1BGYJ

Cytochrome bc1 complex from bovine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 18
structure length 62
sequence length 62
chains with identical sequence V
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1bgyJ00
1NTZJ 1BE3J 3BCCJ 3H1KJ 1EZVI 1KYOI 3H1JJ 3L73J 3L74J 3TGUJ 1NTMJ 3L75J 3CX5I 1SQVJ 1NU1J 1SQQJ 4PD4I 5KLVJ 3H1IJ 3H1HJ 2BCCJ 1P84I 2IBZI 2FYUJ 1BCCJ 3CXHI 1PP9J 1L0NJ 3H1LJ 1SQPJ 4U3FJ 3L72J 3L71J 1BGYJ 1SQBJ 3L70J 1L0LJ 1NTKJ 3CWBJ 4D6TJ 1SQXJ 1KB9I
chains in the Genus database with same CATH superfamily
1NYHA 4H13D 1KZUB 1NTKD 3H1HD 2QM7A 5AVYB 3VP9A 3CCRP 1BDCA 3TGUJ 4M3LA 2W90A 4AUWA 1FZAA 3L72E 2JWAA 3H32A 2PAJA 2WPSA 3A3YB 5AW8B 3BRVB 2Z4EA 3L75E 3VMZA 3B5NB 3HD7D 1X22A 3H1HJ 1GK6A 4IL6E 4WY4B 5KKZB 3E1IA 3H1HG 3M06A 3F5HA 2M0BA 5DJTB 1J1DC 1S3JA 4N78E 1N86A 5CBNA 2IBZD 3A0HE 2BEQD 3C9IA 3A0HH 3PJSK 1FE6A 3GF3A 3AE5C 3GHGC 5CJ0A 5KAIE 2AEMA 4I2LC 1IK7A 4L75A 5TISH 1HTLC 5APXA 3U1CA 3EQ2A 2OQQA 3N7NA 1LWUB 1IJDB 4WY4C 1H8AA 2AXTH 5CJ4A 1SQPD 2C0WA 2K9YA 2ZXEB 1RY3A 2RMZA 3H1JD 5AVWB 1KILE 2M3EA 3N4XA 5E79H 3A5TA 3G71P 3EWKA 1QVFO 1CI6A 1G1IA 3KZIH 4YPCA 1M1KQ 2H7HA 3V2NA 2GUSA 3L73J 2QJYB 4U7JA 2E74B 2ZJSE 1RE4A 4EI2A 4KJMA 3M91A 1K05A 1RQUA 2IYOA 3I55P 1AJYA 1PGOA 2BCCJ 3EFFK 3FWLA 2BCCG 2W6BA 2GUVA 4QMAA 5APTA 3L71G 3Q2YA 1L0ND 2MKVA 2ZAEB 2N9YB 1T2KD 2JO1A 2WSSH 4H44B 3H6PA 3U1AA 1NAYA 1KB9E 2FFDC 2YKOA 2IX7C 2CK3H 4IL6X 1ZXGA 1FZCB 2E5YA 3A7OA 1X79B 1SFCA 2O01H 2OARA 3CCMP 4C46A 2N1TB 5AVUB 3RBZA 5KLIC 3CD6P 1L0NG 1BE3G 3IR9A 3NXSA 4I7ZB 2HPCA 1OVUA 3P8CE 4EDFA 2J59M 3Q5PA 3CI9A 2KS1B 4I1LA 5AVQB 5CBOA 1SQXJ 2BEZF 3GHGA 3AE9C 5KTBA 3L70G 5B5EH 2QA4P 1OMIA 3B5NA 2ZXXA 1EC5A 1GMJA 3KPEA 3PH0A 4WY4A 1NAFA 5DJUB 3RK2D 4A7PA 5CCGA 1M1JA 1JEKA 2A06E 3WU2E 2FY8A 4PD4D 3CPWO 2XDJA 1LTJA 5APVA 1SQQD 1FDMA 2AXTE 4HB1A 2KNCA 3R2PA 1L0LG 3HE5B 1LTJC 1SQPK 4ASWA 1NH4A 3HUSB 4N3YB 1HWTC 1PZQA 1FZGA 1BCCE 1YTZT 1PP9J 5AW6B 1ZR4A 1S2EA 1M7LA 3BRTB 1RE3C 4DOJA 1VQNP 3SFDC 1BCCG 1UIXA 3RL0C 2OYHA 2WWWA 1LJ2A 3WUVA 3G3ZA 1ZV8A 1SQBJ 2JKVA 3Q5SA 4R4LA 1ZMEC 2XV5A 1USDA 1N8RQ 1LTJB 3RBXA 4C7RA 2RN0A 3SWFA 3R4YA 3H1KE 2QJYC 1URQD 2ZT9B 4PV1D 2KYVA 2P67A 1KILB 2WSCH 3L4FA 2POHA 3M9BA 2K3RA 5APYA 2V7QH 1ZRTE 1NU1K 1VF5B 3MTUE 1ZN5A 3M9HA 1PGQA 1BDDA 1IFMA 1SQXK 2H88C 1J1EB 5KLVJ 1VQMP 2IBZG 2P1JA 2KI7B 2IBZI 4JBZA 1ZP0C 3W67A 2OYHB 1OVRA 3CC2P 2OTLP 4MN4C 2NZ2A 2IPPA 4ZKUA 2W6JH 1Q7YQ 1T2KC 2UWJE 1JY3O 3L73G 3B71A 1PV3A 1SQVE 2D2CD 1R5SA 2K88A 1EQ7A 2L91A 2NPSB 3D6YA 5CCHC 2BCCE 1T6AA 2KLVA 2M5AA 5BU5A 3HTKB 1P84H 2NRGA 1VQOP 1JTHB 2KIKA 1KB9D 1GL2B 1S5LE 5BVZA 1S72P 1PP9E 2ZYGA 2I1KA 2FKWB 4H13B 4YXDC 1LTSC 1QX8A 2KNCB 1W2EA 1PPJE 3VTPC 3AEEC 4YXWH 2BCCD 5KLVK 1VQ7P 2OTKE 3M0DC 1Q81Q 5C39A 3KXDA 2DW3A 2YXRB 4WY4D 4L76A 4GDOA 1FBMA 3II6A 3CC4P 4UB8H 1JOCA 2OYIC 5AVXB 2C0XA 4GT1A 1RF1A 3GG2A 1VDFA 2WPQA 2AXCA 2YNYA 3EFGA 4PJ0H 4AQRD 1EDIA 3H1ID 1JTHA 1KQSO 1YJ9P 2WVRA 1RF1C 1J1DB 1SQBK 1M56D 1WRGA 3H1JE 3TNUA 1SQPE 1DH3A 3O8ZA 1PFIA 1DD3A 2P7JA 3M9QA 2WZ7A 1N73C 1L0LJ 3BCCD 1DEEG 4D6TG 4W80A 1SQQK 3AEAC 1LT9C 3JC22 4D6TJ 4YTPC 1LWUA 1OXZA 3L72G 1YHQP 1FZEA 1X0TA 2Q3EA 1N2DC 1BGYG 1SQQG 3E7KA 3SWKA 4EOTA 1FJPA 1IZNB 1L4AC 1SFCC 2E74D 3PP5A 3VOPA 4BXLA 3L75D 3TF5A 1YI2P 3CCSP 4GOEA 5CHXA 1VQLP 1SQVJ 3E1RA 1URQC 4PV1C 2A45I 1SQBG 1IFPA 4JF7A 3RK3E 3TDKA 3TNUB 1VQ4P 3O6QA 5CCHD 1FDOA 1JY2O 4DCKA 2BASA 3F89A 3AE3C 1BCCD 3CCEP 4TT3H 3V5BA 1PL5A 1DD4A 2NPSA 4K3AA 1KN7A 1KB9H 1EZVG 1KMIZ 2LR2A 2ZYDA 4RO0A 4UB6H 3V2RA 4AYCA 2PP6A 3Q3DA 1SQBD 1N7SB 1FZBA 1P84D 1ZW0A 2FYNB 2QJKC 3GF7A 3GW6A 5CCGC 4LGDE 1S9KD 4PD4H 5GTIH 3VMXA 5KLVG 1N7LA 1KYOD 2FYUE 2N9BA 1A02F 2ZVNB 1VQ9P 2ZFCA 4Y99B 2R3SA 1KB9I 2YO3A 2ZYAA 1HF9A 1K04A 3A0BE 2HPCB 1NTMG 3AEFC 2G3AA 3L74J 2WT7A 2WTYA 1NTMJ 4L74A 5KJ7D 2KS1A 2ZVOB 1FOSF 3WU2H 2JJLA 3L75J 4JYCA 2ZT9C 1RH5B 4WVZA 3Q1MA 3MHVA 2R44A 1JMMA 3AECC 2JR8A 2YIUB 1Y8AA 1NKNA 2FBWC 2QRXA 3AE4C 3PTZA 3AEBC 4JYBA 5APUA 3FX0A 3MGNA 3OAKA 4RKUJ 3D71A 1H89A 1YTZI 1X9VA 2YXQB 3HE5A 1GW4A 3GMAA 2Z5HA 4U3FJ 3L71D 1T3JA 1AFOA 1WMKA 5APQA 2E76C 3AE8C 1JCCA 5TJHA 3H1LD 3QWOC 1HBWA 3IF4A 1PGJA 1U7JA 3H32B 1HGZA 2PGDA 2HG5D 2YIUC 3AE1C 1SFCD 2E74C 5AW4B 5H2FH 1BE3D 1URQB 2OGUA 3ABVC 3H1KJ 1KILD 4PJ0E 4PV1B 1GDTA 1EDLA 4NPEA 3O6QB 1VF5D 1LTTC 2E5TA 2FXPA 4U3FE 1L4AB 1QL1A 2VRSA 3HE4A 1R8EA 5GTIE 3ZDMA 1GU5A 1HH0A 3KQGA 4IFMA 3RGUA 4OGQB 1VQPP 4L73A 1D7MA 2FYNC 3QH9A 2FXMA 3CWBG 1KQFB 1K9MQ 1NHLA 3D70A 1U7MA 3MP7B 1KQGB 5CCGD 3CCVP 4I7ZC 1IK9A 1X8YA 4EIJA 1M8OB 3OW2O 2O01J 3TGUE 2B87B 1S5LX 1DX7A 2QSIA 2C9LY 1KYOH 1MFZA 3JSVC 3L74E 2K37A 1MZ9A 1NWQA 2NPSD 2WSFH 3P8MC 2Y0EA 1AVOA 4XA4A 1W5CE 5AW7B 1KFNA 2A45G 3H25A 1GD2E 1JY3P 2E43A 1NTMK 3KDPB 3KYQA 2WT7B 1T8ZA 1HUCA 1NTKE 1OW6A 1GL2D 2P2UA 2R32A 3SFEC 4ZNCA 2OYIA 1H0TB 2B9BA 3HD7C 4GKGA 1BE3J 1MUUA 3HTKA 1EZVI 4JQ0D 4OWFA 4W7YA 4ZKPA 4NPDA 3NTNA 4O9BA 1JO5A 4KT0J 3P7KA 1LNQA 5AW5B 1SQXG 1NU1J 4IL6H 1JY3N 2QM8A 4RJTA 3CC7P 1EZVD 1NU1G 1NTKG 3TGUD 1K8AQ 2I1JA 4UB8E 1M90Q 2AEFA 2XNXA 1USEA 3PLNA 4H0LC 1NVOA 3L74G 2P10A 5KAIH 2OYIB 3CCLP 1H0TA 4GOFA 3GHGB 1EXJA 1LTBC 2O1JA 1RF1B 4U3FD 5B66E 3L71J 1FS0E 1URQA 5AW0B 2WSEH 3L73D 3LW5J 5KJ7A 2WPRA 3CWBE 4DJGA 2XNDH 3VN0A 1OW7A 4R4MA 1CW5A 1YITP 5E79E 1VF5C 4WBAA 2J58A 3G6EP 1ZOYC 1NTZE 1J1EC 2J5UA 3H1JJ 3H1LE 1L0LK 1QGKB 2E75C 1FU1A 3CL3D 4CPGA 2KLUA 2YKQA 5KAFE 1OW8A 2I8DA 1CSBA 2E76D 2YKPA 1LP1A 4WWIA 1Z56A 3MZWB 1GTWA 1KC8Q 2JEEA 1HJBA 1MKMA 2LXCB 3RL0B 1S4XA 2QJPC 4Y28J 1KD1Q 1PP9D 3L37A 1K73Q 1FJKA 2FXOA 1LTAC 2C9NY 1N7SD 2CPBA 2O3JA 2N1TC 1L0NK 3A2AA 3L70D 1N7SC 2Y0CA 4JPZB 3H1IG 1QL2A 1KORA 4IOIH 5AVTB 2Q7CA 1OWAA 4ASVA 1N7SA 1L2PA 2WITA 3CWBJ 2W6AA 3USSA 1DEBA 3RK2C 1L0LD 3BCCJ 3VMYA 1A02J 1LP1B 5CCHA 2K1AA 1CZQA 3BCCG 5APWA 1T3UA 1UIIA 4D6TD 2XU6A 3TK1A 2QVAA 1YJNP 4Y99C 2R5DA 1RE3A 2GA1A 1KQLA 1M57D 5KJ7C 1XTCC 2W8ZA 2KXPB 1P84E 2NPSC 2Q3IA 1CI6B 1S1CX 1ZRTD 1JMBA 1NKZB 3SWYA 3V4WA 3BVHA 3WUUA 4HH2A 1OIPA 3I5CA 1RQVA 3M0AA 3L36A 4Z1MH 1N73B 2FYUK 5EFWB 3RK3D 3HUSC 4B86A 2YO2A 3C8VA 4EYYQ 1Q86Q 3IAOA 3TSIA 5BU8B 3NMDA 3AE7C 1JB0J 5AVRB 5GTHH 4ZMDA 1IO4A 3C1LA 3CX5E 1Y47A 3U59A 5KAFH 2FFDB 1NTKJ 2Y9YA 1RE4C 1FZCA 4GODA 1SQVK 1NOHA 1W2BO 3VYIA 1SFCB 2JP3A 1KILC 1SQXD 5AW9B 2YMKA 2GM4A 3BCCE 4UB6E 1NU1D 5TISE 3BASA 2RH0A 2KP8A 3T97B 3PHLA 2KOGA 3AEDC 2WSFJ 3OJAB 1SQQE 1BGYE 1L4AD 2JDIH 3B4SA 3IFMA 3MD0A 2M3BA 1SQQJ 4NPFX 5M1BA 4OGQD 2QJKB 1AV1A 1ZLLA 1G2CA 3H1IE 1NTZK 1WT6A 2KZJA 3PRJA 4W7ZA 4D6TE 1L4AA 1JCDA 3D6ZA 1QEXA 2ITAA 1M1JB 3CXHI 2QE7H 4RESB 2FFDA 1L0NJ 1OFCX 2QJPB 1Q90D 1SQPG 1JY2N 2H8PD 3H1JG 1VQKP 1SQPJ 3P8CD 4WB4A 3S9OA 1YJWP 1U57A 1GU4A 1IC2A 2QG4A 2R5BA 1IFNA 3MUDC 4C7NA 1SP4A 4H0LB 4TLFA 3L70J 2B87A 1AQTA 1PPJD 1ZR2A 1YQ3C 2A45H 1RF0C 2YMYA 3MUDA 3T97A 1M1JC 2IFNA 2E75D 1EDJA 1S5LH 2AEJA 3BATA 1RF0A 2H43A 2KB7P 2SPZA 3B5NC 3K5BA 5KKZC 1NTZJ 1KFMA 1JY2P 1YBKA 2HLOA 2WQYC 3H1LG 1NTZG 3WUTA 1QLED 1HJ0A 1PPJG 1SLQA 2HYNA 3AEGC 3FGAD 3V2PA 2XKMA 1SQVD 4KHXA 4H13C 1PP9G 3B5ND 3H1IJ 3CX5H 3HD7B 3LW5H 4PD4I 2B89A 1NJIQ 1KILA 3V6IA 2IZ0A 1BCCJ 5APSA 2D2CC 3KHUA 1MFTA 2W83C 1SQVG 2V7QJ 4OVNF 3M0DA 3LIDA 4LC1A 4BRYB 3L73E 3W68A 1BGYD 1HVVA 2P58A 3LIEA 4N6JA 3RK3C 1NO4A 1IFDA 3MIWA 1NU1E 3RL0g 3VMAA 3P32A 1SQXE 2IBZE 1JUNA 1JM0A 1E79H 3FWNA 1Q2NA 3H1KD 1G1JA 1VQ8P 1OZHA 3KZIE 1AA0A 3CX5D 2QEXP 1G2CB 3Q5RA 3ITKA 5GTHE 1VL2A 2Q1KA 1GL2A 1TU3F 2R3CA 3H1KG 4BRYA 1GZLA 2E76B 1GL2C 1P84I 3VP8A 2Y9ZA 4C7NB 2JWDA 3S1KA 3RL0D 4DZOA 4H44D 1KTMA 2HFED 3CLQA 3CXHD 1DIPA 3TGUG 1J2JB 2H89C 3FXDA 5KLIB 1Y9BA 1EXIA 1LTGC 2OYHC 2N1TD 4PD4E 2A06D 4IFDK 2PRRA 3G9RA 2M8RA 2WMMA 3L74D 2IYPA 1SVFA 1LGHB 2O01N 1BSHA 3S4RA 1L0LE 3HE4B 4OGQC 2HODA 4U3FG 2B88A 1PGPA 4HJGH 2Z5IA 5B5EE 1VQ6P 2A06G 2L5GB 2O1KA 3A0BH 1KYOI 3HD7A 4HYTB 2CPSA 4IFFA 2PFXA 5KLVD 1EDKA 1IFIA 3HUSA 3L35A 5AVSB 3RK2B 3UIAA 2OYOA 3V4QA 3L70E 1OX3A 3G4SP 3B8EB 4K35A 1LT1A 2WPVB 3CMAP 1FZFA 2OTJP 3CXHH 1NTMD 4XFJA 5L8RJ 4BWNA 1YIJP 1PIXA 1BE3E 1L0NE 3GLMA 1NGMB 1E5WA 1JNMA 2XZRA 1VPCA 3CCQP 1FC2C 3H1LJ 1AQ5A 1VQ5P 3WMM0 3RK3B 1LWUC 1BSNA 5AW3B 2IFMA 4XE5B 2WSEJ 5AVVB 3L72J 2KZIA 1N73A 1BGYJ 2LXBA 1FDIA 2Q6QA 3L71E 5AW1B 3CCJP 1H88A 1NTZD 2E42A 2KK7A 1AVYA 2K9JA 5K5GB 1GK4A 1KV4A 5AVZB 3IN6A 1FAVA 4DT0A 2Y0DA 5AW2B 2RKLA 2Q9IA 3AE6C 2ZT9D 5H2FE 1Q82Q 1IFJA 1NTME 3CWBD 2G8YA 2FYZA 1R5LA 3HRNA 1NTKK 2QIWA 1OVVA 5B66H 1LT9B 3CX5I 1MV8A 3JCUE 4GIFA 3JCUH 2FYUG 1YQ4C 5KLVE 2FYUJ 2IDBA 5CMZA 3CMEP 4N78D 1RHZB 3TYYA 1XTGB 1QVGO 1YYCA 1FOSE 2Q5UA 2K9JB 2M5AB 1GW3A 2KSJA 2WSCJ 3AE2C 4HKZH 1EZVE 4H44C 4LLHA 3V2QA 3I56P 1KYOE 2FYUD 2D2CB 2KSEA 2LKMA 3NFQA 3FXEA 2HODB 2N1TA 1FZCC 3L72D 4H0LD 1S9KE 3CCUP 2HR3A 1LTIC 4I6MC 3SSUA 1SS1A 1SQBE 2V4HA 3H1HE 1LT9A 2E75B 3OA7A 3CXHE 2KUBA 2MJZA 2IZ1A 4OH8B 3L75G 1HGVA 2W27A
chains in the Genus database with same CATH topology
1NTZJ 1BE3J 3BCCJ 3H1KJ 1EZVI 1KYOI 3H1JJ 3L73J 3L74J 3TGUJ 1NTMJ 3L75J 3CX5I 1SQVJ 1NU1J 1SQQJ 4PD4I 5KLVJ 3H1IJ 3H1HJ 2BCCJ 1P84I 2IBZI 2FYUJ 1BCCJ 3CXHI 1PP9J 1L0NJ 3H1LJ 1SQPJ 4U3FJ 3L72J 3L71J 1BGYJ 1SQBJ 3L70J 1L0LJ 1NTKJ 3CWBJ 4D6TJ 1SQXJ 1KB9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ J;  1BE3 J;  3BCC J;  3H1K J;  1EZV I;  1KYO I;  3H1J J;  3L73 J;  3L74 J;  3TGU J;  1NTM J;  3L75 J;  3CX5 I;  1SQV J;  1NU1 J;  1SQQ J;  4PD4 I;  5KLV J;  3H1I J;  3H1H J;  2BCC J;  1P84 I;  2IBZ I;  2FYU J;  1BCC J;  3CXH I;  1PP9 J;  1L0N J;  3H1L J;  1SQP J;  4U3F J;  3L72 J;  3L71 J;  1BGY J;  1SQB J;  3L70 J;  1L0L J;  1NTK J;  3CWB J;  4D6T J;  1SQX J;  1KB9 I; 
#chains in the Genus database with same CATH topology
 1NYH A;  4H13 D;  1KZU B;  1NTK D;  3H1H D;  2QM7 A;  5AVY B;  3VP9 A;  3CCR P;  1BDC A;  3TGU J;  4M3L A;  2W90 A;  4AUW A;  1FZA A;  3L72 E;  2JWA A;  3H32 A;  2PAJ A;  2WPS A;  3A3Y B;  5AW8 B;  3BRV B;  2Z4E A;  3L75 E;  3VMZ A;  3B5N B;  3HD7 D;  1X22 A;  3H1H J;  1GK6 A;  4IL6 E;  4WY4 B;  5KKZ B;  3E1I A;  3H1H G;  3M06 A;  3F5H A;  2M0B A;  5DJT B;  1J1D C;  1S3J A;  4N78 E;  1N86 A;  5CBN A;  2IBZ D;  3A0H E;  2BEQ D;  3C9I A;  3A0H H;  3PJS K;  1FE6 A;  3GF3 A;  3AE5 C;  3GHG C;  5CJ0 A;  5KAI E;  2AEM A;  4I2L C;  1IK7 A;  4L75 A;  5TIS H;  1HTL C;  5APX A;  3U1C A;  3EQ2 A;  2OQQ A;  3N7N A;  1LWU B;  1IJD B;  4WY4 C;  1H8A A;  2AXT H;  5CJ4 A;  1SQP D;  2C0W A;  2K9Y A;  2ZXE B;  1RY3 A;  2RMZ A;  3H1J D;  5AVW B;  1KIL E;  2M3E A;  3N4X A;  5E79 H;  3A5T A;  3G71 P;  3EWK A;  1QVF O;  1CI6 A;  1G1I A;  3KZI H;  4YPC A;  1M1K Q;  2H7H A;  3V2N A;  2GUS A;  3L73 J;  2QJY B;  4U7J A;  2E74 B;  2ZJS E;  1RE4 A;  4EI2 A;  4KJM A;  3M91 A;  1K05 A;  1RQU A;  2IYO A;  3I55 P;  1AJY A;  1PGO A;  2BCC J;  3EFF K;  3FWL A;  2BCC G;  2W6B A;  2GUV A;  4QMA A;  5APT A;  3L71 G;  3Q2Y A;  1L0N D;  2MKV A;  2ZAE B;  2N9Y B;  1T2K D;  2JO1 A;  2WSS H;  4H44 B;  3H6P A;  3U1A A;  1NAY A;  1KB9 E;  2FFD C;  2YKO A;  2IX7 C;  2CK3 H;  4IL6 X;  1ZXG A;  1FZC B;  2E5Y A;  3A7O A;  1X79 B;  1SFC A;  2O01 H;  2OAR A;  3CCM P;  4C46 A;  2N1T B;  5AVU B;  3RBZ A;  5KLI C;  3CD6 P;  1L0N G;  1BE3 G;  3IR9 A;  3NXS A;  4I7Z B;  2HPC A;  1OVU A;  3P8C E;  4EDF A;  2J59 M;  3Q5P A;  3CI9 A;  2KS1 B;  4I1L A;  5AVQ B;  5CBO A;  1SQX J;  2BEZ F;  3GHG A;  3AE9 C;  5KTB A;  3L70 G;  5B5E H;  2QA4 P;  1OMI A;  3B5N A;  2ZXX A;  1EC5 A;  1GMJ A;  3KPE A;  3PH0 A;  4WY4 A;  1NAF A;  5DJU B;  3RK2 D;  4A7P A;  5CCG A;  1M1J A;  1JEK A;  2A06 E;  3WU2 E;  2FY8 A;  4PD4 D;  3CPW O;  2XDJ A;  1LTJ A;  5APV A;  1SQQ D;  1FDM A;  2AXT E;  4HB1 A;  2KNC A;  3R2P A;  1L0L G;  3HE5 B;  1LTJ C;  1SQP K;  4ASW A;  1NH4 A;  3HUS B;  4N3Y B;  1HWT C;  1PZQ A;  1FZG A;  1BCC E;  1YTZ T;  1PP9 J;  5AW6 B;  1ZR4 A;  1S2E A;  1M7L A;  3BRT B;  1RE3 C;  4DOJ A;  1VQN P;  3SFD C;  1BCC G;  1UIX A;  3RL0 C;  2OYH A;  2WWW A;  1LJ2 A;  3WUV A;  3G3Z A;  1ZV8 A;  1SQB J;  2JKV A;  3Q5S A;  4R4L A;  1ZME C;  2XV5 A;  1USD A;  1N8R Q;  1LTJ B;  3RBX A;  4C7R A;  2RN0 A;  3SWF A;  3R4Y A;  3H1K E;  2QJY C;  1URQ D;  2ZT9 B;  4PV1 D;  2KYV A;  2P67 A;  1KIL B;  2WSC H;  3L4F A;  2POH A;  3M9B A;  2K3R A;  5APY A;  2V7Q H;  1ZRT E;  1NU1 K;  1VF5 B;  3MTU E;  1ZN5 A;  3M9H A;  1PGQ A;  1BDD A;  1IFM A;  1SQX K;  2H88 C;  1J1E B;  5KLV J;  1VQM P;  2IBZ G;  2P1J A;  2KI7 B;  2IBZ I;  4JBZ A;  1ZP0 C;  3W67 A;  2OYH B;  1OVR A;  3CC2 P;  2OTL P;  4MN4 C;  2NZ2 A;  2IPP A;  4ZKU A;  2W6J H;  1Q7Y Q;  1T2K C;  2UWJ E;  1JY3 O;  3L73 G;  3B71 A;  1PV3 A;  1SQV E;  2D2C D;  1R5S A;  2K88 A;  1EQ7 A;  2L91 A;  2NPS B;  3D6Y A;  5CCH C;  2BCC E;  1T6A A;  2KLV A;  2M5A A;  5BU5 A;  3HTK B;  1P84 H;  2NRG A;  1VQO P;  1JTH B;  2KIK A;  1KB9 D;  1GL2 B;  1S5L E;  5BVZ A;  1S72 P;  1PP9 E;  2ZYG A;  2I1K A;  2FKW B;  4H13 B;  4YXD C;  1LTS C;  1QX8 A;  2KNC B;  1W2E A;  1PPJ E;  3VTP C;  3AEE C;  4YXW H;  2BCC D;  5KLV K;  1VQ7 P;  2OTK E;  3M0D C;  1Q81 Q;  5C39 A;  3KXD A;  2DW3 A;  2YXR B;  4WY4 D;  4L76 A;  4GDO A;  1FBM A;  3II6 A;  3CC4 P;  4UB8 H;  1JOC A;  2OYI C;  5AVX B;  2C0X A;  4GT1 A;  1RF1 A;  3GG2 A;  1VDF A;  2WPQ A;  2AXC A;  2YNY A;  3EFG A;  4PJ0 H;  4AQR D;  1EDI A;  3H1I D;  1JTH A;  1KQS O;  1YJ9 P;  2WVR A;  1RF1 C;  1J1D B;  1SQB K;  1M56 D;  1WRG A;  3H1J E;  3TNU A;  1SQP E;  1DH3 A;  3O8Z A;  1PFI A;  1DD3 A;  2P7J A;  3M9Q A;  2WZ7 A;  1N73 C;  1L0L J;  3BCC D;  1DEE G;  4D6T G;  4W80 A;  1SQQ K;  3AEA C;  1LT9 C;  3JC2 2;  4D6T J;  4YTP C;  1LWU A;  1OXZ A;  3L72 G;  1YHQ P;  1FZE A;  1X0T A;  2Q3E A;  1N2D C;  1BGY G;  1SQQ G;  3E7K A;  3SWK A;  4EOT A;  1FJP A;  1IZN B;  1L4A C;  1SFC C;  2E74 D;  3PP5 A;  3VOP A;  4BXL A;  3L75 D;  3TF5 A;  1YI2 P;  3CCS P;  4GOE A;  5CHX A;  1VQL P;  1SQV J;  3E1R A;  1URQ C;  4PV1 C;  2A45 I;  1SQB G;  1IFP A;  4JF7 A;  3RK3 E;  3TDK A;  3TNU B;  1VQ4 P;  3O6Q A;  5CCH D;  1FDO A;  1JY2 O;  4DCK A;  2BAS A;  3F89 A;  3AE3 C;  1BCC D;  3CCE P;  4TT3 H;  3V5B A;  1PL5 A;  1DD4 A;  2NPS A;  4K3A A;  1KN7 A;  1KB9 H;  1EZV G;  1KMI Z;  2LR2 A;  2ZYD A;  4RO0 A;  4UB6 H;  3V2R A;  4AYC A;  2PP6 A;  3Q3D A;  1SQB D;  1N7S B;  1FZB A;  1P84 D;  1ZW0 A;  2FYN B;  2QJK C;  3GF7 A;  3GW6 A;  5CCG C;  4LGD E;  1S9K D;  4PD4 H;  5GTI H;  3VMX A;  5KLV G;  1N7L A;  1KYO D;  2FYU E;  2N9B A;  1A02 F;  2ZVN B;  1VQ9 P;  2ZFC A;  4Y99 B;  2R3S A;  1KB9 I;  2YO3 A;  2ZYA A;  1HF9 A;  1K04 A;  3A0B E;  2HPC B;  1NTM G;  3AEF C;  2G3A A;  3L74 J;  2WT7 A;  2WTY A;  1NTM J;  4L74 A;  5KJ7 D;  2KS1 A;  2ZVO B;  1FOS F;  3WU2 H;  2JJL A;  3L75 J;  4JYC A;  2ZT9 C;  1RH5 B;  4WVZ A;  3Q1M A;  3MHV A;  2R44 A;  1JMM A;  3AEC C;  2JR8 A;  2YIU B;  1Y8A A;  1NKN A;  2FBW C;  2QRX A;  3AE4 C;  3PTZ A;  3AEB C;  4JYB A;  5APU A;  3FX0 A;  3MGN A;  3OAK A;  4RKU J;  3D71 A;  1H89 A;  1YTZ I;  1X9V A;  2YXQ B;  3HE5 A;  1GW4 A;  3GMA A;  2Z5H A;  4U3F J;  3L71 D;  1T3J A;  1AFO A;  1WMK A;  5APQ A;  2E76 C;  3AE8 C;  1JCC A;  5TJH A;  3H1L D;  3QWO C;  1HBW A;  3IF4 A;  1PGJ A;  1U7J A;  3H32 B;  1HGZ A;  2PGD A;  2HG5 D;  2YIU C;  3AE1 C;  1SFC D;  2E74 C;  5AW4 B;  5H2F H;  1BE3 D;  1URQ B;  2OGU A;  3ABV C;  3H1K J;  1KIL D;  4PJ0 E;  4PV1 B;  1GDT A;  1EDL A;  4NPE A;  3O6Q B;  1VF5 D;  1LTT C;  2E5T A;  2FXP A;  4U3F E;  1L4A B;  1QL1 A;  2VRS A;  3HE4 A;  1R8E A;  5GTI E;  3ZDM A;  1GU5 A;  1HH0 A;  3KQG A;  4IFM A;  3RGU A;  4OGQ B;  1VQP P;  4L73 A;  1D7M A;  2FYN C;  3QH9 A;  2FXM A;  3CWB G;  1KQF B;  1K9M Q;  1NHL A;  3D70 A;  1U7M A;  3MP7 B;  1KQG B;  5CCG D;  3CCV P;  4I7Z C;  1IK9 A;  1X8Y A;  4EIJ A;  1M8O B;  3OW2 O;  2O01 J;  3TGU E;  2B87 B;  1S5L X;  1DX7 A;  2QSI A;  2C9L Y;  1KYO H;  1MFZ A;  3JSV C;  3L74 E;  2K37 A;  1MZ9 A;  1NWQ A;  2NPS D;  2WSF H;  3P8M C;  2Y0E A;  1AVO A;  4XA4 A;  1W5C E;  5AW7 B;  1KFN A;  2A45 G;  3H25 A;  1GD2 E;  1JY3 P;  2E43 A;  1NTM K;  3KDP B;  3KYQ A;  2WT7 B;  1T8Z A;  1HUC A;  1NTK E;  1OW6 A;  1GL2 D;  2P2U A;  2R32 A;  3SFE C;  4ZNC A;  2OYI A;  1H0T B;  2B9B A;  3HD7 C;  4GKG A;  1BE3 J;  1MUU A;  3HTK A;  1EZV I;  4JQ0 D;  4OWF A;  4W7Y A;  4ZKP A;  4NPD A;  3NTN A;  4O9B A;  1JO5 A;  4KT0 J;  3P7K A;  1LNQ A;  5AW5 B;  1SQX G;  1NU1 J;  4IL6 H;  1JY3 N;  2QM8 A;  4RJT A;  3CC7 P;  1EZV D;  1NU1 G;  1NTK G;  3TGU D;  1K8A Q;  2I1J A;  4UB8 E;  1M90 Q;  2AEF A;  2XNX A;  1USE A;  3PLN A;  4H0L C;  1NVO A;  3L74 G;  2P10 A;  5KAI H;  2OYI B;  3CCL P;  1H0T A;  4GOF A;  3GHG B;  1EXJ A;  1LTB C;  2O1J A;  1RF1 B;  4U3F D;  5B66 E;  3L71 J;  1FS0 E;  1URQ A;  5AW0 B;  2WSE H;  3L73 D;  3LW5 J;  5KJ7 A;  2WPR A;  3CWB E;  4DJG A;  2XND H;  3VN0 A;  1OW7 A;  4R4M A;  1CW5 A;  1YIT P;  5E79 E;  1VF5 C;  4WBA A;  2J58 A;  3G6E P;  1ZOY C;  1NTZ E;  1J1E C;  2J5U A;  3H1J J;  3H1L E;  1L0L K;  1QGK B;  2E75 C;  1FU1 A;  3CL3 D;  4CPG A;  2KLU A;  2YKQ A;  5KAF E;  1OW8 A;  2I8D A;  1CSB A;  2E76 D;  2YKP A;  1LP1 A;  4WWI A;  1Z56 A;  3MZW B;  1GTW A;  1KC8 Q;  2JEE A;  1HJB A;  1MKM A;  2LXC B;  3RL0 B;  1S4X A;  2QJP C;  4Y28 J;  1KD1 Q;  1PP9 D;  3L37 A;  1K73 Q;  1FJK A;  2FXO A;  1LTA C;  2C9N Y;  1N7S D;  2CPB A;  2O3J A;  2N1T C;  1L0N K;  3A2A A;  3L70 D;  1N7S C;  2Y0C A;  4JPZ B;  3H1I G;  1QL2 A;  1KOR A;  4IOI H;  5AVT B;  2Q7C A;  1OWA A;  4ASV A;  1N7S A;  1L2P A;  2WIT A;  3CWB J;  2W6A A;  3USS A;  1DEB A;  3RK2 C;  1L0L D;  3BCC J;  3VMY A;  1A02 J;  1LP1 B;  5CCH A;  2K1A A;  1CZQ A;  3BCC G;  5APW A;  1T3U A;  1UII A;  4D6T D;  2XU6 A;  3TK1 A;  2QVA A;  1YJN P;  4Y99 C;  2R5D A;  1RE3 A;  2GA1 A;  1KQL A;  1M57 D;  5KJ7 C;  1XTC C;  2W8Z A;  2KXP B;  1P84 E;  2NPS C;  2Q3I A;  1CI6 B;  1S1C X;  1ZRT D;  1JMB A;  1NKZ B;  3SWY A;  3V4W A;  3BVH A;  3WUU A;  4HH2 A;  1OIP A;  3I5C A;  1RQV A;  3M0A A;  3L36 A;  4Z1M H;  1N73 B;  2FYU K;  5EFW B;  3RK3 D;  3HUS C;  4B86 A;  2YO2 A;  3C8V A;  4EYY Q;  1Q86 Q;  3IAO A;  3TSI A;  5BU8 B;  3NMD A;  3AE7 C;  1JB0 J;  5AVR B;  5GTH H;  4ZMD A;  1IO4 A;  3C1L A;  3CX5 E;  1Y47 A;  3U59 A;  5KAF H;  2FFD B;  1NTK J;  2Y9Y A;  1RE4 C;  1FZC A;  4GOD A;  1SQV K;  1NOH A;  1W2B O;  3VYI A;  1SFC B;  2JP3 A;  1KIL C;  1SQX D;  5AW9 B;  2YMK A;  2GM4 A;  3BCC E;  4UB6 E;  1NU1 D;  5TIS E;  3BAS A;  2RH0 A;  2KP8 A;  3T97 B;  3PHL A;  2KOG A;  3AED C;  2WSF J;  3OJA B;  1SQQ E;  1BGY E;  1L4A D;  2JDI H;  3B4S A;  3IFM A;  3MD0 A;  2M3B A;  1SQQ J;  4NPF X;  5M1B A;  4OGQ D;  2QJK B;  1AV1 A;  1ZLL A;  1G2C A;  3H1I E;  1NTZ K;  1WT6 A;  2KZJ A;  3PRJ A;  4W7Z A;  4D6T E;  1L4A A;  1JCD A;  3D6Z A;  1QEX A;  2ITA A;  1M1J B;  3CXH I;  2QE7 H;  4RES B;  2FFD A;  1L0N J;  1OFC X;  2QJP B;  1Q90 D;  1SQP G;  1JY2 N;  2H8P D;  3H1J G;  1VQK P;  1SQP J;  3P8C D;  4WB4 A;  3S9O A;  1YJW P;  1U57 A;  1GU4 A;  1IC2 A;  2QG4 A;  2R5B A;  1IFN A;  3MUD C;  4C7N A;  1SP4 A;  4H0L B;  4TLF A;  3L70 J;  2B87 A;  1AQT A;  1PPJ D;  1ZR2 A;  1YQ3 C;  2A45 H;  1RF0 C;  2YMY A;  3MUD A;  3T97 A;  1M1J C;  2IFN A;  2E75 D;  1EDJ A;  1S5L H;  2AEJ A;  3BAT A;  1RF0 A;  2H43 A;  2KB7 P;  2SPZ A;  3B5N C;  3K5B A;  5KKZ C;  1NTZ J;  1KFM A;  1JY2 P;  1YBK A;  2HLO A;  2WQY C;  3H1L G;  1NTZ G;  3WUT A;  1QLE D;  1HJ0 A;  1PPJ G;  1SLQ A;  2HYN A;  3AEG C;  3FGA D;  3V2P A;  2XKM A;  1SQV D;  4KHX A;  4H13 C;  1PP9 G;  3B5N D;  3H1I J;  3CX5 H;  3HD7 B;  3LW5 H;  4PD4 I;  2B89 A;  1NJI Q;  1KIL A;  3V6I A;  2IZ0 A;  1BCC J;  5APS A;  2D2C C;  3KHU A;  1MFT A;  2W83 C;  1SQV G;  2V7Q J;  4OVN F;  3M0D A;  3LID A;  4LC1 A;  4BRY B;  3L73 E;  3W68 A;  1BGY D;  1HVV A;  2P58 A;  3LIE A;  4N6J A;  3RK3 C;  1NO4 A;  1IFD A;  3MIW A;  1NU1 E;  3RL0 g;  3VMA A;  3P32 A;  1SQX E;  2IBZ E;  1JUN A;  1JM0 A;  1E79 H;  3FWN A;  1Q2N A;  3H1K D;  1G1J A;  1VQ8 P;  1OZH A;  3KZI E;  1AA0 A;  3CX5 D;  2QEX P;  1G2C B;  3Q5R A;  3ITK A;  5GTH E;  1VL2 A;  2Q1K A;  1GL2 A;  1TU3 F;  2R3C A;  3H1K G;  4BRY A;  1GZL A;  2E76 B;  1GL2 C;  1P84 I;  3VP8 A;  2Y9Z A;  4C7N B;  2JWD A;  3S1K A;  3RL0 D;  4DZO A;  4H44 D;  1KTM A;  2HFE D;  3CLQ A;  3CXH D;  1DIP A;  3TGU G;  1J2J B;  2H89 C;  3FXD A;  5KLI B;  1Y9B A;  1EXI A;  1LTG C;  2OYH C;  2N1T D;  4PD4 E;  2A06 D;  4IFD K;  2PRR A;  3G9R A;  2M8R A;  2WMM A;  3L74 D;  2IYP A;  1SVF A;  1LGH B;  2O01 N;  1BSH A;  3S4R A;  1L0L E;  3HE4 B;  4OGQ C;  2HOD A;  4U3F G;  2B88 A;  1PGP A;  4HJG H;  2Z5I A;  5B5E E;  1VQ6 P;  2A06 G;  2L5G B;  2O1K A;  3A0B H;  1KYO I;  3HD7 A;  4HYT B;  2CPS A;  4IFF A;  2PFX A;  5KLV D;  1EDK A;  1IFI A;  3HUS A;  3L35 A;  5AVS B;  3RK2 B;  3UIA A;  2OYO A;  3V4Q A;  3L70 E;  1OX3 A;  3G4S P;  3B8E B;  4K35 A;  1LT1 A;  2WPV B;  3CMA P;  1FZF A;  2OTJ P;  3CXH H;  1NTM D;  4XFJ A;  5L8R J;  4BWN A;  1YIJ P;  1PIX A;  1BE3 E;  1L0N E;  3GLM A;  1NGM B;  1E5W A;  1JNM A;  2XZR A;  1VPC A;  3CCQ P;  1FC2 C;  3H1L J;  1AQ5 A;  1VQ5 P;  3WMM 0;  3RK3 B;  1LWU C;  1BSN A;  5AW3 B;  2IFM A;  4XE5 B;  2WSE J;  5AVV B;  3L72 J;  2KZI A;  1N73 A;  1BGY J;  2LXB A;  1FDI A;  2Q6Q A;  3L71 E;  5AW1 B;  3CCJ P;  1H88 A;  1NTZ D;  2E42 A;  2KK7 A;  1AVY A;  2K9J A;  5K5G B;  1GK4 A;  1KV4 A;  5AVZ B;  3IN6 A;  1FAV A;  4DT0 A;  2Y0D A;  5AW2 B;  2RKL A;  2Q9I A;  3AE6 C;  2ZT9 D;  5H2F E;  1Q82 Q;  1IFJ A;  1NTM E;  3CWB D;  2G8Y A;  2FYZ A;  1R5L A;  3HRN A;  1NTK K;  2QIW A;  1OVV A;  5B66 H;  1LT9 B;  3CX5 I;  1MV8 A;  3JCU E;  4GIF A;  3JCU H;  2FYU G;  1YQ4 C;  5KLV E;  2FYU J;  2IDB A;  5CMZ A;  3CME P;  4N78 D;  1RHZ B;  3TYY A;  1XTG B;  1QVG O;  1YYC A;  1FOS E;  2Q5U A;  2K9J B;  2M5A B;  1GW3 A;  2KSJ A;  2WSC J;  3AE2 C;  4HKZ H;  1EZV E;  4H44 C;  4LLH A;  3V2Q A;  3I56 P;  1KYO E;  2FYU D;  2D2C B;  2KSE A;  2LKM A;  3NFQ A;  3FXE A;  2HOD B;  2N1T A;  1FZC C;  3L72 D;  4H0L D;  1S9K E;  3CCU P;  2HR3 A;  1LTI C;  4I6M C;  3SSU A;  1SS1 A;  1SQB E;  2V4H A;  3H1H E;  1LT9 A;  2E75 B;  3OA7 A;  3CXH E;  2KUB A;  2MJZ A;  2IZ1 A;  4OH8 B;  3L75 G;  1HGV A;  2W27 A; 
#chains in the Genus database with same CATH homology
 1NTZ J;  1BE3 J;  3BCC J;  3H1K J;  1EZV I;  1KYO I;  3H1J J;  3L73 J;  3L74 J;  3TGU J;  1NTM J;  3L75 J;  3CX5 I;  1SQV J;  1NU1 J;  1SQQ J;  4PD4 I;  5KLV J;  3H1I J;  3H1H J;  2BCC J;  1P84 I;  2IBZ I;  2FYU J;  1BCC J;  3CXH I;  1PP9 J;  1L0N J;  3H1L J;  1SQP J;  4U3F J;  3L72 J;  3L71 J;  1BGY J;  1SQB J;  3L70 J;  1L0L J;  1NTK J;  3CWB J;  4D6T J;  1SQX J;  1KB9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...