHTL 4QT5A 5D1ZA 1H8SA 3ZZ1A 2VL5B 3FT2B 3ZMRA 5EZOH 3D85B 3Q6FA 4JKL