1BGYJ

Cytochrome bc1 complex from bovine
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
b'VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 18
structure length 62
sequence length 62
chains with identical sequence V
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1bgyJ00
1SQVJ 1KB9I 3H1HJ 1NTZJ 1EZVI 3L70J 4D6TJ 1L0LJ 3H1IJ 2FYUJ 3CX5I 3H1LJ 3L73J 1BCCJ 1NU1J 3TGUJ 1SQBJ 1PP9J 3CWBJ 1SQQJ 1L0NJ 3CXHI 1BGYJ 3L72J 2IBZI 2BCCJ 1NTMJ 1SQPJ 3H1JJ 4PD4I 1SQXJ 4U3FJ 3L75J 1BE3J 1KYOI 3L71J 3BCCJ 3L74J 5KLVJ 1P84I 3H1KJ 1NTKJ
chains in the Genus database with same CATH superfamily
2NPSB 1AVOA 4A7PA 3LIDA 3HE5A 3CWBJ 1RE3A 4BWNA 2FYNC 2HPCB 1K73Q 1NHLA 1H0TB 2FYUK 1KD1Q 2FXPA 1PGQA 1JY2N 2ZYGA 4LC1A 2K3RA 1EDJA 3P7KA 3HTKB 1SQBJ 2KIKA 2G3AA 4BRYA 2ZVNB 1SVFA 2GM4A 4GIFA 1H89A 1JY3O 3BCCE 1BCCD 2JR8A 3A0HH 4WBAA 1SQQD 2B87B 3JSVC 1VQ7P 1N7SD 1Q2NA 1KC8Q 1QL1A 1YTZI 1QVGO 1URQA 1SQPJ 3CMAP 1ZLLA 1YIJP 2YKPA 5KLVE 1NGMB 1NTZJ 1MFZA 4ZKUA 1GL2D 2KS1B 3TNUA 4KHXA 3CL3D 2IDBA 2FYUG 1NTKD 1PIXA 1NTKK 2N9YB 4O9BA 4GKGA 1SQXJ 1BSNA 2Q9IA 1GU5A 2N1TB 1DH3A 3A2AA 3AEDC 3H25A 4LLHA 2RN0A 1IK7A 1DX7A 3C8VA 3L70G 5AVSB 3HD7B 1BCCG 4MN4C 1R5LA 3OW2O 3M9QA 1L4AA 3B5NB 1N8RQ 4Y28J 4I2LC 5KAIH 1SFCD 3VMAA 2D2CD 1GMJA 1PPJD 1KORA 2B89A 1NH4A 3I5CA 2A45H 3TDKA 2V4HA 1PZQA 3H1LJ 1NTKG 1KQFB 3USSA 1OW6A 1OWAA 3E1IA 3MD0A 1Q90D 2YKOA 2B87A 3C9IA 1LTGC 1RF1B 3GG2A 4XFJA 1AQTA 1N73B 1W2EA 1P84D 2W6AA 1GD2E 1HGZA 1ZR4A 1Y47A 4JYBA 1QX8A 1VQNP 2WSCJ 1Y9BA 3HUSA 4GOEA 4IOIH 2W8ZA 3JCUE 2E76B 3V2PA 2N1TC 4ZMDA 2IFMA 4PD4H 1L0NJ 3H1KD 5KLVD 1CSBA 4LGDE 5KLVK 3F5HA 5AW0B 2OARA 3RL0C 3CX5D 2HYNA 2QIWA 2ZT9D 1PP9D 1U57A 2AEMA 2FFDC 2HODA 3HD7C 3U1CA 4UB6H 5KJ7C 2E74B 1E79H 1GW4A 4XE5B 1JMBA 3SSUA 2K37A 1HH0A 1ZV8A 4OVNF 1N2DC 3AE7C 3B5NA 5AVXB 5CBNA 4H0LB 2WMMA 4HH2A 3BCCG 3WMM0 3TGUE 2P58A 1ZMEC 2GA1A 4PV1C 1LWUA 3BVHA 3CC7P 1QLED 1BSHA 3AECC 1VQPP 1VQ8P 4KJMA 5CCHC 3G3ZA 2LR2A 5KLVG 3OAKA 2OYHA 4N78E 2O1JA 1ZP0C 1IFMA 1T3JA 3IF4A 1K9MQ 1RF1C 1OVVA 1PGJA 2WVRA 3H1JE 1URQD 4U3FE 1FJPA 4IL6E 1M1KQ 2LXCB 1L0LE 1Q7YQ 1VQOP 2YNYA 3RK3E 1WMKA 2P7JA 4DCKA 3M9HA 2B88A 2Q3IA 3CCLP 4NPDA 1HBWA 1KILA 3I55P 5E79E 1M1JC 4OGQB 2AXTE 5K5GB 2RMZA 2WPVB 2E74C 5APQA 2E43A 1LT1A 2XU6A 3L73D 1L4AD 1SQVE 2IZ0A 5CMZA 3MUDC 1JCDA 5AW1B 2G8YA 3TGUJ 2QEXP 4JPZB 5C39A 3VP8A 1FOSF 2NPSD 4H0LC 5APSA 2OTJP 2DW3A 2E5YA 4RJTA 3HRNA 5CJ0A 1VF5D 2WZ7A 1M57D 1OVUA 3CXHD 3H1HE 2E75C 1GL2A 2M3BA 4H13B 2V7QJ 4R4LA 3H1JJ 3LW5J 1MUUA 3A5TA 4U3FJ 2YMKA 2I1KA 5TISE 1HF9A 1QGKB 3M0AA 2P2UA 3CCQP 1H8AA 3L75D 4OH8B 1AFOA 3ABVC 3H32B 1S2EA 4C7NB 2QM8A 5CCGC 2OYOA 4N78D 1NYHA 3RK2D 3FWNA 2K1AA 4XA4A 1LNQA 1GW3A 1FZCC 2KNCB 4YXDC 1AQ5A 1SQQE 2WSFH 3QH9A 1FE6A 1U7MA 5CHXA 2WWWA 1KYOH 4OGQC 4WY4B 3VMZA 5B66E 5CJ4A 1L0LK 3N7NA 1LTJC 1JB0J 4DOJA 4EI2A 3AE4C 2BCCD 4I1LA 1YQ4C 2W83C 2WSCH 2KSEA 1AJYA 1HVVA 1ZXGA 3TGUG 3MGNA 2H88C 4GOFA 3SWKA 4DZOA 3H1HJ 2QM7A 3B5ND 5AW4B 2OYIC 1TU3F 4WWIA 1SQVK 1JMMA 1LP1B 3M91A 5AVUB 1EQ7A 2E42A 4H13C 2BASA 1L2PA 3IN6A 3AE5C 1BGYD 5BVZA 1RE4A 4U3FG 2ZAEB 1YI2P 2FYUJ 3D6YA 4N3YB 1J1DB 1OZHA 1VL2A 1L0LG 1R5SA 3HE4B 4UB8E 1PPJE 5KKZB 1T2KC 1SLQA 3V2NA 1NTMD 1Y8AA 4L75A 2IFNA 3L70J 4PD4D 1JTHB 1BCCJ 3M0DA 4ASWA 1VQKP 3BRTB 2Q1KA 3JC22 1RE3C 1XTGB 2KI7B 4C7NA 3E1RA 3L35A 3Q1MA 1YHQP 4AUWA 1T3UA 4WY4C 1M90Q 1KILD 1SQVG 3MP7B 1RHZB 1MFTA 1UIXA 3L71D 4Y99B 1GDTA 1EDIA 2KNCA 2E76D 3V4QA 3F89A 3S1KA 1BGYG 3JCUH 1P84E 2QJPC 4K3AA 1USEA 1NTKJ 3L72D 4RESB 1SQQK 2OGUA 2WPSA 3K5BA 2KSJA 2IZ1A 1K05A 3H1HG 1JNMA 3WU2E 5AVZB 1M8OB 5AW2B 3FXDA 2M5AA 2XNXA 3RBXA 1K8AQ 2NZ2A 1JY3N 1FDIA 3H1KE 4ASVA 4WVZA 3KZIH 3H1IE 3CX5E 1PP9E 4TT3H 3CCMP 2KLUA 1FS0E 1KFNA 1NKNA 4KT0J 1J1DC 1WT6A 1VQ4P 2VRSA 3I56P 1KB9E 2Z5IA 4BXLA 3PP5A 4ZNCA 5GTHE 2E5TA 5APVA 5KKZC 3RL0B 3CCRP 3IAOA 3RK3B 2FFDB 1SQQG 4D6TD 2K88A 3GHGB 2Q7CA 2FBWC 1DD4A 2JWDA 3HE4A 1DD3A 2R5DA 2C0WA 1HGVA 2V7QH 3ZDMA 3N4XA 2NPSA 5APUA 3LW5H 3V2QA 3CMEP 1UIIA 3KXDA 4Y99C 2Q5UA 1OMIA 2HPCA 3BCCJ 1H0TA 2I8DA 2JO1A 1LTSC 4PV1B 1NU1E 3FGAD 5APTA 5AVWB 3L74D 3WUUA 3HTKA 2R32A 3L37A 2WSFJ 5E79H 1HJBA 1MKMA 5KLVJ 1MZ9A 2HFED 2MJZA 1E5WA 1Z56A 2UWJE 3MZWB 3NXSA 2YKQA 4H44C 3E7KA 3D70A 1LT9B 2J5UA 5KTBA 2PGDA 4HKZH 4IFFA 3T97B 3L73E 1PPJG 2O01N 5M1BA 1Q81Q 1GU4A 2QRXA 1S5LE 2KS1A 5AW6B 1HJ0A 3H1LD 3H1ID 1M1JB 3RK3C 1PGPA 2Q3EA 5AW5B 1CZQA 1RY3A 1IFDA 2N1TA 2PAJA 3GHGC 3L74G 1CW5A 1GK6A 1FOSE 1KQLA 3CXHE 3SWFA 1KB9D 1GZLA 1N7SB 2PFXA 3CC2P 1HUCA 4HJGH 2FFDA 3HD7A 4IFMA 1KN7A 1P84I 2LXBA 5KJ7A 3NMDA 1RQUA 4PJ0E 3AE8C 1LTAC 1A02F 1NKZB 2C9NY 2K9JB 4EDFA 3GW6A 1XTCC 3AEGC 5B5EE 1IO4A 2E75B 3L75E 4GODA 1ZW0A 3V2RA 1VQ9P 1L0ND 1FJKA 3CX5I 3H1KG 2WPRA 1VQLP 1BDCA 4EIJA 2SPZA 1CI6B 2W90A 3L36A 3H1IG 2Y0DA 4HYTB 2R3SA 5B66H 1KV4A 1G2CB 3CCEP 1OX3A 1PP9G 1NU1D 1NU1K 5TJHA 3WUVA 4IFDK 1KFMA 4JBZA 5CCHA 1KB9I 1W5CE 2FXOA 1X9VA 3CCUP 2FYZA 2ZJSE 1LT9C 2M8RA 2NRGA 2Z4EA 3D71A 3Q5SA 3Q5RA 1RF1A 5H2FH 2BCCE 2O1KA 1N73A 2QA4P 1OVRA 1SFCB 1VQ6P 1FZCB 1Q82Q 1LJ2A 1JCCA 4C46A 2ZYAA 1LTJB 2KB7P 1HTLC 4DT0A 2N9BA 3PJSK 3AEFC 1YBKA 2FKWB 4U7JA 2OTLP 1N7SC 2O3JA 4L73A 2BEQD 1YQ3C 5DJTB 2GUSA 3NFQA 1KQGB 1BGYE 3A0BH 1NU1G 1ZN5A 1DEEG 2I1JA 2OYIB 2W27A 1GL2C 1ZRTE 2KZJA 2QG4A 3O6QB 1BDDA 1D7MA 1BE3D 3L4FA 2ZFCA 4CPGA 1G1IA 3A3YB 1NTME 3TF5A 2IYOA 4PD4E 4JF7A 1FDMA 1HWTC 2R5BA 1FDOA 3QWOC 5CBOA 2IYPA 4HB1A 1L0LJ 3PTZA 2CPBA 4UB6E 2ZT9B 1DIPA 3L73G 2BCCJ 1KILE 1P84H 4RO0A 1JOCA 2KYVA 3L71E 3RGUA 1H88A 1NOHA 2A06D 1FZFA 4N6JA 3HE5B 1AA0A 3S9OA 1SFCC 2D2CC 5L8RJ 3L72E 1WRGA 3CXHI 2WQYC 2HR3A 5CCGA 1S5LX 5BU5A 1EXJA 2HG5D 1J2JB 3CX5H 1M7LA 1SQVJ 3IFMA 4I6MC 4BRYB 3V6IA 3Q2YA 2QSIA 3TYYA 3KHUA 2N1TD 3CWBE 1BGYJ 3MTUE 1EZVD 3VTPC 2QJPB 1Q86Q 1IZNB 3RL0D 1JY2P 4L76A 1JO5A 3HD7D 1RF0C 2YIUB 3L75G 2RH0A 5KJ7D 1URQB 3AE2C 1KZUB 3P32A 2HLOA 2WT7B 4Z1MH 2ZXEB 3R2PA 5AW7B 3CD6P 2C0XA 3MHVA 3TNUB 3UIAA 4D6TE 4L74A 2O01J 3KPEA 2ITAA 3BATA 2Y0CA 1OIPA 5APYA 2KOGA 3KQGA 1SQPE 3MIWA 4PV1D 1ZRTD 2ZT9C 4W7YA 1RQVA 2BCCG 2A45I 1ZR2A 1IFIA 4IL6X 5CCHD 1NTMK 2A45G 4I7ZC 1EDLA 1IC2A 1SS1A 1SQQJ 1L4AB 3U59A 3SFEC 1SQXE 3GMAA 3H32A 1FBMA 2J58A 3L74E 1OFCX 4DJGA 3PH0A 4YPCA 3B8EB 1VF5B 5AW9B 3BASA 3SFDC 2FYUD 5KLIB 1KQSO 2YXRB 5AVYB 3TSIA 5AVTB 4WY4A 3U1AA 1S5LH 5AW8B 3CI9A 1FU1A 2YIUC 2L91A 3P8CD 2E74D 2FY8A 1URQC 3EWKA 3AE9C 3L70D 4PD4I 3FWLA 3G71P 2WSSH 2YO3A 2YO2A 1NTMG 5KAFE 1YTZT 3CWBD 2H43A 3TK1A 1FZEA 3CXHH 3H1LE 4D6TJ 3CCJP 4H44B 3RK2B 2Y9YA 4H0LD 3CCVP 3HUSB 3AE1C 2WT7A 3EQ2A 3R4YA 1IFJA 1IFPA 3RBZA 2Y0EA 4PJ0H 1KYOE 2R3CA 1J1EC 1LP1A 2FXMA 5BU8B 5GTIE 1SQBD 1SQBK 1S9KD 5APWA 2E75D 3L71G 2XDJA 1X0TA 3AE6C 2QJYB 3AE3C 2IPPA 5B5EH 2M3EA 4AQRD 2HODB 3L72G 1L4AC 3L74J 3SWYA 1X22A 3Q5PA 3PHLA 2QE7H 1NJIQ 3O8ZA 1S4XA 1SQPD 1SQPK 1OXZA 1IFNA 1JUNA 3G4SP 1L0NE 2NPSC 2P10A 1JTHA 1NTZD 1U7JA 1NTZK 2M0BA 4IL6H 3CWBG 3Q3DA 4OWFA 5CCGD 1VF5C 2H7HA 2WPQA 1X79B 5AVQB 5KLIC 2KK7A 1SQXD 1SQXK 3AEAC 1LWUB 2WITA 2H8PD 2POHA 1SQBG 4OGQD 3M06A 2CK3H 3BRVB 3CC4P 3H1KJ 2OYHB 3GF7A 4C7RA 2AXTH 3W68A 1EXIA 1EC5A 3FXEA 3H1IJ 1EDKA 1NVOA 1PP9J 2BEZF 2KP8A 1YITP 4D6TG 3VMXA 2GUVA 1IK9A 3A7OA 1LTTC 1R8EA 3RK2C 2Y9ZA 1SQPG 3HUSC 3OA7A 2PRRA 4EYYQ 4RKUJ 2AEJA 1NTZG 2H89C 1AVYA 3BCCD 4ZKPA 2QJYC 1KILB 4H13D 1FZGA 1GK4A 1SQXG 3P8MC 1VQMP 3V5BA 3A0HE 1A02J 1W2BO 2P1JA 1KYOD 2QJKB 2KXPB 5TISH 2PP6A 1BE3E 2O01H 4WB4A 1T2KD 3GHGA 3B5NC 2XKMA 3G9RA 1NU1J 3KZIE 1FAVA 3VMYA 1LWUC 1PV3A 4GDOA 3B4SA 1GL2B 1YJWP 1USDA 1L0NK 1T6AA 3AEBC 1QVFO 1X8YA 4WY4D 5AW3B 2QVAA 4K35A 1KMIZ 2WSEH 2KZIA 2OYHC 2A06E 2AEFA 3H1LG 3PLNA 1KYOI 1SP4A 1K04A 2ZXXA 4YXWH 3NTNA 2OTKE 3L73J 2RKLA 1YJNP 5KAIE 2LKMA 2B9BA 1N73C 4M3LA 3W67A 3H6PA 5APXA 2D2CB 1EZVE 3LIEA 4NPFX 1KILC 5EFWB 1LT9A 2ZYDA 2L5GB 1KTMA 4W7ZA 1QEXA 3T97A 3CCSP 4EOTA 1NO4A 3GF3A 2IBZE 1MV8A 2E76C 1L0NG 1AV1A 1BE3J 2QJKC 2CPSA 3AEEC 2YMYA 1YJ9P 1NAYA 1M1JA 4GT1A 3IR9A 3EFFK 1PL5A 2JJLA 4UB8H 5DJUB 3II6A 3L75J 1N7SA 2Q6QA 3VP9A 1RH5B 3MUDA 3VOPA 1LTIC 4TLFA 2MKVA 4R4MA 1N7LA 2K9JA 4AYCA 2K9YA 1JEKA 1VDFA 3WUTA 2OQQA 1QL2A 2Z5HA 5AVVB 3PRJA 1NWQA 3KYQA 1CI6A 2R44A 3EFGA 2XZRA 1G2CA 2JWAA 1IJDB 3TGUD 4I7ZB 2JP3A 1S72P 2FYUE 3RL0g 4B86A 3WU2H 3OJAB 1N86A 1G1JA 4H44D 5KAFH 4JQ0D 2J59M 3P8CE 3B71A 1SFCA 2KLVA 2ZVOB 3L70E 2W6BA 1FZCA 1OW7A 1BE3G 3H1JD 1BCCE 2FYNB 1PGOA 4U3FD 5GTIH 3ITKA 1L0LD 1KB9H 3D6ZA 1S3JA 1JM0A 2P67A 1LTJA 2AXCA 5GTHH 3VYIA 3RK3D 2IBZD 1GTWA 1M56D 5AVRB 2M5AB 1SQBE 4NPEA 1S9KE 4JYCA 2KUBA 1DEBA 1FZAA 1NTMJ 3CLQA 5H2FE 2A06G 3GLMA 2XV5A 1NTKE 1RF0A 1LGHB 1T8ZA 1VQ5P 2W6JH 3CPWO 1VPCA 1RE4C 3V4WA 2OYIA 2WTYA 2IX7C 4W80A 3M9BA 4YTPC 1LTBC 1SQVD 2YXQB 3S4RA 3O6QA 1J1EB 2C9LY 1NAFA 2XNDH 1OW8A 1JY3P 3L71J 3C1LA 3H1JG 2JKVA 3KDPB 1FZBA 1NTZE 1EZVI 1PFIA 1FC2C 2JDIH 3VN0A 1EZVG 3L72J 3M0DC 2IBZI 1S1CX 2JEEA 3FX0A 3H1HD 2WSEJ 2IBZG 3A0BE 1ZOYC 1YYCA 1JY2O 4QMAA 3G6EP
chains in the Genus database with same CATH topology
1SQVJ 1KB9I 3H1HJ 1NTZJ 1EZVI 3L70J 4D6TJ 1L0LJ 3H1IJ 2FYUJ 3CX5I 3H1LJ 3L73J 1BCCJ 1NU1J 3TGUJ 1SQBJ 1PP9J 3CWBJ 1SQQJ 1L0NJ 3CXHI 1BGYJ 3L72J 2IBZI 2BCCJ 1NTMJ 1SQPJ 3H1JJ 4PD4I 1SQXJ 4U3FJ 3L75J 1BE3J 1KYOI 3L71J 3BCCJ 3L74J 5KLVJ 1P84I 3H1KJ 1NTKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV J;  1KB9 I;  3H1H J;  1NTZ J;  1EZV I;  3L70 J;  4D6T J;  1L0L J;  3H1I J;  2FYU J;  3CX5 I;  3H1L J;  3L73 J;  1BCC J;  1NU1 J;  3TGU J;  1SQB J;  1PP9 J;  3CWB J;  1SQQ J;  1L0N J;  3CXH I;  1BGY J;  3L72 J;  2IBZ I;  2BCC J;  1NTM J;  1SQP J;  3H1J J;  4PD4 I;  1SQX J;  4U3F J;  3L75 J;  1BE3 J;  1KYO I;  3L71 J;  3BCC J;  3L74 J;  5KLV J;  1P84 I;  3H1K J;  1NTK J; 
#chains in the Genus database with same CATH topology
 2NPS B;  1AVO A;  4A7P A;  3LID A;  3HE5 A;  3CWB J;  1RE3 A;  4BWN A;  2FYN C;  2HPC B;  1K73 Q;  1NHL A;  1H0T B;  2FYU K;  1KD1 Q;  2FXP A;  1PGQ A;  1JY2 N;  2ZYG A;  4LC1 A;  2K3R A;  1EDJ A;  3P7K A;  3HTK B;  1SQB J;  2KIK A;  2G3A A;  4BRY A;  2ZVN B;  1SVF A;  2GM4 A;  4GIF A;  1H89 A;  1JY3 O;  3BCC E;  1BCC D;  2JR8 A;  3A0H H;  4WBA A;  1SQQ D;  2B87 B;  3JSV C;  1VQ7 P;  1N7S D;  1Q2N A;  1KC8 Q;  1QL1 A;  1YTZ I;  1QVG O;  1URQ A;  1SQP J;  3CMA P;  1ZLL A;  1YIJ P;  2YKP A;  5KLV E;  1NGM B;  1NTZ J;  1MFZ A;  4ZKU A;  1GL2 D;  2KS1 B;  3TNU A;  4KHX A;  3CL3 D;  2IDB A;  2FYU G;  1NTK D;  1PIX A;  1NTK K;  2N9Y B;  4O9B A;  4GKG A;  1SQX J;  1BSN A;  2Q9I A;  1GU5 A;  2N1T B;  1DH3 A;  3A2A A;  3AED C;  3H25 A;  4LLH A;  2RN0 A;  1IK7 A;  1DX7 A;  3C8V A;  3L70 G;  5AVS B;  3HD7 B;  1BCC G;  4MN4 C;  1R5L A;  3OW2 O;  3M9Q A;  1L4A A;  3B5N B;  1N8R Q;  4Y28 J;  4I2L C;  5KAI H;  1SFC D;  3VMA A;  2D2C D;  1GMJ A;  1PPJ D;  1KOR A;  2B89 A;  1NH4 A;  3I5C A;  2A45 H;  3TDK A;  2V4H A;  1PZQ A;  3H1L J;  1NTK G;  1KQF B;  3USS A;  1OW6 A;  1OWA A;  3E1I A;  3MD0 A;  1Q90 D;  2YKO A;  2B87 A;  3C9I A;  1LTG C;  1RF1 B;  3GG2 A;  4XFJ A;  1AQT A;  1N73 B;  1W2E A;  1P84 D;  2W6A A;  1GD2 E;  1HGZ A;  1ZR4 A;  1Y47 A;  4JYB A;  1QX8 A;  1VQN P;  2WSC J;  1Y9B A;  3HUS A;  4GOE A;  4IOI H;  2W8Z A;  3JCU E;  2E76 B;  3V2P A;  2N1T C;  4ZMD A;  2IFM A;  4PD4 H;  1L0N J;  3H1K D;  5KLV D;  1CSB A;  4LGD E;  5KLV K;  3F5H A;  5AW0 B;  2OAR A;  3RL0 C;  3CX5 D;  2HYN A;  2QIW A;  2ZT9 D;  1PP9 D;  1U57 A;  2AEM A;  2FFD C;  2HOD A;  3HD7 C;  3U1C A;  4UB6 H;  5KJ7 C;  2E74 B;  1E79 H;  1GW4 A;  4XE5 B;  1JMB A;  3SSU A;  2K37 A;  1HH0 A;  1ZV8 A;  4OVN F;  1N2D C;  3AE7 C;  3B5N A;  5AVX B;  5CBN A;  4H0L B;  2WMM A;  4HH2 A;  3BCC G;  3WMM 0;  3TGU E;  2P58 A;  1ZME C;  2GA1 A;  4PV1 C;  1LWU A;  3BVH A;  3CC7 P;  1QLE D;  1BSH A;  3AEC C;  1VQP P;  1VQ8 P;  4KJM A;  5CCH C;  3G3Z A;  2LR2 A;  5KLV G;  3OAK A;  2OYH A;  4N78 E;  2O1J A;  1ZP0 C;  1IFM A;  1T3J A;  3IF4 A;  1K9M Q;  1RF1 C;  1OVV A;  1PGJ A;  2WVR A;  3H1J E;  1URQ D;  4U3F E;  1FJP A;  4IL6 E;  1M1K Q;  2LXC B;  1L0L E;  1Q7Y Q;  1VQO P;  2YNY A;  3RK3 E;  1WMK A;  2P7J A;  4DCK A;  3M9H A;  2B88 A;  2Q3I A;  3CCL P;  4NPD A;  1HBW A;  1KIL A;  3I55 P;  5E79 E;  1M1J C;  4OGQ B;  2AXT E;  5K5G B;  2RMZ A;  2WPV B;  2E74 C;  5APQ A;  2E43 A;  1LT1 A;  2XU6 A;  3L73 D;  1L4A D;  1SQV E;  2IZ0 A;  5CMZ A;  3MUD C;  1JCD A;  5AW1 B;  2G8Y A;  3TGU J;  2QEX P;  4JPZ B;  5C39 A;  3VP8 A;  1FOS F;  2NPS D;  4H0L C;  5APS A;  2OTJ P;  2DW3 A;  2E5Y A;  4RJT A;  3HRN A;  5CJ0 A;  1VF5 D;  2WZ7 A;  1M57 D;  1OVU A;  3CXH D;  3H1H E;  2E75 C;  1GL2 A;  2M3B A;  4H13 B;  2V7Q J;  4R4L A;  3H1J J;  3LW5 J;  1MUU A;  3A5T A;  4U3F J;  2YMK A;  2I1K A;  5TIS E;  1HF9 A;  1QGK B;  3M0A A;  2P2U A;  3CCQ P;  1H8A A;  3L75 D;  4OH8 B;  1AFO A;  3ABV C;  3H32 B;  1S2E A;  4C7N B;  2QM8 A;  5CCG C;  2OYO A;  4N78 D;  1NYH A;  3RK2 D;  3FWN A;  2K1A A;  4XA4 A;  1LNQ A;  1GW3 A;  1FZC C;  2KNC B;  4YXD C;  1AQ5 A;  1SQQ E;  2WSF H;  3QH9 A;  1FE6 A;  1U7M A;  5CHX A;  2WWW A;  1KYO H;  4OGQ C;  4WY4 B;  3VMZ A;  5B66 E;  5CJ4 A;  1L0L K;  3N7N A;  1LTJ C;  1JB0 J;  4DOJ A;  4EI2 A;  3AE4 C;  2BCC D;  4I1L A;  1YQ4 C;  2W83 C;  2WSC H;  2KSE A;  1AJY A;  1HVV A;  1ZXG A;  3TGU G;  3MGN A;  2H88 C;  4GOF A;  3SWK A;  4DZO A;  3H1H J;  2QM7 A;  3B5N D;  5AW4 B;  2OYI C;  1TU3 F;  4WWI A;  1SQV K;  1JMM A;  1LP1 B;  3M91 A;  5AVU B;  1EQ7 A;  2E42 A;  4H13 C;  2BAS A;  1L2P A;  3IN6 A;  3AE5 C;  1BGY D;  5BVZ A;  1RE4 A;  4U3F G;  2ZAE B;  1YI2 P;  2FYU J;  3D6Y A;  4N3Y B;  1J1D B;  1OZH A;  1VL2 A;  1L0L G;  1R5S A;  3HE4 B;  4UB8 E;  1PPJ E;  5KKZ B;  1T2K C;  1SLQ A;  3V2N A;  1NTM D;  1Y8A A;  4L75 A;  2IFN A;  3L70 J;  4PD4 D;  1JTH B;  1BCC J;  3M0D A;  4ASW A;  1VQK P;  3BRT B;  2Q1K A;  3JC2 2;  1RE3 C;  1XTG B;  2KI7 B;  4C7N A;  3E1R A;  3L35 A;  3Q1M A;  1YHQ P;  4AUW A;  1T3U A;  4WY4 C;  1M90 Q;  1KIL D;  1SQV G;  3MP7 B;  1RHZ B;  1MFT A;  1UIX A;  3L71 D;  4Y99 B;  1GDT A;  1EDI A;  2KNC A;  2E76 D;  3V4Q A;  3F89 A;  3S1K A;  1BGY G;  3JCU H;  1P84 E;  2QJP C;  4K3A A;  1USE A;  1NTK J;  3L72 D;  4RES B;  1SQQ K;  2OGU A;  2WPS A;  3K5B A;  2KSJ A;  2IZ1 A;  1K05 A;  3H1H G;  1JNM A;  3WU2 E;  5AVZ B;  1M8O B;  5AW2 B;  3FXD A;  2M5A A;  2XNX A;  3RBX A;  1K8A Q;  2NZ2 A;  1JY3 N;  1FDI A;  3H1K E;  4ASV A;  4WVZ A;  3KZI H;  3H1I E;  3CX5 E;  1PP9 E;  4TT3 H;  3CCM P;  2KLU A;  1FS0 E;  1KFN A;  1NKN A;  4KT0 J;  1J1D C;  1WT6 A;  1VQ4 P;  2VRS A;  3I56 P;  1KB9 E;  2Z5I A;  4BXL A;  3PP5 A;  4ZNC A;  5GTH E;  2E5T A;  5APV A;  5KKZ C;  3RL0 B;  3CCR P;  3IAO A;  3RK3 B;  2FFD B;  1SQQ G;  4D6T D;  2K88 A;  3GHG B;  2Q7C A;  2FBW C;  1DD4 A;  2JWD A;  3HE4 A;  1DD3 A;  2R5D A;  2C0W A;  1HGV A;  2V7Q H;  3ZDM A;  3N4X A;  2NPS A;  5APU A;  3LW5 H;  3V2Q A;  3CME P;  1UII A;  3KXD A;  4Y99 C;  2Q5U A;  1OMI A;  2HPC A;  3BCC J;  1H0T A;  2I8D A;  2JO1 A;  1LTS C;  4PV1 B;  1NU1 E;  3FGA D;  5APT A;  5AVW B;  3L74 D;  3WUU A;  3HTK A;  2R32 A;  3L37 A;  2WSF J;  5E79 H;  1HJB A;  1MKM A;  5KLV J;  1MZ9 A;  2HFE D;  2MJZ A;  1E5W A;  1Z56 A;  2UWJ E;  3MZW B;  3NXS A;  2YKQ A;  4H44 C;  3E7K A;  3D70 A;  1LT9 B;  2J5U A;  5KTB A;  2PGD A;  4HKZ H;  4IFF A;  3T97 B;  3L73 E;  1PPJ G;  2O01 N;  5M1B A;  1Q81 Q;  1GU4 A;  2QRX A;  1S5L E;  2KS1 A;  5AW6 B;  1HJ0 A;  3H1L D;  3H1I D;  1M1J B;  3RK3 C;  1PGP A;  2Q3E A;  5AW5 B;  1CZQ A;  1RY3 A;  1IFD A;  2N1T A;  2PAJ A;  3GHG C;  3L74 G;  1CW5 A;  1GK6 A;  1FOS E;  1KQL A;  3CXH E;  3SWF A;  1KB9 D;  1GZL A;  1N7S B;  2PFX A;  3CC2 P;  1HUC A;  4HJG H;  2FFD A;  3HD7 A;  4IFM A;  1KN7 A;  1P84 I;  2LXB A;  5KJ7 A;  3NMD A;  1RQU A;  4PJ0 E;  3AE8 C;  1LTA C;  1A02 F;  1NKZ B;  2C9N Y;  2K9J B;  4EDF A;  3GW6 A;  1XTC C;  3AEG C;  5B5E E;  1IO4 A;  2E75 B;  3L75 E;  4GOD A;  1ZW0 A;  3V2R A;  1VQ9 P;  1L0N D;  1FJK A;  3CX5 I;  3H1K G;  2WPR A;  1VQL P;  1BDC A;  4EIJ A;  2SPZ A;  1CI6 B;  2W90 A;  3L36 A;  3H1I G;  2Y0D A;  4HYT B;  2R3S A;  5B66 H;  1KV4 A;  1G2C B;  3CCE P;  1OX3 A;  1PP9 G;  1NU1 D;  1NU1 K;  5TJH A;  3WUV A;  4IFD K;  1KFM A;  4JBZ A;  5CCH A;  1KB9 I;  1W5C E;  2FXO A;  1X9V A;  3CCU P;  2FYZ A;  2ZJS E;  1LT9 C;  2M8R A;  2NRG A;  2Z4E A;  3D71 A;  3Q5S A;  3Q5R A;  1RF1 A;  5H2F H;  2BCC E;  2O1K A;  1N73 A;  2QA4 P;  1OVR A;  1SFC B;  1VQ6 P;  1FZC B;  1Q82 Q;  1LJ2 A;  1JCC A;  4C46 A;  2ZYA A;  1LTJ B;  2KB7 P;  1HTL C;  4DT0 A;  2N9B A;  3PJS K;  3AEF C;  1YBK A;  2FKW B;  4U7J A;  2OTL P;  1N7S C;  2O3J A;  4L73 A;  2BEQ D;  1YQ3 C;  5DJT B;  2GUS A;  3NFQ A;  1KQG B;  1BGY E;  3A0B H;  1NU1 G;  1ZN5 A;  1DEE G;  2I1J A;  2OYI B;  2W27 A;  1GL2 C;  1ZRT E;  2KZJ A;  2QG4 A;  3O6Q B;  1BDD A;  1D7M A;  1BE3 D;  3L4F A;  2ZFC A;  4CPG A;  1G1I A;  3A3Y B;  1NTM E;  3TF5 A;  2IYO A;  4PD4 E;  4JF7 A;  1FDM A;  1HWT C;  2R5B A;  1FDO A;  3QWO C;  5CBO A;  2IYP A;  4HB1 A;  1L0L J;  3PTZ A;  2CPB A;  4UB6 E;  2ZT9 B;  1DIP A;  3L73 G;  2BCC J;  1KIL E;  1P84 H;  4RO0 A;  1JOC A;  2KYV A;  3L71 E;  3RGU A;  1H88 A;  1NOH A;  2A06 D;  1FZF A;  4N6J A;  3HE5 B;  1AA0 A;  3S9O A;  1SFC C;  2D2C C;  5L8R J;  3L72 E;  1WRG A;  3CXH I;  2WQY C;  2HR3 A;  5CCG A;  1S5L X;  5BU5 A;  1EXJ A;  2HG5 D;  1J2J B;  3CX5 H;  1M7L A;  1SQV J;  3IFM A;  4I6M C;  4BRY B;  3V6I A;  3Q2Y A;  2QSI A;  3TYY A;  3KHU A;  2N1T D;  3CWB E;  1BGY J;  3MTU E;  1EZV D;  3VTP C;  2QJP B;  1Q86 Q;  1IZN B;  3RL0 D;  1JY2 P;  4L76 A;  1JO5 A;  3HD7 D;  1RF0 C;  2YIU B;  3L75 G;  2RH0 A;  5KJ7 D;  1URQ B;  3AE2 C;  1KZU B;  3P32 A;  2HLO A;  2WT7 B;  4Z1M H;  2ZXE B;  3R2P A;  5AW7 B;  3CD6 P;  2C0X A;  3MHV A;  3TNU B;  3UIA A;  4D6T E;  4L74 A;  2O01 J;  3KPE A;  2ITA A;  3BAT A;  2Y0C A;  1OIP A;  5APY A;  2KOG A;  3KQG A;  1SQP E;  3MIW A;  4PV1 D;  1ZRT D;  2ZT9 C;  4W7Y A;  1RQV A;  2BCC G;  2A45 I;  1ZR2 A;  1IFI A;  4IL6 X;  5CCH D;  1NTM K;  2A45 G;  4I7Z C;  1EDL A;  1IC2 A;  1SS1 A;  1SQQ J;  1L4A B;  3U59 A;  3SFE C;  1SQX E;  3GMA A;  3H32 A;  1FBM A;  2J58 A;  3L74 E;  1OFC X;  4DJG A;  3PH0 A;  4YPC A;  3B8E B;  1VF5 B;  5AW9 B;  3BAS A;  3SFD C;  2FYU D;  5KLI B;  1KQS O;  2YXR B;  5AVY B;  3TSI A;  5AVT B;  4WY4 A;  3U1A A;  1S5L H;  5AW8 B;  3CI9 A;  1FU1 A;  2YIU C;  2L91 A;  3P8C D;  2E74 D;  2FY8 A;  1URQ C;  3EWK A;  3AE9 C;  3L70 D;  4PD4 I;  3FWL A;  3G71 P;  2WSS H;  2YO3 A;  2YO2 A;  1NTM G;  5KAF E;  1YTZ T;  3CWB D;  2H43 A;  3TK1 A;  1FZE A;  3CXH H;  3H1L E;  4D6T J;  3CCJ P;  4H44 B;  3RK2 B;  2Y9Y A;  4H0L D;  3CCV P;  3HUS B;  3AE1 C;  2WT7 A;  3EQ2 A;  3R4Y A;  1IFJ A;  1IFP A;  3RBZ A;  2Y0E A;  4PJ0 H;  1KYO E;  2R3C A;  1J1E C;  1LP1 A;  2FXM A;  5BU8 B;  5GTI E;  1SQB D;  1SQB K;  1S9K D;  5APW A;  2E75 D;  3L71 G;  2XDJ A;  1X0T A;  3AE6 C;  2QJY B;  3AE3 C;  2IPP A;  5B5E H;  2M3E A;  4AQR D;  2HOD B;  3L72 G;  1L4A C;  3L74 J;  3SWY A;  1X22 A;  3Q5P A;  3PHL A;  2QE7 H;  1NJI Q;  3O8Z A;  1S4X A;  1SQP D;  1SQP K;  1OXZ A;  1IFN A;  1JUN A;  3G4S P;  1L0N E;  2NPS C;  2P10 A;  1JTH A;  1NTZ D;  1U7J A;  1NTZ K;  2M0B A;  4IL6 H;  3CWB G;  3Q3D A;  4OWF A;  5CCG D;  1VF5 C;  2H7H A;  2WPQ A;  1X79 B;  5AVQ B;  5KLI C;  2KK7 A;  1SQX D;  1SQX K;  3AEA C;  1LWU B;  2WIT A;  2H8P D;  2POH A;  1SQB G;  4OGQ D;  3M06 A;  2CK3 H;  3BRV B;  3CC4 P;  3H1K J;  2OYH B;  3GF7 A;  4C7R A;  2AXT H;  3W68 A;  1EXI A;  1EC5 A;  3FXE A;  3H1I J;  1EDK A;  1NVO A;  1PP9 J;  2BEZ F;  2KP8 A;  1YIT P;  4D6T G;  3VMX A;  2GUV A;  1IK9 A;  3A7O A;  1LTT C;  1R8E A;  3RK2 C;  2Y9Z A;  1SQP G;  3HUS C;  3OA7 A;  2PRR A;  4EYY Q;  4RKU J;  2AEJ A;  1NTZ G;  2H89 C;  1AVY A;  3BCC D;  4ZKP A;  2QJY C;  1KIL B;  4H13 D;  1FZG A;  1GK4 A;  1SQX G;  3P8M C;  1VQM P;  3V5B A;  3A0H E;  1A02 J;  1W2B O;  2P1J A;  1KYO D;  2QJK B;  2KXP B;  5TIS H;  2PP6 A;  1BE3 E;  2O01 H;  4WB4 A;  1T2K D;  3GHG A;  3B5N C;  2XKM A;  3G9R A;  1NU1 J;  3KZI E;  1FAV A;  3VMY A;  1LWU C;  1PV3 A;  4GDO A;  3B4S A;  1GL2 B;  1YJW P;  1USD A;  1L0N K;  1T6A A;  3AEB C;  1QVF O;  1X8Y A;  4WY4 D;  5AW3 B;  2QVA A;  4K35 A;  1KMI Z;  2WSE H;  2KZI A;  2OYH C;  2A06 E;  2AEF A;  3H1L G;  3PLN A;  1KYO I;  1SP4 A;  1K04 A;  2ZXX A;  4YXW H;  3NTN A;  2OTK E;  3L73 J;  2RKL A;  1YJN P;  5KAI E;  2LKM A;  2B9B A;  1N73 C;  4M3L A;  3W67 A;  3H6P A;  5APX A;  2D2C B;  1EZV E;  3LIE A;  4NPF X;  1KIL C;  5EFW B;  1LT9 A;  2ZYD A;  2L5G B;  1KTM A;  4W7Z A;  1QEX A;  3T97 A;  3CCS P;  4EOT A;  1NO4 A;  3GF3 A;  2IBZ E;  1MV8 A;  2E76 C;  1L0N G;  1AV1 A;  1BE3 J;  2QJK C;  2CPS A;  3AEE C;  2YMY A;  1YJ9 P;  1NAY A;  1M1J A;  4GT1 A;  3IR9 A;  3EFF K;  1PL5 A;  2JJL A;  4UB8 H;  5DJU B;  3II6 A;  3L75 J;  1N7S A;  2Q6Q A;  3VP9 A;  1RH5 B;  3MUD A;  3VOP A;  1LTI C;  4TLF A;  2MKV A;  4R4M A;  1N7L A;  2K9J A;  4AYC A;  2K9Y A;  1JEK A;  1VDF A;  3WUT A;  2OQQ A;  1QL2 A;  2Z5H A;  5AVV B;  3PRJ A;  1NWQ A;  3KYQ A;  1CI6 A;  2R44 A;  3EFG A;  2XZR A;  1G2C A;  2JWA A;  1IJD B;  3TGU D;  4I7Z B;  2JP3 A;  1S72 P;  2FYU E;  3RL0 g;  4B86 A;  3WU2 H;  3OJA B;  1N86 A;  1G1J A;  4H44 D;  5KAF H;  4JQ0 D;  2J59 M;  3P8C E;  3B71 A;  1SFC A;  2KLV A;  2ZVO B;  3L70 E;  2W6B A;  1FZC A;  1OW7 A;  1BE3 G;  3H1J D;  1BCC E;  2FYN B;  1PGO A;  4U3F D;  5GTI H;  3ITK A;  1L0L D;  1KB9 H;  3D6Z A;  1S3J A;  1JM0 A;  2P67 A;  1LTJ A;  2AXC A;  5GTH H;  3VYI A;  3RK3 D;  2IBZ D;  1GTW A;  1M56 D;  5AVR B;  2M5A B;  1SQB E;  4NPE A;  1S9K E;  4JYC A;  2KUB A;  1DEB A;  1FZA A;  1NTM J;  3CLQ A;  5H2F E;  2A06 G;  3GLM A;  2XV5 A;  1NTK E;  1RF0 A;  1LGH B;  1T8Z A;  1VQ5 P;  2W6J H;  3CPW O;  1VPC A;  1RE4 C;  3V4W A;  2OYI A;  2WTY A;  2IX7 C;  4W80 A;  3M9B A;  4YTP C;  1LTB C;  1SQV D;  2YXQ B;  3S4R A;  3O6Q A;  1J1E B;  2C9L Y;  1NAF A;  2XND H;  1OW8 A;  1JY3 P;  3L71 J;  3C1L A;  3H1J G;  2JKV A;  3KDP B;  1FZB A;  1NTZ E;  1EZV I;  1PFI A;  1FC2 C;  2JDI H;  3VN0 A;  1EZV G;  3L72 J;  3M0D C;  2IBZ I;  1S1C X;  2JEE A;  3FX0 A;  3H1H D;  2WSE J;  2IBZ G;  3A0B E;  1ZOY C;  1YYC A;  1JY2 O;  4QMA A;  3G6E P; 
#chains in the Genus database with same CATH homology
 1SQV J;  1KB9 I;  3H1H J;  1NTZ J;  1EZV I;  3L70 J;  4D6T J;  1L0L J;  3H1I J;  2FYU J;  3CX5 I;  3H1L J;  3L73 J;  1BCC J;  1NU1 J;  3TGU J;  1SQB J;  1PP9 J;  3CWB J;  1SQQ J;  1L0N J;  3CXH I;  1BGY J;  3L72 J;  2IBZ I;  2BCC J;  1NTM J;  1SQP J;  3H1J J;  4PD4 I;  1SQX J;  4U3F J;  3L75 J;  1BE3 J;  1KYO I;  3L71 J;  3BCC J;  3L74 J;  5KLV J;  1P84 I;  3H1K J;  1NTK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...