1BGYJ

Cytochrome bc1 complex from bovine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 18
structure length 62
sequence length 62
chains with identical sequence V
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1bgyJ00
1SQQJ 1KB9I 3L75J 1PP9J 3H1LJ 3L72J 3L70J 2FYUJ 5KLVJ 1L0NJ 3CX5I 3TGUJ 1L0LJ 1BCCJ 1NU1J 3L74J 4PD4I 1NTMJ 3L73J 3H1HJ 4D6TJ 1NTZJ 1KYOI 1EZVI 1SQBJ 2IBZI 3CXHI 1NTKJ 1BGYJ 2BCCJ 3H1IJ 1SQXJ 3CWBJ 3L71J 1SQPJ 4U3FJ 1BE3J 1P84I 3H1JJ 3H1KJ 1SQVJ 3BCCJ
chains in the Genus database with same CATH superfamily
2QVAA 4ZKUA 1AJYA 1RE3C 2KOGA 2E74D 1NTKG 2NPSC 1R5LA 4NPFX 1M1JA 3KZIH 3RBZA 2N1TC 3CCQP 2FFDA 1EDIA 1L4AA 2WVRA 1G1JA 2R3CA 1LT9C 1M7LA 1FBMA 2E5YA 1N73C 2MJZA 3M06A 3L35A 4KT0J 1OXZA 5CCGD 5AW6B 2K9YA 1LTIC 3L36A 2QM8A 2XZRA 3PP5A 4H0LD 2QJKC 3L73G 1YJ9P 3AE2C 2K3RA 2O1KA 3B5NA 1JO5A 3L37A 1KFNA 1NTKE 3G71P 1Q7YQ 2BCCD 2I1JA 3SSUA 3LW5H 1SQXD 4OGQD 2MKVA 1NTMK 3JCUE 3CXHE 4UB6H 5AW2B 3V2RA 2WSCH 1FJPA 1ZRTD 1OX3A 1PIXA 2C0WA 2XU6A 3T97B 1ZR4A 2IBZG 2KP8A 1QEXA 3E1RA 1ZOYC 2E76B 2ZXEB 3B4SA 2IFNA 3L73E 3MHVA 1KMIZ 4XE5B 1U7MA 1SQVK 3H1IJ 1X9VA 3L70G 2OYOA 4PD4D 5DJUB 1Y8AA 3H1HG 3VMYA 2HG5D 3V2PA 4WB4A 1HBWA 3EWKA 2OTJP 1N7SB 5AW7B 2ZYAA 2BCCJ 2ZT9C 3R2PA 1HF9A 4W7YA 1SQXJ 4JPZB 1EDKA 1IFJA 2IZ0A 1W5CE 3L75J 1KV4A 2UWJE 3H32B 3P7KA 5C39A 3G3ZA 1CI6A 1L0NJ 2IBZE 4RKUJ 4C7NB 3Q3DA 2XV5A 1M1KQ 2GM4A 1NTMD 1FU1A 1VDFA 1J2JB 1SQQG 1FDIA 4PV1B 3WUUA 3M0AA 1FZCB 1JMBA 5KAFE 3VN0A 3L70E 3CCJP 5BVZA 3EFFK 1HGZA 1FOSE 1PL5A 2Z5HA 3CMAP 3M91A 3H32A 1IK7A 3H1HE 3SFEC 1NO4A 3MUDA 5GTIH 2W83C 2BASA 4C7NA 1VQLP 3LIEA 2K37A 3CC4P 5APTA 3VTPC 3CLQA 3HD7D 3ABVC 2A45I 1NTZJ 2WITA 5BU8B 1BCCD 1Q86Q 2G3AA 4H44B 1HUCA 3L71J 1J1DB 1URQD 2R5BA 3AE1C 1HTLC 1SQQE 5KJ7A 2Q3EA 3C1LA 3G4SP 4OVNF 1BSNA 3V2NA 1Q81Q 3PLNA 1GK4A 1VF5C 5APXA 1G2CA 1BE3G 2E42A 3H1JG 1J1EB 4R4MA 3RK3B 4WY4C 2QEXP 3L74G 3MD0A 3TGUJ 2Y0CA 1SS1A 1L4AD 1G1IA 1YI2P 1GU4A 2LKMA 3H1KG 1KB9D 1YITP 1OW8A 2Q7CA 1S2EA 5KLVD 3CI9A 1YIJP 1BCCJ 2K9JA 4PD4I 4WWIA 3W67A 4BRYB 1SQPK 4HH2A 4YTPC 2QM7A 3B5ND 2KUBA 2FYUK 2RH0A 2P1JA 1BE3E 1IFIA 3H1JE 4KHXA 3AEEC 1SFCA 1LWUA 5H2FE 2ZXXA 4EYYQ 2QE7H 1Q2NA 1L0LJ 2WPQA 5L8RJ 3PHLA 2OQQA 1GW3A 3NXSA 1JY2N 4IOIH 3Q2YA 1LP1B 4OGQB 3CMEP 2P58A 4IFFA 5APSA 1FZAA 5GTHE 1RF1B 3A0HE 3TSIA 1GW4A 2NZ2A 4N78E 2LXBA 4U3FJ 3JC22 1JOCA 5KLVJ 4CPGA 2G8YA 5AVZB 4U3FE 4RO0A 4O9BA 5KTBA 1RQUA 2E76C 2QIWA 3HUSB 1LP1A 1NU1D 4K3AA 1LJ2A 1FZFA 2AEMA 3WU2E 5AW9B 5AW0B 3BVHA 2GA1A 2GUVA 5CCHC 1YHQP 1LTAC 2H88C 2ITAA 1N7SC 3FXEA 1Q90D 2XKMA 2JP3A 1ZR2A 3OJAB 1GDTA 2R44A 1KILE 3O6QB 5AW1B 3V4QA 1GZLA 2OYIB 1BSHA 2JDIH 1M57D 4JYBA 5AVRB 4M3LA 5B5EH 1RH5B 3FGAD 3BATA 2AEJA 1KB9I 2OTLP 3GF7A 5K5GB 3CCSP 1OW7A 1T3JA 5KKZC 1H0TB 2W6JH 2R32A 1T2KD 2YIUB 1Q82Q 1OW6A 3VOPA 4PV1D 5B66H 1LTBC 3I5CA 1K73Q 1VQ4P 3D6ZA 2IPPA 3TYYA 1SQBG 1GL2C 5KJ7D 1N8RQ 1VQ8P 3BCCG 3CCUP 2QG4A 2Q3IA 1H0TA 2R5DA 1AA0A 3CC7P 3SWFA 1TU3F 1JMMA 3M0DC 1X0TA 3CCMP 1OVRA 4H44D 4L73A 3RK2C 2QJPB 3E1IA 3RK3C 4IL6E 1RF0C 3CX5E 4EDFA 1X79B 2V7QJ 3QWOC 1OVVA 5KLIB 1M1JB 2AEFA 3PH0A 5AW4B 5TISE 2E74C 2Q6QA 4C7RA 1SQBJ 1L4AB 1SQXK 1MKMA 1SQBE 3BCCJ 3Q5SA 1EDLA 3P8MC 4YXWH 3NMDA 1L0NK 3BCCE 4N3YB 3GHGA 3GG2A 3CXHD 3B71A 1IFMA 3KXDA 3TDKA 3U1CA 1QL1A 2P10A 2QA4P 3I55P 3BRTB 1LTTC 3KZIE 1FC2C 1HJ0A 5AVYB 5CCGC 2OARA 3HE5B 4W7ZA 3B5NB 2YXQB 4H0LC 2N9BA 1VQ5P 1X22A 2WZ7A 3IFMA 4Z1MH 3CWBG 2I8DA 1OMIA 2XNDH 1PGOA 3H1ID 2FXPA 4OGQC 2WSFJ 1NTZK 3VMXA 3D70A 4GKGA 1RF1C 3FWNA 3HE5A 2M3BA 1NTKJ 2PGDA 2E75B 2M0BA 1PFIA 3N4XA 3L75D 4UB6E 2Y9ZA 2IBZD 2AXCA 3HUSC 1KILA 1OVUA 3E7KA 1L0ND 1S9KE 4UB8H 2PRRA 1RE4C 1KTMA 5APVA 1JTHA 2V4HA 1FE6A 3CWBJ 2YO2A 2WT7B 2ZFCA 1EDJA 2IZ1A 3OAKA 3KDPB 3CWBE 1K8AQ 1KYOD 4D6TG 1EZVD 1AFOA 3L73J 3FXDA 1VL2A 2IYOA 1SP4A 3H1HD 1OWAA 1CI6B 2W90A 4EIJA 3HE4B 3TK1A 4OWFA 2O01H 3VMZA 2OYIC 2KS1B 4QMAA 1EXJA 2ZJSE 1S1CX 3CCVP 3V5BA 1T6AA 1ZN5A 2WT7A 3A3YB 2HYNA 1ZMEC 1NTZD 4C46A 5DJTB 3H1LG 4N6JA 1WMKA 3CCLP 3L71D 1A02J 4NPEA 1L0LK 1QX8A 1SQQD 2A45H 3HE4A 4D6TJ 2FBWC 1FZEA 2KS1A 2YIUC 2P2UA 1KQFB 4D6TE 1CW5A 3S9OA 1QVFO 4HKZH 3CC2P 2CK3H 4R4LA 2OYHA 1L2PA 2J5UA 1LTJA 1QVGO 3AE5C 3I56P 3A7OA 3L70J 3M9QA 2FXOA 1ZV8A 1W2BO 3H1HJ 3AECC 3HD7C 4NPDA 1MFTA 1PGPA 3TGUD 5CCHA 1JNMA 5AVSB 5KLVK 1HJBA 5GTIE 2XNXA 2QJYC 1URQC 3EQ2A 1D7MA 3QH9A 4TLFA 1NTMG 1G2CB 3MGNA 3H1LE 1A02F 1N86A 3O8ZA 4DCKA 1AQTA 2IFMA 3CCEP 2QJPC 1SQQJ 3GMAA 4AQRD 4PD4H 1VQNP 1IC2A 3TF5A 1M1JC 1VQKP 1FOSF 2FFDC 3Q1MA 1L4AC 1L0LD 2IBZI 4DZOA 1SQVG 1NYHA 2AXTH 1NKZB 3K5BA 4A7PA 2IYPA 2K9JB 4IL6X 3RL0B 5E79H 1RQVA 3VYIA 3F5HA 2KZJA 1YQ4C 3UIAA 1KYOI 4K35A 1NTME 1EZVI 4N78D 1KQSO 1SFCB 2YXRB 1LWUB 1IK9A 1NAYA 5CHXA 2PP6A 3B5NC 4Y99B 2RMZA 4U3FD 1NU1K 1IZNB 1FZGA 2A06G 1NKNA 1ZXGA 4DOJA 1HGVA 1BE3J 3H1JJ 1H89A 2HFED 4L74A 1QL2A 2XDJA 1SQVE 1T8ZA 3L74J 1PZQA 3RGUA 4DJGA 3A0BH 1P84D 3L74E 1FS0E 3H1KJ 1KILD 2N1TB 1KC8Q 2CPSA 3H1KE 2POHA 1OZHA 2KIKA 5KAIH 1DD3A 1LT9B 5CJ4A 1N73B 2E75D 1RE3A 1WT6A 2A06E 1PP9G 3G9RA 3SWKA 3U59A 2NPSA 1AVYA 4I6MC 2QJKB 2N1TA 2P7JA 2KSEA 1KB9E 1LNQA 1KB9H 3TNUA 1UIXA 4TT3H 4JYCA 1LT9A 3M9HA 1N73A 2YKQA 2ZYGA 4I2LC 2YNYA 2QSIA 3KPEA 1KFMA 1MV8A 4HYTB 3A5TA 3V6IA 3WUTA 3AE6C 3AEDC 1EC5A 2K88A 3S1KA 3IAOA 1YTZT 1PP9E 1JY2P 3MUDC 3AE3C 5B5EE 1P84H 3VP9A 2YMKA 1T2KC 1SQPG 2Q1KA 2W6BA 3MTUE 2Y0EA 1WRGA 4PV1C 2WSSH 3CX5D 2FYUG 1USDA 2Z5IA 2YMYA 1FZCC 5AVQB 4IFMA 2M8RA 2O1JA 2JEEA 4GIFA 1BGYG 1CSBA 3ITKA 3AEFC 5KJ7C 2RN0A 1SQBD 5B66E 3AEAC 2O3JA 1PPJG 1GU5A 3BCCD 4I7ZB 2KB7P 2JWDA 4YXDC 3KHUA 2JO1A 4H13D 3NTNA 2WPVB 4BXLA 2Z4EA 4H44C 4LLHA 2B88A 1SQPJ 1P84I 3L72G 1FDOA 1J1DC 5CMZA 3HRNA 1SQPE 1PGQA 2FYUE 1AVOA 4EI2A 2KYVA 2WSEJ 3IN6A 2HODB 2KSJA 3GHGB 1BGYE 1J1EC 3BRVB 3B8EB 2Q5UA 4RJTA 1XTGB 4L75A 1GTWA 1PPJE 1KN7A 3AEGC 1LWUC 3RL0D 3Q5PA 4B86A 1NTKD 1ZLLA 1K04A 1S3JA 4Y99C 4GDOA 4HB1A 1JCDA 2HODA 1N2DC 1S72P 3L72E 2V7QH 1N7LA 1VF5B 1SFCD 1S9KD 3GF3A 4EOTA 3KQGA 2L91A 3PJSK 4WY4B 1RHZB 2OGUA 3CWBD 1SLQA 2H89C 1AV1A 3GW6A 2KLUA 3H25A 1KQLA 4Y28J 1JY3N 3P8CE 2D2CD 2W8ZA 2KNCB 3L73D 1FDMA 2C9LY 2KLVA 3WMM0 2W27A 1KILB 1KZUB 3CPWO 2R3SA 3CX5I 2H7HA 2H8PD 1JTHB 1ZP0C 2NPSD 1YTZI 4WY4A 3L4FA 1NOHA 2JKVA 3LW5J 1SQQK 2N1TD 2LR2A 3AEBC 2SPZA 4AYCA 2KNCA 3N7NA 3CD6P 1JY2O 1DIPA 2B87B 2WSCJ 2WPSA 3Q5RA 2WSFH 4UB8E 3H1IG 4D6TD 3RK3E 2A45G 1PGJA 3D71A 1R5SA 1BDCA 2GUSA 4AUWA 3JCUH 3CXHH 1DEBA 3L70D 5AW5B 2KI7B 2WPRA 1YJNP 2BCCG 3SFDC 3PTZA 2KXPB 1SQXG 2WWWA 2O01J 2B87A 1JY3P 1NH4A 3L75G 2C0XA 2I1KA 1L0NG 1LTGC 1U7JA 2VRSA 2K1AA 3H1LD 4WBAA 2OYHB 4ASVA 1QLED 3MP7B 1UIIA 1LTJB 2HLOA 1NVOA 1HVVA 1MUUA 1EZVG 5APWA 1IFDA 3H1IE 1K05A 1K9MQ 3T97A 3H6PA 3CXHI 2RKLA 3PRJA 1H88A 3HTKB 1YBKA 1M56D 2BCCE 1S5LE 1SQXE 1FAVA 1NWQA 2E43A 2O01N 1S5LH 3W68A 3L75E 4I7ZC 5AW8B 1NTZG 2IDBA 3AE9C 3P32A 1L0NE 4RESB 1BDDA 2ZT9D 1ZRTE 3L71G 2FXMA 4H13B 3USSA 1N7SA 3H1LJ 1GK6A 2E5TA 2B9BA 1KYOE 3WUVA 3HTKA 3KYQA 1HWTC 1IO4A 1EZVE 1KYOH 1PV3A 5KAFH 3V4WA 5KKZB 4JQ0D 1LTSC 5CBNA 2CPBA 1EXIA 3F89A 1HH0A 2BEQD 3GHGC 1XTCC 1NJIQ 1MZ9A 4PD4E 3TGUG 1SQVD 1MFZA 1BE3D 3H1JD 3II6A 1JEKA 5KLIC 3GLMA 2N9YB 1CZQA 1GL2B 1FZCA 3L74D 1NTZE 2AXTE 4ZNCA 1JUNA 5APUA 4XFJA 3L71E 2HPCB 5E79E 1BCCG 3H1KD 4I1LA 1DEEG 4W80A 2J58A 3RL0g 3IR9A 2FY8A 1M8OB 1NTMJ 3G6EP 1VQMP 1FZBA 1OIPA 4YPCA 2C9NY 3S4RA 2WQYC 3RK2B 2A06D 2NRGA 3R4YA 1E79H 1GL2A 4LC1A 1L0LG 1M90Q 1GMJA 2WTYA 1GD2E 5AVVB 1VF5D 2LXCB 3TGUE 2E74B 2HPCA 2FYNB 2D2CB 3AE7C 3M0DA 4WY4D 4OH8B 1SQVJ 3V2QA 4MN4C 1KILC 3C9IA 2J59M 1VQ6P 1KORA 3FWLA 5AVTB 1RF0A 2Q9IA 3NFQA 1BCCE 2NPSB 3A0BE 2FKWB 1JY3O 2FYZA 5BU5A 3CCRP 4U3FG 2E75C 5KLVG 3M9BA 1VQ9P 3LIDA 4ZKPA 2QRXA 5H2FH 4H0LB 1PP9D 5KAIE 2ZYDA 3TNUB 1JM0A 1EQ7A 1L0LE 3BASA 2YKPA 1IFPA 3A2AA 1QGKB 1AQ5A 5AVXB 1Y9BA 4BRYA 3RBXA 1FJKA 1S4XA 3OW2O 1R8EA 5CCGA 5GTHH 1SQBK 4HJGH 3A0HH 4ASWA 2KK7A 1IJDB 3CL3D 2B89A 2ZVNB 4GOEA 1LGHB 4ZMDA 5KLVE 2OYHC 4L76A 1VQPP 1LTJC 4JF7A 5EFWB 1X8YA 1U57A 1RF1A 3AE4C 1USEA 1PP9J 3WU2H 2DW3A 2JWAA 3JSVC 1SQPD 1YJWP 1NU1G 5CBOA 2E76D 2FYUD 1P84E 3VP8A 3ZDMA 2HR3A 5AW3B 2KZIA 3HUSA 4U7JA 1BGYD 5TJHA 1H8AA 2M3EA 1RE4A 5APQA 5CCHD 2OTKE 1IFNA 1KQGB 1DD4A 2ZAEB 1LT1A 1YQ3C 2YO3A 1N7SD 1PPJD 1NTKK 1ZW0A 3FX0A 2ZT9B 1VQOP 4H13C 5CJ0A 1S5LX 1NAFA 3EFGA 3O6QA 3L72D 1NU1J 2JR8A 2OYIA 3U1AA 1NU1E 2M5AB 1JB0J 2IX7C 2WMMA 3AE8C 1T3UA 3MZWB 1YYCA 1DX7A 4IFDK 2L5GB 3MIWA 2FYUJ 1E5WA 1KD1Q 4LGDE 4PJ0E 1VQ7P 3HD7B 4PJ0H 3D6YA 3P8CD 1BGYJ 1OFCX 2Y0DA 4GT1A 4GOFA 2PAJA 3RL0C 1SVFA 2QJYB 2ZVOB 1URQB 1VPCA 2BEZF 2M5AA 2PFXA 3IF4A 5M1BA 3VMAA 3SWYA 2H43A 1NHLA 5APYA 4GODA 4XA4A 1W2EA 1GL2D 4JBZA 1Y47A 2JJLA 1JCCA 3C8VA 1Z56A 1SFCC 1NGMB 3OA7A 2P67A 3HD7A 2WSEH 2Y9YA 4IL6H 3CX5H 4BWNA 3L72J 2YKOA 5AVWB 4WVZA 5AVUB 1RY3A 1URQA 2FFDB 2FYNC 5TISH 3RK2D 2W6AA 2D2CC 4DT0A 1DH3A 4KJMA 3RK3D
chains in the Genus database with same CATH topology
1SQQJ 1KB9I 3L75J 1PP9J 3H1LJ 3L72J 3L70J 2FYUJ 5KLVJ 1L0NJ 3CX5I 3TGUJ 1L0LJ 1BCCJ 1NU1J 3L74J 4PD4I 1NTMJ 3L73J 3H1HJ 4D6TJ 1NTZJ 1KYOI 1EZVI 1SQBJ 2IBZI 3CXHI 1NTKJ 1BGYJ 2BCCJ 3H1IJ 1SQXJ 3CWBJ 3L71J 1SQPJ 4U3FJ 1BE3J 1P84I 3H1JJ 3H1KJ 1SQVJ 3BCCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ J;  1KB9 I;  3L75 J;  1PP9 J;  3H1L J;  3L72 J;  3L70 J;  2FYU J;  5KLV J;  1L0N J;  3CX5 I;  3TGU J;  1L0L J;  1BCC J;  1NU1 J;  3L74 J;  4PD4 I;  1NTM J;  3L73 J;  3H1H J;  4D6T J;  1NTZ J;  1KYO I;  1EZV I;  1SQB J;  2IBZ I;  3CXH I;  1NTK J;  1BGY J;  2BCC J;  3H1I J;  1SQX J;  3CWB J;  3L71 J;  1SQP J;  4U3F J;  1BE3 J;  1P84 I;  3H1J J;  3H1K J;  1SQV J;  3BCC J; 
#chains in the Genus database with same CATH topology
 2QVA A;  4ZKU A;  1AJY A;  1RE3 C;  2KOG A;  2E74 D;  1NTK G;  2NPS C;  1R5L A;  4NPF X;  1M1J A;  3KZI H;  3RBZ A;  2N1T C;  3CCQ P;  2FFD A;  1EDI A;  1L4A A;  2WVR A;  1G1J A;  2R3C A;  1LT9 C;  1M7L A;  1FBM A;  2E5Y A;  1N73 C;  2MJZ A;  3M06 A;  3L35 A;  4KT0 J;  1OXZ A;  5CCG D;  5AW6 B;  2K9Y A;  1LTI C;  3L36 A;  2QM8 A;  2XZR A;  3PP5 A;  4H0L D;  2QJK C;  3L73 G;  1YJ9 P;  3AE2 C;  2K3R A;  2O1K A;  3B5N A;  1JO5 A;  3L37 A;  1KFN A;  1NTK E;  3G71 P;  1Q7Y Q;  2BCC D;  2I1J A;  3SSU A;  3LW5 H;  1SQX D;  4OGQ D;  2MKV A;  1NTM K;  3JCU E;  3CXH E;  4UB6 H;  5AW2 B;  3V2R A;  2WSC H;  1FJP A;  1ZRT D;  1OX3 A;  1PIX A;  2C0W A;  2XU6 A;  3T97 B;  1ZR4 A;  2IBZ G;  2KP8 A;  1QEX A;  3E1R A;  1ZOY C;  2E76 B;  2ZXE B;  3B4S A;  2IFN A;  3L73 E;  3MHV A;  1KMI Z;  4XE5 B;  1U7M A;  1SQV K;  3H1I J;  1X9V A;  3L70 G;  2OYO A;  4PD4 D;  5DJU B;  1Y8A A;  3H1H G;  3VMY A;  2HG5 D;  3V2P A;  4WB4 A;  1HBW A;  3EWK A;  2OTJ P;  1N7S B;  5AW7 B;  2ZYA A;  2BCC J;  2ZT9 C;  3R2P A;  1HF9 A;  4W7Y A;  1SQX J;  4JPZ B;  1EDK A;  1IFJ A;  2IZ0 A;  1W5C E;  3L75 J;  1KV4 A;  2UWJ E;  3H32 B;  3P7K A;  5C39 A;  3G3Z A;  1CI6 A;  1L0N J;  2IBZ E;  4RKU J;  4C7N B;  3Q3D A;  2XV5 A;  1M1K Q;  2GM4 A;  1NTM D;  1FU1 A;  1VDF A;  1J2J B;  1SQQ G;  1FDI A;  4PV1 B;  3WUU A;  3M0A A;  1FZC B;  1JMB A;  5KAF E;  3VN0 A;  3L70 E;  3CCJ P;  5BVZ A;  3EFF K;  1HGZ A;  1FOS E;  1PL5 A;  2Z5H A;  3CMA P;  3M91 A;  3H32 A;  1IK7 A;  3H1H E;  3SFE C;  1NO4 A;  3MUD A;  5GTI H;  2W83 C;  2BAS A;  4C7N A;  1VQL P;  3LIE A;  2K37 A;  3CC4 P;  5APT A;  3VTP C;  3CLQ A;  3HD7 D;  3ABV C;  2A45 I;  1NTZ J;  2WIT A;  5BU8 B;  1BCC D;  1Q86 Q;  2G3A A;  4H44 B;  1HUC A;  3L71 J;  1J1D B;  1URQ D;  2R5B A;  3AE1 C;  1HTL C;  1SQQ E;  5KJ7 A;  2Q3E A;  3C1L A;  3G4S P;  4OVN F;  1BSN A;  3V2N A;  1Q81 Q;  3PLN A;  1GK4 A;  1VF5 C;  5APX A;  1G2C A;  1BE3 G;  2E42 A;  3H1J G;  1J1E B;  4R4M A;  3RK3 B;  4WY4 C;  2QEX P;  3L74 G;  3MD0 A;  3TGU J;  2Y0C A;  1SS1 A;  1L4A D;  1G1I A;  1YI2 P;  1GU4 A;  2LKM A;  3H1K G;  1KB9 D;  1YIT P;  1OW8 A;  2Q7C A;  1S2E A;  5KLV D;  3CI9 A;  1YIJ P;  1BCC J;  2K9J A;  4PD4 I;  4WWI A;  3W67 A;  4BRY B;  1SQP K;  4HH2 A;  4YTP C;  2QM7 A;  3B5N D;  2KUB A;  2FYU K;  2RH0 A;  2P1J A;  1BE3 E;  1IFI A;  3H1J E;  4KHX A;  3AEE C;  1SFC A;  1LWU A;  5H2F E;  2ZXX A;  4EYY Q;  2QE7 H;  1Q2N A;  1L0L J;  2WPQ A;  5L8R J;  3PHL A;  2OQQ A;  1GW3 A;  3NXS A;  1JY2 N;  4IOI H;  3Q2Y A;  1LP1 B;  4OGQ B;  3CME P;  2P58 A;  4IFF A;  5APS A;  1FZA A;  5GTH E;  1RF1 B;  3A0H E;  3TSI A;  1GW4 A;  2NZ2 A;  4N78 E;  2LXB A;  4U3F J;  3JC2 2;  1JOC A;  5KLV J;  4CPG A;  2G8Y A;  5AVZ B;  4U3F E;  4RO0 A;  4O9B A;  5KTB A;  1RQU A;  2E76 C;  2QIW A;  3HUS B;  1LP1 A;  1NU1 D;  4K3A A;  1LJ2 A;  1FZF A;  2AEM A;  3WU2 E;  5AW9 B;  5AW0 B;  3BVH A;  2GA1 A;  2GUV A;  5CCH C;  1YHQ P;  1LTA C;  2H88 C;  2ITA A;  1N7S C;  3FXE A;  1Q90 D;  2XKM A;  2JP3 A;  1ZR2 A;  3OJA B;  1GDT A;  2R44 A;  1KIL E;  3O6Q B;  5AW1 B;  3V4Q A;  1GZL A;  2OYI B;  1BSH A;  2JDI H;  1M57 D;  4JYB A;  5AVR B;  4M3L A;  5B5E H;  1RH5 B;  3FGA D;  3BAT A;  2AEJ A;  1KB9 I;  2OTL P;  3GF7 A;  5K5G B;  3CCS P;  1OW7 A;  1T3J A;  5KKZ C;  1H0T B;  2W6J H;  2R32 A;  1T2K D;  2YIU B;  1Q82 Q;  1OW6 A;  3VOP A;  4PV1 D;  5B66 H;  1LTB C;  3I5C A;  1K73 Q;  1VQ4 P;  3D6Z A;  2IPP A;  3TYY A;  1SQB G;  1GL2 C;  5KJ7 D;  1N8R Q;  1VQ8 P;  3BCC G;  3CCU P;  2QG4 A;  2Q3I A;  1H0T A;  2R5D A;  1AA0 A;  3CC7 P;  3SWF A;  1TU3 F;  1JMM A;  3M0D C;  1X0T A;  3CCM P;  1OVR A;  4H44 D;  4L73 A;  3RK2 C;  2QJP B;  3E1I A;  3RK3 C;  4IL6 E;  1RF0 C;  3CX5 E;  4EDF A;  1X79 B;  2V7Q J;  3QWO C;  1OVV A;  5KLI B;  1M1J B;  2AEF A;  3PH0 A;  5AW4 B;  5TIS E;  2E74 C;  2Q6Q A;  4C7R A;  1SQB J;  1L4A B;  1SQX K;  1MKM A;  1SQB E;  3BCC J;  3Q5S A;  1EDL A;  3P8M C;  4YXW H;  3NMD A;  1L0N K;  3BCC E;  4N3Y B;  3GHG A;  3GG2 A;  3CXH D;  3B71 A;  1IFM A;  3KXD A;  3TDK A;  3U1C A;  1QL1 A;  2P10 A;  2QA4 P;  3I55 P;  3BRT B;  1LTT C;  3KZI E;  1FC2 C;  1HJ0 A;  5AVY B;  5CCG C;  2OAR A;  3HE5 B;  4W7Z A;  3B5N B;  2YXQ B;  4H0L C;  2N9B A;  1VQ5 P;  1X22 A;  2WZ7 A;  3IFM A;  4Z1M H;  3CWB G;  2I8D A;  1OMI A;  2XND H;  1PGO A;  3H1I D;  2FXP A;  4OGQ C;  2WSF J;  1NTZ K;  3VMX A;  3D70 A;  4GKG A;  1RF1 C;  3FWN A;  3HE5 A;  2M3B A;  1NTK J;  2PGD A;  2E75 B;  2M0B A;  1PFI A;  3N4X A;  3L75 D;  4UB6 E;  2Y9Z A;  2IBZ D;  2AXC A;  3HUS C;  1KIL A;  1OVU A;  3E7K A;  1L0N D;  1S9K E;  4UB8 H;  2PRR A;  1RE4 C;  1KTM A;  5APV A;  1JTH A;  2V4H A;  1FE6 A;  3CWB J;  2YO2 A;  2WT7 B;  2ZFC A;  1EDJ A;  2IZ1 A;  3OAK A;  3KDP B;  3CWB E;  1K8A Q;  1KYO D;  4D6T G;  1EZV D;  1AFO A;  3L73 J;  3FXD A;  1VL2 A;  2IYO A;  1SP4 A;  3H1H D;  1OWA A;  1CI6 B;  2W90 A;  4EIJ A;  3HE4 B;  3TK1 A;  4OWF A;  2O01 H;  3VMZ A;  2OYI C;  2KS1 B;  4QMA A;  1EXJ A;  2ZJS E;  1S1C X;  3CCV P;  3V5B A;  1T6A A;  1ZN5 A;  2WT7 A;  3A3Y B;  2HYN A;  1ZME C;  1NTZ D;  4C46 A;  5DJT B;  3H1L G;  4N6J A;  1WMK A;  3CCL P;  3L71 D;  1A02 J;  4NPE A;  1L0L K;  1QX8 A;  1SQQ D;  2A45 H;  3HE4 A;  4D6T J;  2FBW C;  1FZE A;  2KS1 A;  2YIU C;  2P2U A;  1KQF B;  4D6T E;  1CW5 A;  3S9O A;  1QVF O;  4HKZ H;  3CC2 P;  2CK3 H;  4R4L A;  2OYH A;  1L2P A;  2J5U A;  1LTJ A;  1QVG O;  3AE5 C;  3I56 P;  3A7O A;  3L70 J;  3M9Q A;  2FXO A;  1ZV8 A;  1W2B O;  3H1H J;  3AEC C;  3HD7 C;  4NPD A;  1MFT A;  1PGP A;  3TGU D;  5CCH A;  1JNM A;  5AVS B;  5KLV K;  1HJB A;  5GTI E;  2XNX A;  2QJY C;  1URQ C;  3EQ2 A;  1D7M A;  3QH9 A;  4TLF A;  1NTM G;  1G2C B;  3MGN A;  3H1L E;  1A02 F;  1N86 A;  3O8Z A;  4DCK A;  1AQT A;  2IFM A;  3CCE P;  2QJP C;  1SQQ J;  3GMA A;  4AQR D;  4PD4 H;  1VQN P;  1IC2 A;  3TF5 A;  1M1J C;  1VQK P;  1FOS F;  2FFD C;  3Q1M A;  1L4A C;  1L0L D;  2IBZ I;  4DZO A;  1SQV G;  1NYH A;  2AXT H;  1NKZ B;  3K5B A;  4A7P A;  2IYP A;  2K9J B;  4IL6 X;  3RL0 B;  5E79 H;  1RQV A;  3VYI A;  3F5H A;  2KZJ A;  1YQ4 C;  3UIA A;  1KYO I;  4K35 A;  1NTM E;  1EZV I;  4N78 D;  1KQS O;  1SFC B;  2YXR B;  1LWU B;  1IK9 A;  1NAY A;  5CHX A;  2PP6 A;  3B5N C;  4Y99 B;  2RMZ A;  4U3F D;  1NU1 K;  1IZN B;  1FZG A;  2A06 G;  1NKN A;  1ZXG A;  4DOJ A;  1HGV A;  1BE3 J;  3H1J J;  1H89 A;  2HFE D;  4L74 A;  1QL2 A;  2XDJ A;  1SQV E;  1T8Z A;  3L74 J;  1PZQ A;  3RGU A;  4DJG A;  3A0B H;  1P84 D;  3L74 E;  1FS0 E;  3H1K J;  1KIL D;  2N1T B;  1KC8 Q;  2CPS A;  3H1K E;  2POH A;  1OZH A;  2KIK A;  5KAI H;  1DD3 A;  1LT9 B;  5CJ4 A;  1N73 B;  2E75 D;  1RE3 A;  1WT6 A;  2A06 E;  1PP9 G;  3G9R A;  3SWK A;  3U59 A;  2NPS A;  1AVY A;  4I6M C;  2QJK B;  2N1T A;  2P7J A;  2KSE A;  1KB9 E;  1LNQ A;  1KB9 H;  3TNU A;  1UIX A;  4TT3 H;  4JYC A;  1LT9 A;  3M9H A;  1N73 A;  2YKQ A;  2ZYG A;  4I2L C;  2YNY A;  2QSI A;  3KPE A;  1KFM A;  1MV8 A;  4HYT B;  3A5T A;  3V6I A;  3WUT A;  3AE6 C;  3AED C;  1EC5 A;  2K88 A;  3S1K A;  3IAO A;  1YTZ T;  1PP9 E;  1JY2 P;  3MUD C;  3AE3 C;  5B5E E;  1P84 H;  3VP9 A;  2YMK A;  1T2K C;  1SQP G;  2Q1K A;  2W6B A;  3MTU E;  2Y0E A;  1WRG A;  4PV1 C;  2WSS H;  3CX5 D;  2FYU G;  1USD A;  2Z5I A;  2YMY A;  1FZC C;  5AVQ B;  4IFM A;  2M8R A;  2O1J A;  2JEE A;  4GIF A;  1BGY G;  1CSB A;  3ITK A;  3AEF C;  5KJ7 C;  2RN0 A;  1SQB D;  5B66 E;  3AEA C;  2O3J A;  1PPJ G;  1GU5 A;  3BCC D;  4I7Z B;  2KB7 P;  2JWD A;  4YXD C;  3KHU A;  2JO1 A;  4H13 D;  3NTN A;  2WPV B;  4BXL A;  2Z4E A;  4H44 C;  4LLH A;  2B88 A;  1SQP J;  1P84 I;  3L72 G;  1FDO A;  1J1D C;  5CMZ A;  3HRN A;  1SQP E;  1PGQ A;  2FYU E;  1AVO A;  4EI2 A;  2KYV A;  2WSE J;  3IN6 A;  2HOD B;  2KSJ A;  3GHG B;  1BGY E;  1J1E C;  3BRV B;  3B8E B;  2Q5U A;  4RJT A;  1XTG B;  4L75 A;  1GTW A;  1PPJ E;  1KN7 A;  3AEG C;  1LWU C;  3RL0 D;  3Q5P A;  4B86 A;  1NTK D;  1ZLL A;  1K04 A;  1S3J A;  4Y99 C;  4GDO A;  4HB1 A;  1JCD A;  2HOD A;  1N2D C;  1S72 P;  3L72 E;  2V7Q H;  1N7L A;  1VF5 B;  1SFC D;  1S9K D;  3GF3 A;  4EOT A;  3KQG A;  2L91 A;  3PJS K;  4WY4 B;  1RHZ B;  2OGU A;  3CWB D;  1SLQ A;  2H89 C;  1AV1 A;  3GW6 A;  2KLU A;  3H25 A;  1KQL A;  4Y28 J;  1JY3 N;  3P8C E;  2D2C D;  2W8Z A;  2KNC B;  3L73 D;  1FDM A;  2C9L Y;  2KLV A;  3WMM 0;  2W27 A;  1KIL B;  1KZU B;  3CPW O;  2R3S A;  3CX5 I;  2H7H A;  2H8P D;  1JTH B;  1ZP0 C;  2NPS D;  1YTZ I;  4WY4 A;  3L4F A;  1NOH A;  2JKV A;  3LW5 J;  1SQQ K;  2N1T D;  2LR2 A;  3AEB C;  2SPZ A;  4AYC A;  2KNC A;  3N7N A;  3CD6 P;  1JY2 O;  1DIP A;  2B87 B;  2WSC J;  2WPS A;  3Q5R A;  2WSF H;  4UB8 E;  3H1I G;  4D6T D;  3RK3 E;  2A45 G;  1PGJ A;  3D71 A;  1R5S A;  1BDC A;  2GUS A;  4AUW A;  3JCU H;  3CXH H;  1DEB A;  3L70 D;  5AW5 B;  2KI7 B;  2WPR A;  1YJN P;  2BCC G;  3SFD C;  3PTZ A;  2KXP B;  1SQX G;  2WWW A;  2O01 J;  2B87 A;  1JY3 P;  1NH4 A;  3L75 G;  2C0X A;  2I1K A;  1L0N G;  1LTG C;  1U7J A;  2VRS A;  2K1A A;  3H1L D;  4WBA A;  2OYH B;  4ASV A;  1QLE D;  3MP7 B;  1UII A;  1LTJ B;  2HLO A;  1NVO A;  1HVV A;  1MUU A;  1EZV G;  5APW A;  1IFD A;  3H1I E;  1K05 A;  1K9M Q;  3T97 A;  3H6P A;  3CXH I;  2RKL A;  3PRJ A;  1H88 A;  3HTK B;  1YBK A;  1M56 D;  2BCC E;  1S5L E;  1SQX E;  1FAV A;  1NWQ A;  2E43 A;  2O01 N;  1S5L H;  3W68 A;  3L75 E;  4I7Z C;  5AW8 B;  1NTZ G;  2IDB A;  3AE9 C;  3P32 A;  1L0N E;  4RES B;  1BDD A;  2ZT9 D;  1ZRT E;  3L71 G;  2FXM A;  4H13 B;  3USS A;  1N7S A;  3H1L J;  1GK6 A;  2E5T A;  2B9B A;  1KYO E;  3WUV A;  3HTK A;  3KYQ A;  1HWT C;  1IO4 A;  1EZV E;  1KYO H;  1PV3 A;  5KAF H;  3V4W A;  5KKZ B;  4JQ0 D;  1LTS C;  5CBN A;  2CPB A;  1EXI A;  3F89 A;  1HH0 A;  2BEQ D;  3GHG C;  1XTC C;  1NJI Q;  1MZ9 A;  4PD4 E;  3TGU G;  1SQV D;  1MFZ A;  1BE3 D;  3H1J D;  3II6 A;  1JEK A;  5KLI C;  3GLM A;  2N9Y B;  1CZQ A;  1GL2 B;  1FZC A;  3L74 D;  1NTZ E;  2AXT E;  4ZNC A;  1JUN A;  5APU A;  4XFJ A;  3L71 E;  2HPC B;  5E79 E;  1BCC G;  3H1K D;  4I1L A;  1DEE G;  4W80 A;  2J58 A;  3RL0 g;  3IR9 A;  2FY8 A;  1M8O B;  1NTM J;  3G6E P;  1VQM P;  1FZB A;  1OIP A;  4YPC A;  2C9N Y;  3S4R A;  2WQY C;  3RK2 B;  2A06 D;  2NRG A;  3R4Y A;  1E79 H;  1GL2 A;  4LC1 A;  1L0L G;  1M90 Q;  1GMJ A;  2WTY A;  1GD2 E;  5AVV B;  1VF5 D;  2LXC B;  3TGU E;  2E74 B;  2HPC A;  2FYN B;  2D2C B;  3AE7 C;  3M0D A;  4WY4 D;  4OH8 B;  1SQV J;  3V2Q A;  4MN4 C;  1KIL C;  3C9I A;  2J59 M;  1VQ6 P;  1KOR A;  3FWL A;  5AVT B;  1RF0 A;  2Q9I A;  3NFQ A;  1BCC E;  2NPS B;  3A0B E;  2FKW B;  1JY3 O;  2FYZ A;  5BU5 A;  3CCR P;  4U3F G;  2E75 C;  5KLV G;  3M9B A;  1VQ9 P;  3LID A;  4ZKP A;  2QRX A;  5H2F H;  4H0L B;  1PP9 D;  5KAI E;  2ZYD A;  3TNU B;  1JM0 A;  1EQ7 A;  1L0L E;  3BAS A;  2YKP A;  1IFP A;  3A2A A;  1QGK B;  1AQ5 A;  5AVX B;  1Y9B A;  4BRY A;  3RBX A;  1FJK A;  1S4X A;  3OW2 O;  1R8E A;  5CCG A;  5GTH H;  1SQB K;  4HJG H;  3A0H H;  4ASW A;  2KK7 A;  1IJD B;  3CL3 D;  2B89 A;  2ZVN B;  4GOE A;  1LGH B;  4ZMD A;  5KLV E;  2OYH C;  4L76 A;  1VQP P;  1LTJ C;  4JF7 A;  5EFW B;  1X8Y A;  1U57 A;  1RF1 A;  3AE4 C;  1USE A;  1PP9 J;  3WU2 H;  2DW3 A;  2JWA A;  3JSV C;  1SQP D;  1YJW P;  1NU1 G;  5CBO A;  2E76 D;  2FYU D;  1P84 E;  3VP8 A;  3ZDM A;  2HR3 A;  5AW3 B;  2KZI A;  3HUS A;  4U7J A;  1BGY D;  5TJH A;  1H8A A;  2M3E A;  1RE4 A;  5APQ A;  5CCH D;  2OTK E;  1IFN A;  1KQG B;  1DD4 A;  2ZAE B;  1LT1 A;  1YQ3 C;  2YO3 A;  1N7S D;  1PPJ D;  1NTK K;  1ZW0 A;  3FX0 A;  2ZT9 B;  1VQO P;  4H13 C;  5CJ0 A;  1S5L X;  1NAF A;  3EFG A;  3O6Q A;  3L72 D;  1NU1 J;  2JR8 A;  2OYI A;  3U1A A;  1NU1 E;  2M5A B;  1JB0 J;  2IX7 C;  2WMM A;  3AE8 C;  1T3U A;  3MZW B;  1YYC A;  1DX7 A;  4IFD K;  2L5G B;  3MIW A;  2FYU J;  1E5W A;  1KD1 Q;  4LGD E;  4PJ0 E;  1VQ7 P;  3HD7 B;  4PJ0 H;  3D6Y A;  3P8C D;  1BGY J;  1OFC X;  2Y0D A;  4GT1 A;  4GOF A;  2PAJ A;  3RL0 C;  1SVF A;  2QJY B;  2ZVO B;  1URQ B;  1VPC A;  2BEZ F;  2M5A A;  2PFX A;  3IF4 A;  5M1B A;  3VMA A;  3SWY A;  2H43 A;  1NHL A;  5APY A;  4GOD A;  4XA4 A;  1W2E A;  1GL2 D;  4JBZ A;  1Y47 A;  2JJL A;  1JCC A;  3C8V A;  1Z56 A;  1SFC C;  1NGM B;  3OA7 A;  2P67 A;  3HD7 A;  2WSE H;  2Y9Y A;  4IL6 H;  3CX5 H;  4BWN A;  3L72 J;  2YKO A;  5AVW B;  4WVZ A;  5AVU B;  1RY3 A;  1URQ A;  2FFD B;  2FYN C;  5TIS H;  3RK2 D;  2W6A A;  2D2C C;  4DT0 A;  1DH3 A;  4KJM A;  3RK3 D; 
#chains in the Genus database with same CATH homology
 1SQQ J;  1KB9 I;  3L75 J;  1PP9 J;  3H1L J;  3L72 J;  3L70 J;  2FYU J;  5KLV J;  1L0N J;  3CX5 I;  3TGU J;  1L0L J;  1BCC J;  1NU1 J;  3L74 J;  4PD4 I;  1NTM J;  3L73 J;  3H1H J;  4D6T J;  1NTZ J;  1KYO I;  1EZV I;  1SQB J;  2IBZ I;  3CXH I;  1NTK J;  1BGY J;  2BCC J;  3H1I J;  1SQX J;  3CWB J;  3L71 J;  1SQP J;  4U3F J;  1BE3 J;  1P84 I;  3H1J J;  3H1K J;  1SQV J;  3BCC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...