1BGYJ

Cytochrome bc1 complex from bovine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
b'VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
molecule tags Electron transport
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
total genus 18
structure length 62
sequence length 62
chains with identical sequence V
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1bgyJ00
1NTKJ 3L73J 3L74J 1NTZJ 1SQXJ 3CWBJ 3L70J 2IBZI 1NTMJ 1L0LJ 4PD4I 1L0NJ 3TGUJ 1NU1J 3BCCJ 1P84I 3H1IJ 1KYOI 3L71J 2FYUJ 4D6TJ 1SQBJ 3L75J 2BCCJ 1BE3J 3H1JJ 3CXHI 3H1KJ 1SQQJ 1SQVJ 3H1HJ 1KB9I 1SQPJ 3H1LJ 1EZVI 5KLVJ 1PP9J 1BGYJ 3CX5I 4U3FJ 1BCCJ 3L72J
chains in the Genus database with same CATH superfamily
2FBWC 3H6PA 1T3UA 1ZMEC 2O01H 2N1TA 2P67A 2WSCJ 4L73A 3MD0A 2YMYA 3EFFK 3V2NA 1ZR4A 1L0NJ 5AW0B 3TGUJ 1IFMA 1LTTC 3CC2P 2POHA 1FJPA 2M0BA 3VN0A 3H25A 1H0TA 3R2PA 4UB8E 2ZT9C 3CLQA 2GA1A 3KDPB 4DCKA 4WY4D 3WMM0 1SQBJ 3CL3D 1GW3A 1FBMA 4IOIH 5AW2B 5BU5A 3Q1MA 1LWUC 3BVHA 4BRYB 5APWA 2RN0A 2XDJA 4H0LC 4H0LD 3I5CA 1HTLC 3H1IE 1NGMB 1AVYA 1PGOA 1NTZG 1YYCA 3H1JD 1P84E 4ZNCA 5TISH 1NTZD 2ZT9D 1BCCJ 1ZR2A 2ZYDA 4PD4E 1K05A 3L74E 1LWUA 5CCHA 2ZYGA 1S5LH 2FYNB 3L72D 2J5UA 3U1CA 1JMMA 3PH0A 2AXTE 2Q6QA 1RE3C 1YQ4C 1FZCB 2WPSA 1PGJA 3MGNA 4M3LA 1IJDB 5AW8B 3HE4A 1QL2A 3VP8A 2E5YA 1RF1C 1KYOI 1NAFA 3IAOA 4NPEA 4JBZA 3L74D 1DEBA 2QM7A 2A06E 2NPSD 3AE3C 4D6TJ 4MN4C 2KB7P 1N2DC 3BASA 3BRTB 1BGYD 3G9RA 3L75J 3MP7B 5AVYB 4YTPC 2FXMA 4D6TE 2WSCH 1KQSO 2AXCA 3CC4P 1WT6A 5AW7B 2RMZA 3BCCG 5AW3B 2QEXP 2L5GB 3O6QA 1S5LE 2LR2A 1NKNA 1ZRTE 2M3BA 5E79E 2FYUD 2XV5A 1MFZA 2H88C 3RK3C 1BGYJ 4N78D 3M9BA 4QMAA 3VP9A 1YQ3C 1KB9D 3VMXA 5GTIH 1BE3D 2HR3A 3WUTA 5AVWB 3L36A 2N9BA 3G71P 1EZVG 1KV4A 5CBNA 3OA7A 1BSNA 3RGUA 1NTMG 3A5TA 1M1JC 2IBZE 1SQQK 1JTHB 4UB6E 2JEEA 1KQFB 3E1RA 4N78E 1QVGO 2MJZA 2H43A 5APTA 2XNXA 2KOGA 4EYYQ 2XU6A 2L91A 2G3AA 5KTBA 3HTKA 3SFEC 3A2AA 2QJPC 4DZOA 1KMIZ 3IR9A 1NTKK 3TYYA 1BE3J 1PGPA 3H1JJ 3AE7C 1G2CA 2QM8A 2CPBA 3P8MC 4C7RA 5BVZA 1KB9I 2FYNC 5AVTB 2K88A 3SFDC 1AV1A 1G2CB 4XFJA 4PD4H 5AVUB 4RO0A 5GTHE 1KC8Q 3TF5A 2NPSC 3OAKA 2M3EA 2I1KA 1KYOH 4PV1B 5CJ0A 1SQPG 1L0LD 3L72J 3D6ZA 1NU1G 1S4XA 4IFMA 3CCJP 2A45H 4C7NB 3CCSP 4ASVA 2OYIC 4B86A 1SQQE 3B5NB 4GOEA 3JCUE 3L73J 4WB4A 4AQRD 1X0TA 1YIJP 4Z1MH 4W7ZA 2YMKA 1HH0A 2W83C 3C9IA 3FGAD 1M7LA 1KYOD 1QEXA 3IFMA 3FXEA 3RBXA 1FS0E 1J2JB 1RF0A 2ZFCA 5EFWB 1SQVD 3SSUA 2CPSA 3NMDA 1U7JA 2KLVA 1IFJA 1SQBK 3C8VA 3QH9A 3H1KD 2KP8A 1IZNB 1XTCC 2W6BA 2OYHA 5E79H 2WT7B 4N3YB 5H2FH 1SQQJ 1SQVJ 3B5NC 1SVFA 3H1HJ 4HH2A 4OWFA 1OW7A 1MZ9A 1EDIA 1GD2E 2W6JH 3A0BE 1EZVI 1KZUB 1SQVE 2CK3H 4I2LC 2QA4P 4WY4C 5AW6B 3LW5H 3CI9A 3AE8C 2FKWB 3HUSC 4GKGA 1Q81Q 3OJAB 3AEFC 2GUVA 2FYZA 2XZRA 3H1JE 3VMAA 1N73A 1CZQA 1E79H 3G3ZA 1LTAC 2P1JA 2YNYA 1YBKA 2QJYC 2WPRA 1ZP0C 1VF5D 3RL0C 3FXDA 1VQKP 3FWNA 2E76D 2I1JA 3M0DC 3H1LE 2OYIA 1NU1E 1S5LX 2HLOA 1N86A 2QIWA 2Z5HA 5KLVD 2OYIB 1NTZK 1QL1A 3L72E 2KK7A 3H1LD 2KLUA 1S2EA 3SWFA 2H8PD 1GL2A 3I56P 1XTGB 1L4AA 2YO2A 3H32B 2ITAA 3JSVC 2O01J 4D6TD 4RJTA 1GU5A 1LTIC 2KSJA 4H44C 3HRNA 1IC2A 2LXCB 3Q5SA 1Q2NA 1Q90D 2A06G 2FYUG 3LW5J 4H44B 5KLIB 1FZFA 2IBZD 4OGQC 2H89C 1YTZT 2G8YA 1OXZA 3A7OA 3TNUA 3L71E 4AYCA 1X22A 1EC5A 4HJGH 1FZAA 3V2PA 3M06A 2BEQD 3L75E 1NTZJ 3V2QA 1M1JA 3AE1C 2N1TB 3L73D 3Q3DA 3WU2H 1W5CE 2C0XA 1M1JB 1UIIA 3P8CD 2N1TC 3RK3E 4H13C 1Q86Q 1PL5A 2XKMA 1CSBA 2QJKC 1NH4A 3H1IJ 2FYUK 2MKVA 2WSFJ 4PJ0H 4Y99B 3CD6P 1SFCD 1LTJB 1S3JA 3EWKA 3HUSA 4IFFA 4DT0A 3AECC 2Y0DA 4RKUJ 4YXDC 1RE4C 1TU3F 1H88A 3T97A 1EXJA 2QJYB 3RL0B 1NTME 1W2EA 1VQOP 1YJNP 3CXHI 3H1KJ 4L74A 2M5AB 1HGVA 1JY2N 2YKOA 4HKZH 1PP9E 5KAFH 1JMBA 1SQQD 3P7KA 5AVSB 4BXLA 1HF9A 3GLMA 4OH8B 3AE6C 1L4AD 2P2UA 3LIDA 4EI2A 1HVVA 2KI7B 2Q3IA 2QG4A 1VF5B 2YKQA 5TISE 3AEAC 2R3SA 3IN6A 1RE3A 2KUBA 4BRYA 1LTSC 1NJIQ 4HB1A 3V4WA 2RH0A 2IDBA 1A02J 2YXQB 1IFIA 1NTMJ 1NTKD 1L0LJ 1JY3P 1KORA 1SP4A 5B66E 1FDMA 2NRGA 1K9MQ 3MUDC 1NO4A 2BEZF 1OIPA 1SQBE 3HE4B 2Q9IA 3MIWA 3E1IA 1ZV8A 2WT7A 2ZT9B 1GTWA 2HG5D 1L0LK 1EQ7A 1M57D 1MUUA 2D2CD 3KHUA 3TNUB 1KILB 2LXBA 2NZ2A 1DH3A 1NTKE 2OTKE 3PTZA 3HD7D 2FFDB 1BCCD 1WMKA 1S72P 1JY2P 1LT9A 1OMIA 1NAYA 2IBZG 2K37A 3H1LJ 3KXDA 3LIEA 3AE9C 5CCGC 2QE7H 2E75D 2HFED 2WMMA 3CX5I 3CWBD 5L8RJ 4U3FJ 1VL2A 1P84H 2YIUC 3FWLA 3PLNA 4IL6X 1L2PA 2ZVOB 5B5EH 1Q82Q 1MFTA 3E7KA 2E74C 1SQVK 1X8YA 1DD3A 3IF4A 1N73B 1GMJA 1AQTA 1N73C 1S9KD 3TGUE 3F89A 5KLIC 1N7SD 3H1ID 4IL6E 3G6EP 1OWAA 3CX5H 5APYA 1DEEG 1FDIA 1KQLA 1MKMA 1P84D 2Y9YA 3AE4C 1YJ9P 1K73Q 1Y8AA 1U7MA 1NU1K 2E42A 2K9JB 2KXPB 3HE5A 3M0AA 1OW6A 3B8EB 5AVVB 1FOSE 2ZJSE 3D70A 2JWDA 1FZGA 1BDDA 2Z5IA 2PP6A 3HTKB 4KJMA 2Q5UA 3V4QA 3CX5D 3VMYA 1OFCX 3L70E 3L4FA 2K1AA 5KLVE 2P10A 1URQB 1R5SA 1QLED 1FJKA 3RK2D 1HJ0A 4N6JA 3U1AA 1FZCA 1VPCA 1JY3N 5KLVJ 3HD7A 1SQBG 2OYOA 4CPGA 1T2KD 4AUWA 2WVRA 1BGYE 4GODA 1GK6A 1LT1A 1YITP 1G1JA 2A06D 1NTKJ 5KLVK 2FFDC 1G1IA 1JB0J 2A45I 3N7NA 1HJBA 1RH5B 2KYVA 3K5BA 3D6YA 4KHXA 2M5AA 3BCCE 4WBAA 5APSA 1ZLLA 1SQVG 4PV1D 1KILD 2PRRA 3A0HH 2OARA 1N8RQ 1Q7YQ 2D2CB 1RF1A 3EQ2A 1IO4A 2PGDA 1SS1A 2YO3A 2XNDH 3PHLA 4XA4A 1E5WA 1LP1B 1OX3A 1U57A 2JP3A 1FZEA 1KB9E 1PP9D 1PV3A 1USEA 2V7QH 1KILE 2BCCJ 1T3JA 3L71G 2Y0EA 3TK1A 1EZVE 1OVUA 3WUVA 5CCHC 5AVRB 1LNQA 1IK7A 1M8OB 5CCHD 1OVRA 1RE4A 4U3FD 4TT3H 1CW5A 1JY3O 1NYHA 4U3FG 4LLHA 3NFQA 4GDOA 1DX7A 2O1JA 3V5BA 1CI6A 3O8ZA 1DD4A 3H1LG 1IK9A 3S4RA 5BU8B 3A0HE 2PFXA 3EFGA 1FE6A 3GW6A 3NTNA 4PV1C 4ZKUA 3I55P 2WSEJ 3CCLP 1SFCA 1FZBA 3L72G 5AW9B 3CXHE 1RY3A 4JPZB 1SQXJ 1PPJG 4EIJA 1SQXG 1VQLP 2AEFA 3GHGB 3KYQA 3RK3B 1VQNP 3H1KE 1QX8A 1R5LA 1N7LA 4XE5B 5APVA 1Y9BA 1LTBC 2W6AA 4O9BA 1W2BO 5KJ7C 4WWIA 1T2KC 2E75B 1NWQA 1X79B 2AEMA 2O1KA 1URQD 3PRJA 3RK2B 3PP5A 4I7ZB 2K3RA 2ZYAA 1GL2C 3H1HG 3RK2C 3O6QB 3V2RA 5KAIH 2B9BA 1YJWP 1RQVA 3SWKA 1NOHA 4IFDK 1VQ6P 3Q5PA 2B87B 4NPDA 2IZ0A 1J1DC 2IYOA 2R5DA 3AEGC 3SWYA 3GF3A 1KQGB 1CI6B 3USSA 2JDIH 2I8DA 3ITKA 4GIFA 1VQPP 1OW8A 2W27A 3P32A 1A02F 1N7SC 1QGKB 1AQ5A 1J1EB 3CMAP 3KPEA 3CWBJ 3L73G 1LTGC 2IBZI 3H32A 3Q5RA 1ZXGA 4PD4I 3H1IG 3GG2A 1M90Q 1JY2O 1NTZE 2ZXEB 1KB9H 1NU1J 2E74D 3BCCJ 5CJ4A 2OTJP 1KN7A 1P84I 2YXRB 4PD4D 2OYHB 2B89A 2E76B 2YKPA 3GF7A 4BWNA 1L0NK 1LWUB 2WPVB 2ZAEB 1D7MA 4JYBA 1KD1Q 5CCGD 3M9HA 1FC2C 3GHGC 3H1JG 4K3AA 3HD7C 3T97B 1HUCA 2BCCG 5KAIE 3S1KA 3AEBC 2BCCD 2OQQA 1GL2D 3II6A 2Q7CA 1LT9B 2IFNA 1URQC 4KT0J 2WSEH 1M56D 2RKLA 4C7NA 5KJ7D 2K9YA 1SQPK 1FAVA 1IFDA 1SQXD 2FXOA 1NU1D 4NPFX 3BCCD 2LKMA 2FFDA 1USDA 1JNMA 3VYIA 2GUSA 1ZRTD 2Z4EA 5CMZA 1NTKG 3TDKA 3MUDA 3B71A 2DW3A 5K5GB 4EDFA 1L4AB 4OVNF 2A45G 3CCVP 1LJ2A 1RHZB 2AEJA 1EZVD 1LP1A 1BGYG 1L4AC 1PIXA 2QVAA 2QSIA 1JO5A 2KSEA 5DJTB 1BE3E 2VRSA 2Y0CA 3C1LA 2R44A 2W8ZA 4R4MA 4W7YA 4IL6H 1HBWA 3L73E 2QJPB 1EDKA 1OVVA 1JTHA 1MV8A 3L71D 4RESB 3L75G 3TGUG 3AEDC 3W67A 5CCGA 1VDFA 1IFPA 3L75D 3D71A 1YHQP 3CWBG 1LGHB 1RF0C 2KS1B 3V6IA 3M0DA 1H8AA 1HWTC 1SFCC 1LT9C 1M1KQ 4A7PA 3MTUE 2WPQA 2HPCB 1KILC 2C0WA 4UB8H 2GM4A 1NTMD 2KZIA 2N9YB 2BASA 2C9LY 3AE5C 5TJHA 3GMAA 3CXHH 4WVZA 1URQA 3L70G 3L70J 1PPJD 5KJ7A 1VQ8P 5APUA 3HD7B 1H0TB 1L0LE 2KZJA 4OGQD 1LTJC 1OZHA 2WSFH 1NHLA 2B87A 2QJKB 3CCRP 4H44D 5DJUB 2WTYA 3L74G 2K9JA 3HE5B 4DOJA 5B66H 2OYHC 1BSHA 3CXHD 2R3CA 3A0BH 1GL2B 1QVFO 1PPJE 4I7ZC 4GOFA 5H2FE 2P7JA 2WZ7A 3H1KG 1SQPJ 1T8ZA 1VQ7P 1RF1B 1PP9J 1J1DB 5CBOA 3A3YB 3M9QA 1EDLA 2V4HA 1RQUA 4R4LA 2YIUB 2B88A 3TGUD 1GZLA 1BE3G 2E76C 5AVXB 3AEEC 3G4SP 5M1BA 2HPCA 1AVOA 1VF5C 3MHVA 4K35A 3RL0D 1GW4A 1N7SA 3L74J 3PJSK 4ASWA 1AA0A 3TSIA 2IYPA 3CMEP 3CWBE 1BCCE 1J1EC 1KTMA 4GT1A 2W90A 1LTJA 4HYTB 1S1CX 4L75A 4TLFA 2H7HA 3OW2O 1NVOA 1KYOE 2FYUJ 2PAJA 3L71J 1KILA 2E75C 4I1LA 4PJ0E 4YPCA 5AW1B 3CCUP 3CC7P 1GK4A 1S9KE 1AJYA 1EXIA 5GTHH 1JM0A 1JCCA 3B5ND 3NXSA 2HODB 2WITA 3ABVC 2IFMA 1SQXE 4H13B 3VOPA 2D2CC 2O3JA 3FX0A 3VTPC 3W68A 2FY8A 4JYCA 2NPSA 3MZWB 1L0NE 2WWWA 1ZN5A 3H1HD 4U7JA 2O01N 3RL0g 5KAFE 2R5BA 3UIAA 5C39A 1FOSF 2J59M 3CX5E 3L70D 4H0LB 5CHXA 2C9NY 1ZW0A 3QWOC 4OGQB 1L0ND 1SLQA 2IX7C 2BCCE 3H1HE 1T6AA 1K04A 5AVZB 1IFNA 3KZIH 4D6TG 1VQ5P 3KZIE 3BRVB 3JCUH 1PZQA 5KLVG 5APQA 2Y9ZA 5AW5B 1X9VA 2OGUA 2IZ1A 1KFMA 1SQPE 2FYUE 2V7QJ 5AW4B 5B5EE 4EOTA 1R8EA 1JOCA 1FU1A 4Y99C 3WU2E 2Q1KA 1SQPD 1YTZI 3HUSB 1SQXK 3CCMP 1K8AQ 1Y47A 2JR8A 3M91A 5AVQB 2HYNA 3WUUA 3L37A 4JF7A 2KIKA 3AE2C 3P8CE 1BCCG 2JO1A 1KFNA 4WY4B 2FXPA 1VQ9P 3CCQP 1FDOA 3ZDMA 1FZCC 2ZXXA 2KNCB 4W80A 4Y28J 3U59A 1AFOA 2NPSB 4YXWH 4ZMDA 2KNCA 4H13D 2N1TD 3Q2YA 2E5TA 4UB6H 1ZOYC 1NKZB 2HODA 2R32A 2J58A 3N4XA 1Z56A 1PP9G 2JJLA 2AXTH 4WY4A 1DIPA 1HGZA 3L35A 1JCDA 1BDCA 4U3FE 2E43A 2QRXA 1VQ4P 1H89A 1L0NG 2Q3EA 2ZVNB 1GDTA 3CCEP 2OTLP 3F5HA 4LC1A 5KKZB 2WSSH 3RK3D 3CPWO 3B5NA 4C46A 2UWJE 2WQYC 1SQQG 1JUNA 1GU4A 5APXA 3B4SA 1NTMK 3BATA 1VQMP 1UIXA 1N7SB 1EDJA 4L76A 4LGDE 2KS1A 1WRGA 1L0LG 1JEKA 1PGQA 3GHGA 3KQGA 4JQ0D 2JKVA 2P58A 3S9OA 1SQBD 2SPZA 3R4YA 4I6MC 3RBZA 2JWAA 3VMZA 4DJGA 1PFIA 2IPPA 2E74B 1YI2P 1SFCB 5GTIE 4ZKPA 3JC22 2M8RA 5KKZC
chains in the Genus database with same CATH topology
1NTKJ 3L73J 3L74J 1NTZJ 1SQXJ 3CWBJ 3L70J 2IBZI 1NTMJ 1L0LJ 4PD4I 1L0NJ 3TGUJ 1NU1J 3BCCJ 1P84I 3H1IJ 1KYOI 3L71J 2FYUJ 4D6TJ 1SQBJ 3L75J 2BCCJ 1BE3J 3H1JJ 3CXHI 3H1KJ 1SQQJ 1SQVJ 3H1HJ 1KB9I 1SQPJ 3H1LJ 1EZVI 5KLVJ 1PP9J 1BGYJ 3CX5I 4U3FJ 1BCCJ 3L72J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK J;  3L73 J;  3L74 J;  1NTZ J;  1SQX J;  3CWB J;  3L70 J;  2IBZ I;  1NTM J;  1L0L J;  4PD4 I;  1L0N J;  3TGU J;  1NU1 J;  3BCC J;  1P84 I;  3H1I J;  1KYO I;  3L71 J;  2FYU J;  4D6T J;  1SQB J;  3L75 J;  2BCC J;  1BE3 J;  3H1J J;  3CXH I;  3H1K J;  1SQQ J;  1SQV J;  3H1H J;  1KB9 I;  1SQP J;  3H1L J;  1EZV I;  5KLV J;  1PP9 J;  1BGY J;  3CX5 I;  4U3F J;  1BCC J;  3L72 J; 
#chains in the Genus database with same CATH topology
 2FBW C;  3H6P A;  1T3U A;  1ZME C;  2O01 H;  2N1T A;  2P67 A;  2WSC J;  4L73 A;  3MD0 A;  2YMY A;  3EFF K;  3V2N A;  1ZR4 A;  1L0N J;  5AW0 B;  3TGU J;  1IFM A;  1LTT C;  3CC2 P;  2POH A;  1FJP A;  2M0B A;  3VN0 A;  3H25 A;  1H0T A;  3R2P A;  4UB8 E;  2ZT9 C;  3CLQ A;  2GA1 A;  3KDP B;  4DCK A;  4WY4 D;  3WMM 0;  1SQB J;  3CL3 D;  1GW3 A;  1FBM A;  4IOI H;  5AW2 B;  5BU5 A;  3Q1M A;  1LWU C;  3BVH A;  4BRY B;  5APW A;  2RN0 A;  2XDJ A;  4H0L C;  4H0L D;  3I5C A;  1HTL C;  3H1I E;  1NGM B;  1AVY A;  1PGO A;  1NTZ G;  1YYC A;  3H1J D;  1P84 E;  4ZNC A;  5TIS H;  1NTZ D;  2ZT9 D;  1BCC J;  1ZR2 A;  2ZYD A;  4PD4 E;  1K05 A;  3L74 E;  1LWU A;  5CCH A;  2ZYG A;  1S5L H;  2FYN B;  3L72 D;  2J5U A;  3U1C A;  1JMM A;  3PH0 A;  2AXT E;  2Q6Q A;  1RE3 C;  1YQ4 C;  1FZC B;  2WPS A;  1PGJ A;  3MGN A;  4M3L A;  1IJD B;  5AW8 B;  3HE4 A;  1QL2 A;  3VP8 A;  2E5Y A;  1RF1 C;  1KYO I;  1NAF A;  3IAO A;  4NPE A;  4JBZ A;  3L74 D;  1DEB A;  2QM7 A;  2A06 E;  2NPS D;  3AE3 C;  4D6T J;  4MN4 C;  2KB7 P;  1N2D C;  3BAS A;  3BRT B;  1BGY D;  3G9R A;  3L75 J;  3MP7 B;  5AVY B;  4YTP C;  2FXM A;  4D6T E;  2WSC H;  1KQS O;  2AXC A;  3CC4 P;  1WT6 A;  5AW7 B;  2RMZ A;  3BCC G;  5AW3 B;  2QEX P;  2L5G B;  3O6Q A;  1S5L E;  2LR2 A;  1NKN A;  1ZRT E;  2M3B A;  5E79 E;  2FYU D;  2XV5 A;  1MFZ A;  2H88 C;  3RK3 C;  1BGY J;  4N78 D;  3M9B A;  4QMA A;  3VP9 A;  1YQ3 C;  1KB9 D;  3VMX A;  5GTI H;  1BE3 D;  2HR3 A;  3WUT A;  5AVW B;  3L36 A;  2N9B A;  3G71 P;  1EZV G;  1KV4 A;  5CBN A;  3OA7 A;  1BSN A;  3RGU A;  1NTM G;  3A5T A;  1M1J C;  2IBZ E;  1SQQ K;  1JTH B;  4UB6 E;  2JEE A;  1KQF B;  3E1R A;  4N78 E;  1QVG O;  2MJZ A;  2H43 A;  5APT A;  2XNX A;  2KOG A;  4EYY Q;  2XU6 A;  2L91 A;  2G3A A;  5KTB A;  3HTK A;  3SFE C;  3A2A A;  2QJP C;  4DZO A;  1KMI Z;  3IR9 A;  1NTK K;  3TYY A;  1BE3 J;  1PGP A;  3H1J J;  3AE7 C;  1G2C A;  2QM8 A;  2CPB A;  3P8M C;  4C7R A;  5BVZ A;  1KB9 I;  2FYN C;  5AVT B;  2K88 A;  3SFD C;  1AV1 A;  1G2C B;  4XFJ A;  4PD4 H;  5AVU B;  4RO0 A;  5GTH E;  1KC8 Q;  3TF5 A;  2NPS C;  3OAK A;  2M3E A;  2I1K A;  1KYO H;  4PV1 B;  5CJ0 A;  1SQP G;  1L0L D;  3L72 J;  3D6Z A;  1NU1 G;  1S4X A;  4IFM A;  3CCJ P;  2A45 H;  4C7N B;  3CCS P;  4ASV A;  2OYI C;  4B86 A;  1SQQ E;  3B5N B;  4GOE A;  3JCU E;  3L73 J;  4WB4 A;  4AQR D;  1X0T A;  1YIJ P;  4Z1M H;  4W7Z A;  2YMK A;  1HH0 A;  2W83 C;  3C9I A;  3FGA D;  1M7L A;  1KYO D;  1QEX A;  3IFM A;  3FXE A;  3RBX A;  1FS0 E;  1J2J B;  1RF0 A;  2ZFC A;  5EFW B;  1SQV D;  3SSU A;  2CPS A;  3NMD A;  1U7J A;  2KLV A;  1IFJ A;  1SQB K;  3C8V A;  3QH9 A;  3H1K D;  2KP8 A;  1IZN B;  1XTC C;  2W6B A;  2OYH A;  5E79 H;  2WT7 B;  4N3Y B;  5H2F H;  1SQQ J;  1SQV J;  3B5N C;  1SVF A;  3H1H J;  4HH2 A;  4OWF A;  1OW7 A;  1MZ9 A;  1EDI A;  1GD2 E;  2W6J H;  3A0B E;  1EZV I;  1KZU B;  1SQV E;  2CK3 H;  4I2L C;  2QA4 P;  4WY4 C;  5AW6 B;  3LW5 H;  3CI9 A;  3AE8 C;  2FKW B;  3HUS C;  4GKG A;  1Q81 Q;  3OJA B;  3AEF C;  2GUV A;  2FYZ A;  2XZR A;  3H1J E;  3VMA A;  1N73 A;  1CZQ A;  1E79 H;  3G3Z A;  1LTA C;  2P1J A;  2YNY A;  1YBK A;  2QJY C;  2WPR A;  1ZP0 C;  1VF5 D;  3RL0 C;  3FXD A;  1VQK P;  3FWN A;  2E76 D;  2I1J A;  3M0D C;  3H1L E;  2OYI A;  1NU1 E;  1S5L X;  2HLO A;  1N86 A;  2QIW A;  2Z5H A;  5KLV D;  2OYI B;  1NTZ K;  1QL1 A;  3L72 E;  2KK7 A;  3H1L D;  2KLU A;  1S2E A;  3SWF A;  2H8P D;  1GL2 A;  3I56 P;  1XTG B;  1L4A A;  2YO2 A;  3H32 B;  2ITA A;  3JSV C;  2O01 J;  4D6T D;  4RJT A;  1GU5 A;  1LTI C;  2KSJ A;  4H44 C;  3HRN A;  1IC2 A;  2LXC B;  3Q5S A;  1Q2N A;  1Q90 D;  2A06 G;  2FYU G;  3LW5 J;  4H44 B;  5KLI B;  1FZF A;  2IBZ D;  4OGQ C;  2H89 C;  1YTZ T;  2G8Y A;  1OXZ A;  3A7O A;  3TNU A;  3L71 E;  4AYC A;  1X22 A;  1EC5 A;  4HJG H;  1FZA A;  3V2P A;  3M06 A;  2BEQ D;  3L75 E;  1NTZ J;  3V2Q A;  1M1J A;  3AE1 C;  2N1T B;  3L73 D;  3Q3D A;  3WU2 H;  1W5C E;  2C0X A;  1M1J B;  1UII A;  3P8C D;  2N1T C;  3RK3 E;  4H13 C;  1Q86 Q;  1PL5 A;  2XKM A;  1CSB A;  2QJK C;  1NH4 A;  3H1I J;  2FYU K;  2MKV A;  2WSF J;  4PJ0 H;  4Y99 B;  3CD6 P;  1SFC D;  1LTJ B;  1S3J A;  3EWK A;  3HUS A;  4IFF A;  4DT0 A;  3AEC C;  2Y0D A;  4RKU J;  4YXD C;  1RE4 C;  1TU3 F;  1H88 A;  3T97 A;  1EXJ A;  2QJY B;  3RL0 B;  1NTM E;  1W2E A;  1VQO P;  1YJN P;  3CXH I;  3H1K J;  4L74 A;  2M5A B;  1HGV A;  1JY2 N;  2YKO A;  4HKZ H;  1PP9 E;  5KAF H;  1JMB A;  1SQQ D;  3P7K A;  5AVS B;  4BXL A;  1HF9 A;  3GLM A;  4OH8 B;  3AE6 C;  1L4A D;  2P2U A;  3LID A;  4EI2 A;  1HVV A;  2KI7 B;  2Q3I A;  2QG4 A;  1VF5 B;  2YKQ A;  5TIS E;  3AEA C;  2R3S A;  3IN6 A;  1RE3 A;  2KUB A;  4BRY A;  1LTS C;  1NJI Q;  4HB1 A;  3V4W A;  2RH0 A;  2IDB A;  1A02 J;  2YXQ B;  1IFI A;  1NTM J;  1NTK D;  1L0L J;  1JY3 P;  1KOR A;  1SP4 A;  5B66 E;  1FDM A;  2NRG A;  1K9M Q;  3MUD C;  1NO4 A;  2BEZ F;  1OIP A;  1SQB E;  3HE4 B;  2Q9I A;  3MIW A;  3E1I A;  1ZV8 A;  2WT7 A;  2ZT9 B;  1GTW A;  2HG5 D;  1L0L K;  1EQ7 A;  1M57 D;  1MUU A;  2D2C D;  3KHU A;  3TNU B;  1KIL B;  2LXB A;  2NZ2 A;  1DH3 A;  1NTK E;  2OTK E;  3PTZ A;  3HD7 D;  2FFD B;  1BCC D;  1WMK A;  1S72 P;  1JY2 P;  1LT9 A;  1OMI A;  1NAY A;  2IBZ G;  2K37 A;  3H1L J;  3KXD A;  3LIE A;  3AE9 C;  5CCG C;  2QE7 H;  2E75 D;  2HFE D;  2WMM A;  3CX5 I;  3CWB D;  5L8R J;  4U3F J;  1VL2 A;  1P84 H;  2YIU C;  3FWL A;  3PLN A;  4IL6 X;  1L2P A;  2ZVO B;  5B5E H;  1Q82 Q;  1MFT A;  3E7K A;  2E74 C;  1SQV K;  1X8Y A;  1DD3 A;  3IF4 A;  1N73 B;  1GMJ A;  1AQT A;  1N73 C;  1S9K D;  3TGU E;  3F89 A;  5KLI C;  1N7S D;  3H1I D;  4IL6 E;  3G6E P;  1OWA A;  3CX5 H;  5APY A;  1DEE G;  1FDI A;  1KQL A;  1MKM A;  1P84 D;  2Y9Y A;  3AE4 C;  1YJ9 P;  1K73 Q;  1Y8A A;  1U7M A;  1NU1 K;  2E42 A;  2K9J B;  2KXP B;  3HE5 A;  3M0A A;  1OW6 A;  3B8E B;  5AVV B;  1FOS E;  2ZJS E;  3D70 A;  2JWD A;  1FZG A;  1BDD A;  2Z5I A;  2PP6 A;  3HTK B;  4KJM A;  2Q5U A;  3V4Q A;  3CX5 D;  3VMY A;  1OFC X;  3L70 E;  3L4F A;  2K1A A;  5KLV E;  2P10 A;  1URQ B;  1R5S A;  1QLE D;  1FJK A;  3RK2 D;  1HJ0 A;  4N6J A;  3U1A A;  1FZC A;  1VPC A;  1JY3 N;  5KLV J;  3HD7 A;  1SQB G;  2OYO A;  4CPG A;  1T2K D;  4AUW A;  2WVR A;  1BGY E;  4GOD A;  1GK6 A;  1LT1 A;  1YIT P;  1G1J A;  2A06 D;  1NTK J;  5KLV K;  2FFD C;  1G1I A;  1JB0 J;  2A45 I;  3N7N A;  1HJB A;  1RH5 B;  2KYV A;  3K5B A;  3D6Y A;  4KHX A;  2M5A A;  3BCC E;  4WBA A;  5APS A;  1ZLL A;  1SQV G;  4PV1 D;  1KIL D;  2PRR A;  3A0H H;  2OAR A;  1N8R Q;  1Q7Y Q;  2D2C B;  1RF1 A;  3EQ2 A;  1IO4 A;  2PGD A;  1SS1 A;  2YO3 A;  2XND H;  3PHL A;  4XA4 A;  1E5W A;  1LP1 B;  1OX3 A;  1U57 A;  2JP3 A;  1FZE A;  1KB9 E;  1PP9 D;  1PV3 A;  1USE A;  2V7Q H;  1KIL E;  2BCC J;  1T3J A;  3L71 G;  2Y0E A;  3TK1 A;  1EZV E;  1OVU A;  3WUV A;  5CCH C;  5AVR B;  1LNQ A;  1IK7 A;  1M8O B;  5CCH D;  1OVR A;  1RE4 A;  4U3F D;  4TT3 H;  1CW5 A;  1JY3 O;  1NYH A;  4U3F G;  4LLH A;  3NFQ A;  4GDO A;  1DX7 A;  2O1J A;  3V5B A;  1CI6 A;  3O8Z A;  1DD4 A;  3H1L G;  1IK9 A;  3S4R A;  5BU8 B;  3A0H E;  2PFX A;  3EFG A;  1FE6 A;  3GW6 A;  3NTN A;  4PV1 C;  4ZKU A;  3I55 P;  2WSE J;  3CCL P;  1SFC A;  1FZB A;  3L72 G;  5AW9 B;  3CXH E;  1RY3 A;  4JPZ B;  1SQX J;  1PPJ G;  4EIJ A;  1SQX G;  1VQL P;  2AEF A;  3GHG B;  3KYQ A;  3RK3 B;  1VQN P;  3H1K E;  1QX8 A;  1R5L A;  1N7L A;  4XE5 B;  5APV A;  1Y9B A;  1LTB C;  2W6A A;  4O9B A;  1W2B O;  5KJ7 C;  4WWI A;  1T2K C;  2E75 B;  1NWQ A;  1X79 B;  2AEM A;  2O1K A;  1URQ D;  3PRJ A;  3RK2 B;  3PP5 A;  4I7Z B;  2K3R A;  2ZYA A;  1GL2 C;  3H1H G;  3RK2 C;  3O6Q B;  3V2R A;  5KAI H;  2B9B A;  1YJW P;  1RQV A;  3SWK A;  1NOH A;  4IFD K;  1VQ6 P;  3Q5P A;  2B87 B;  4NPD A;  2IZ0 A;  1J1D C;  2IYO A;  2R5D A;  3AEG C;  3SWY A;  3GF3 A;  1KQG B;  1CI6 B;  3USS A;  2JDI H;  2I8D A;  3ITK A;  4GIF A;  1VQP P;  1OW8 A;  2W27 A;  3P32 A;  1A02 F;  1N7S C;  1QGK B;  1AQ5 A;  1J1E B;  3CMA P;  3KPE A;  3CWB J;  3L73 G;  1LTG C;  2IBZ I;  3H32 A;  3Q5R A;  1ZXG A;  4PD4 I;  3H1I G;  3GG2 A;  1M90 Q;  1JY2 O;  1NTZ E;  2ZXE B;  1KB9 H;  1NU1 J;  2E74 D;  3BCC J;  5CJ4 A;  2OTJ P;  1KN7 A;  1P84 I;  2YXR B;  4PD4 D;  2OYH B;  2B89 A;  2E76 B;  2YKP A;  3GF7 A;  4BWN A;  1L0N K;  1LWU B;  2WPV B;  2ZAE B;  1D7M A;  4JYB A;  1KD1 Q;  5CCG D;  3M9H A;  1FC2 C;  3GHG C;  3H1J G;  4K3A A;  3HD7 C;  3T97 B;  1HUC A;  2BCC G;  5KAI E;  3S1K A;  3AEB C;  2BCC D;  2OQQ A;  1GL2 D;  3II6 A;  2Q7C A;  1LT9 B;  2IFN A;  1URQ C;  4KT0 J;  2WSE H;  1M56 D;  2RKL A;  4C7N A;  5KJ7 D;  2K9Y A;  1SQP K;  1FAV A;  1IFD A;  1SQX D;  2FXO A;  1NU1 D;  4NPF X;  3BCC D;  2LKM A;  2FFD A;  1USD A;  1JNM A;  3VYI A;  2GUS A;  1ZRT D;  2Z4E A;  5CMZ A;  1NTK G;  3TDK A;  3MUD A;  3B71 A;  2DW3 A;  5K5G B;  4EDF A;  1L4A B;  4OVN F;  2A45 G;  3CCV P;  1LJ2 A;  1RHZ B;  2AEJ A;  1EZV D;  1LP1 A;  1BGY G;  1L4A C;  1PIX A;  2QVA A;  2QSI A;  1JO5 A;  2KSE A;  5DJT B;  1BE3 E;  2VRS A;  2Y0C A;  3C1L A;  2R44 A;  2W8Z A;  4R4M A;  4W7Y A;  4IL6 H;  1HBW A;  3L73 E;  2QJP B;  1EDK A;  1OVV A;  1JTH A;  1MV8 A;  3L71 D;  4RES B;  3L75 G;  3TGU G;  3AED C;  3W67 A;  5CCG A;  1VDF A;  1IFP A;  3L75 D;  3D71 A;  1YHQ P;  3CWB G;  1LGH B;  1RF0 C;  2KS1 B;  3V6I A;  3M0D A;  1H8A A;  1HWT C;  1SFC C;  1LT9 C;  1M1K Q;  4A7P A;  3MTU E;  2WPQ A;  2HPC B;  1KIL C;  2C0W A;  4UB8 H;  2GM4 A;  1NTM D;  2KZI A;  2N9Y B;  2BAS A;  2C9L Y;  3AE5 C;  5TJH A;  3GMA A;  3CXH H;  4WVZ A;  1URQ A;  3L70 G;  3L70 J;  1PPJ D;  5KJ7 A;  1VQ8 P;  5APU A;  3HD7 B;  1H0T B;  1L0L E;  2KZJ A;  4OGQ D;  1LTJ C;  1OZH A;  2WSF H;  1NHL A;  2B87 A;  2QJK B;  3CCR P;  4H44 D;  5DJU B;  2WTY A;  3L74 G;  2K9J A;  3HE5 B;  4DOJ A;  5B66 H;  2OYH C;  1BSH A;  3CXH D;  2R3C A;  3A0B H;  1GL2 B;  1QVF O;  1PPJ E;  4I7Z C;  4GOF A;  5H2F E;  2P7J A;  2WZ7 A;  3H1K G;  1SQP J;  1T8Z A;  1VQ7 P;  1RF1 B;  1PP9 J;  1J1D B;  5CBO A;  3A3Y B;  3M9Q A;  1EDL A;  2V4H A;  1RQU A;  4R4L A;  2YIU B;  2B88 A;  3TGU D;  1GZL A;  1BE3 G;  2E76 C;  5AVX B;  3AEE C;  3G4S P;  5M1B A;  2HPC A;  1AVO A;  1VF5 C;  3MHV A;  4K35 A;  3RL0 D;  1GW4 A;  1N7S A;  3L74 J;  3PJS K;  4ASW A;  1AA0 A;  3TSI A;  2IYP A;  3CME P;  3CWB E;  1BCC E;  1J1E C;  1KTM A;  4GT1 A;  2W90 A;  1LTJ A;  4HYT B;  1S1C X;  4L75 A;  4TLF A;  2H7H A;  3OW2 O;  1NVO A;  1KYO E;  2FYU J;  2PAJ A;  3L71 J;  1KIL A;  2E75 C;  4I1L A;  4PJ0 E;  4YPC A;  5AW1 B;  3CCU P;  3CC7 P;  1GK4 A;  1S9K E;  1AJY A;  1EXI A;  5GTH H;  1JM0 A;  1JCC A;  3B5N D;  3NXS A;  2HOD B;  2WIT A;  3ABV C;  2IFM A;  1SQX E;  4H13 B;  3VOP A;  2D2C C;  2O3J A;  3FX0 A;  3VTP C;  3W68 A;  2FY8 A;  4JYC A;  2NPS A;  3MZW B;  1L0N E;  2WWW A;  1ZN5 A;  3H1H D;  4U7J A;  2O01 N;  3RL0 g;  5KAF E;  2R5B A;  3UIA A;  5C39 A;  1FOS F;  2J59 M;  3CX5 E;  3L70 D;  4H0L B;  5CHX A;  2C9N Y;  1ZW0 A;  3QWO C;  4OGQ B;  1L0N D;  1SLQ A;  2IX7 C;  2BCC E;  3H1H E;  1T6A A;  1K04 A;  5AVZ B;  1IFN A;  3KZI H;  4D6T G;  1VQ5 P;  3KZI E;  3BRV B;  3JCU H;  1PZQ A;  5KLV G;  5APQ A;  2Y9Z A;  5AW5 B;  1X9V A;  2OGU A;  2IZ1 A;  1KFM A;  1SQP E;  2FYU E;  2V7Q J;  5AW4 B;  5B5E E;  4EOT A;  1R8E A;  1JOC A;  1FU1 A;  4Y99 C;  3WU2 E;  2Q1K A;  1SQP D;  1YTZ I;  3HUS B;  1SQX K;  3CCM P;  1K8A Q;  1Y47 A;  2JR8 A;  3M91 A;  5AVQ B;  2HYN A;  3WUU A;  3L37 A;  4JF7 A;  2KIK A;  3AE2 C;  3P8C E;  1BCC G;  2JO1 A;  1KFN A;  4WY4 B;  2FXP A;  1VQ9 P;  3CCQ P;  1FDO A;  3ZDM A;  1FZC C;  2ZXX A;  2KNC B;  4W80 A;  4Y28 J;  3U59 A;  1AFO A;  2NPS B;  4YXW H;  4ZMD A;  2KNC A;  4H13 D;  2N1T D;  3Q2Y A;  2E5T A;  4UB6 H;  1ZOY C;  1NKZ B;  2HOD A;  2R32 A;  2J58 A;  3N4X A;  1Z56 A;  1PP9 G;  2JJL A;  2AXT H;  4WY4 A;  1DIP A;  1HGZ A;  3L35 A;  1JCD A;  1BDC A;  4U3F E;  2E43 A;  2QRX A;  1VQ4 P;  1H89 A;  1L0N G;  2Q3E A;  2ZVN B;  1GDT A;  3CCE P;  2OTL P;  3F5H A;  4LC1 A;  5KKZ B;  2WSS H;  3RK3 D;  3CPW O;  3B5N A;  4C46 A;  2UWJ E;  2WQY C;  1SQQ G;  1JUN A;  1GU4 A;  5APX A;  3B4S A;  1NTM K;  3BAT A;  1VQM P;  1UIX A;  1N7S B;  1EDJ A;  4L76 A;  4LGD E;  2KS1 A;  1WRG A;  1L0L G;  1JEK A;  1PGQ A;  3GHG A;  3KQG A;  4JQ0 D;  2JKV A;  2P58 A;  3S9O A;  1SQB D;  2SPZ A;  3R4Y A;  4I6M C;  3RBZ A;  2JWA A;  3VMZ A;  4DJG A;  1PFI A;  2IPP A;  2E74 B;  1YI2 P;  1SFC B;  5GTI E;  4ZKP A;  3JC2 2;  2M8R A;  5KKZ C; 
#chains in the Genus database with same CATH homology
 1NTK J;  3L73 J;  3L74 J;  1NTZ J;  1SQX J;  3CWB J;  3L70 J;  2IBZ I;  1NTM J;  1L0L J;  4PD4 I;  1L0N J;  3TGU J;  1NU1 J;  3BCC J;  1P84 I;  3H1I J;  1KYO I;  3L71 J;  2FYU J;  4D6T J;  1SQB J;  3L75 J;  2BCC J;  1BE3 J;  3H1J J;  3CXH I;  3H1K J;  1SQQ J;  1SQV J;  3H1H J;  1KB9 I;  1SQP J;  3H1L J;  1EZV I;  5KLV J;  1PP9 J;  1BGY J;  3CX5 I;  4U3F J;  1BCC J;  3L72 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...