1BH3A

E1m, a116k mutant of rh. blastica porin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFKYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
molecule keywords PORIN
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1bh3A00
3UPGA 3POQA 2XE5A 4FMSA 4C69X 4GCQA 3SY7A 3K19A 3HW9A 2Y0HA 3POXA 2J1NA 3T0SA 3EMNX 3SY9A 3SYSA 2QTKA 3FYXA 4RJWA 4LSIA 5FVNA 7PRNA 3PORA 4KR4A 1PRNA 3SZVA 2ODJA 3WI4A 5DL7A 3JTYA 4D64A 1MPFA 4FSOA 3WI5A 4LSHA 4RJXA 1E54A 5JDPA 3VY9X 2XE1A 1PHOA 1GFOA 4D65A 4GCSA 6PRNA 1BH3A 4FSPA 2OMFA 3SYBA 3VZWX 3A2SX 4AUIA 8PRNA 1HXXA 1OSMA 1GFQA 2Y0LA 3VZTX 3O0EA 3T20A 3VY8X 2O4VA 2XE3A 4GCPA 5DL5A 1GFMA 3SZDA 1GFPA 3VZUX 1HXTA 4FRXA 4FRTA 5DL8A 2FGQX 3HWBA 4BUMX 4LSFA 3NSGA 1BT9A 2Y2XA 1GFNA 5PRNA 3POUA 2J4UP 1OPFA 1H6S1 2K4TA 4LSEA 4KRAA 4D5UA 2FGRA 4FT6A 3UU2A 2ZFGA 4KR8A 3PRNA 1HXUA 2XE2A 2ZLDA 4JFBA 2Y0KA 2PRNA 2PORA 4FOZA 5DL6A 3T24A 2XG6A
chains in the Genus database with same CATH superfamily
3UPGA 3A0BO 3KZIO 3POQA 5G3AA 2IWVA 2XE5A 4FMSA 3PQUA 4AKRB 4B61A 4GCQA 2K0LA 4O4XA 1ZHTA 2XTQA 4PUXA 3K19A 4FOZA 5EE2A 2KDYA 3BRYA 3HW9A 4PJ0O 2Y0HA 3DA4A 3BRZA 2YNKA 3JCUO 2J1NA 3POXA 3EMNX 4N58A 1ZHXA 1T16A 3T0SA 3SY9A 3SYSA 4E1TA 2QTKA 4AYMC 2Y7SA 4G76A 3FYXA 3TZGA 4RL9A 4JCHA 4RJWA 5H2FO 4LSIA 2F1VA 4AKRA 4O3WA 5FVNA 7PRNA 3PORA 4KR4A 1PRNA 3AA7A 1QJ8A 3SZVA 5DL6A 3AA1A 2KXPB 4AKMA 2KZ7B 1QJPA 2ODJA 2AXTO 5AFUK 3DA3A 3WI4A 2LFUA 2W81C 1YS5A 4QQ1A 5G26A 5DL7A 3JTYA 4D64A 4O49A 2JQYA 1MPFA 4FSOA 4N59A 1IZNA 3WI5A 4LSHA 1T1LA 4PR7A 2X9KA 4O3XB 4RJXA 2GE4A 5D5DA 4FZMA 1E54A 4FZLA 5G39A 3AAAB 4AYNA 3LK41 3SY7A 3VY9X 5B66O 2XTRA 3PGRA 2W80C 5IYUA 5JDPA 3AA1B 2XE1A 3HOLA 4C69X 3PF1A 1PHOA 4FZNA 4E1SA 1GFOA 3DWOX 3AA0A 3LK42 4O3ZA 3LK2B 2YPVA 4D65A 4GCSA 6PRNA 4N75A 3BS0A 1BH3A 2R89A 2OMFA 4FSPA 5KAFO 3A2SX 3HOEA 3SYBA 3VZWX 4K3BA 4AUIA 4AZLA 5AFUL 8PRNA 4AYID 4UB6O 1HXXA 1OSMA 1GFQA 2Y0LA 4XNLA 3A0HO 3O0EA 3VY8X 3VZTX 3T20A 1G90A 2XMXA 3AA6A 4C00A 2O4VA 2XE3A 4O3YA 3WU2O 4GCPA 4CTDA 5ADXL 3QRCA 1ZHYA 5DL5A 4U9CA 3PGSA 4GHBA 4N74A 5TISO 3DWNA 3GP6A 1GFMA 3PQSA 4IL6O 4XNKA 3SZDA 5KAIO 1GFPA 3VZUX 3KVDD 1HXTA 2KZ7A 4AYDC 2KXPA 4FRXA 4F4BA 4AYEC 4FRTA 4FUVA 2MNHA 3AAEA 4K3CA 5DL8A 2R4LA 2FGQX 1QJ9A 2R4OA 3HWBA 3LK3A 4FQEA 4O4UA 3VE1A 4LSFA 1ZHZA 4BUMX 3NSGA 2M06A 2F1CX 4RLCA 4UB8O 3PGUA 1ORMA 4FESA 3RBHA 5B5EO 1BT9A 3AA6B 4Z3TA 5G38A 2WJRA 1S5LO 2Y2XA 4RLBA 1GFNA 2R4NA 5PRNA 2KC0A 3POUA 2J4UP 1OPFA 2MHLA 1H6S1 1MM5A 3V8UA 5E79O 5ADXK 2K4TA 4LSEA 5GV0A 1BXWA 3AA0B 2N2LA 2R8AA 3C5OA 3LK2A 3QRAA 4KRAA 4AFKA 4D5UA 4GF4A 2F1TA 2FGRA 4FT6A 5T5FA 3NJTA 1THQA 3UU2A 3VE2A 4C4VA 2ZFGA 5GTHO 3AAAA 2X27X 4KR8A 1Q9GA 3PRNA 1HXUA 1MM4A 2XE2A 2ZLDA 4G75A 3G7GA 3UAQA 3LK3B 1IZNB 1ZHWA 2LHFA 2R4PA 5GTIO 2JMMA 3AAEB 2WJQA 4JFBA 2IWWA 2N2MA 1P4TA 2Y0KA 2R88A 2M07A 2PRNA 3DZMA 4C4VB 1Q9FA 2ERVA 2WVPA 2PORA 3AA7B 3T24A 2XG6A
chains in the Genus database with same CATH topology
3UPGA 4AKRB 3POQA 2XE5A 4FMSA 3PQUA 4B61A 4C69X 4GCQA 2K0LA 4O4XA 1ZHTA 2XTQA 4PUXA 3K19A 5EE2A 3SY7A 2KDYA 3HW9A 2Y0HA 3DA4A 2YNKA 3POXA 2J1NA 4N58A 3EMNX 3T0SA 1ZHXA 3SY9A 3SYSA 4E1TA 2QTKA 4AYMC 2Y7SA 4G76A 3FYXA 3TZGA 4RL9A 4JCHA 4RJWA 4LSIA 2F1VA 4AKRA 4O3WA 5FVNA 7PRNA 3PORA 4KR4A 1PRNA 3AA7A 1QJ8A 3SZVA 5DL6A 3AA1A 2KXPB 4AKMA 2KZ7B 1QJPA 2ODJA 5AFUK 3DA3A 3WI4A 2LFUA 2W81C 1YS5A 4QQ1A 5G26A 5DL7A 3JTYA 4D64A 4O49A 1MPFA 4FSOA 4N59A 1IZNA 3WI5A 4LSHA 4RJXA 4O3XB 2GE4A 5D5DA 4FZMA 1E54A 4FZLA 3AAAB 4AYNA 3LK41 5JDPA 3VY9X 2XTRA 2W80C 5IYUA 3AA1B 2XE1A 3HOLA 1PHOA 4FZNA 4E1SA 1GFOA 3AA0A 3LK42 4O3ZA 3LK2B 2YPVA 4D65A 4GCSA 6PRNA 1BH3A 4FSPA 2OMFA 3SYBA 3VZWX 3A2SX 3HOEA 4AUIA 5AFUL 4AZLA 8PRNA 4AYID 1HXXA 1OSMA 1GFQA 2Y0LA 4XNLA 3O0EA 3VZTX 3VY8X 3T20A 1G90A 2XMXA 3AA6A 2O4VA 2XE3A 4O3YA 4GCPA 5ADXL 3QRCA 1ZHYA 5DL5A 4U9CA 4GHBA 3GP6A 1GFMA 3PQSA 4XNKA 3SZDA 1GFPA 3VZUX 3KVDD 1HXTA 2KZ7A 4AYDC 2KXPA 4FRXA 4F4BA 4AYEC 4FRTA 4FUVA 2MNHA 3AAEA 5DL8A 2FGQX 1QJ9A 3HWBA 3LK3A 4O4UA 3VE1A 4BUMX 4LSFA 1ZHZA 3NSGA 2M06A 4RLCA 1ORMA 4FESA 3RBHA 1BT9A 3AA6B 4Z3TA 2Y2XA 4RLBA 1GFNA 5PRNA 2KC0A 3POUA 2J4UP 1OPFA 2MHLA 1H6S1 1MM5A 3V8UA 5ADXK 2K4TA 4LSEA 5GV0A 1BXWA 3AA0B 2N2LA 3C5OA 3LK2A 3QRAA 4KRAA 4AFKA 4D5UA 4GF4A 2F1TA 2FGRA 4FT6A 5T5FA 3VE2A 1THQA 3UU2A 2ZFGA 3AAAA 2X27X 4KR8A 1Q9GA 3PRNA 1HXUA 1MM4A 2XE2A 2ZLDA 4G75A 3G7GA 3UAQA 3LK3B 1IZNB 1ZHWA 2LHFA 2JMMA 3AAEB 4JFBA 2N2MA 1P4TA 2Y0KA 2M07A 2PRNA 1Q9FA 2ERVA 2PORA 4FOZA 3AA7B 3T24A 2XG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UPG A;  3POQ A;  2XE5 A;  4FMS A;  4C69 X;  4GCQ A;  3SY7 A;  3K19 A;  3HW9 A;  2Y0H A;  3POX A;  2J1N A;  3T0S A;  3EMN X;  3SY9 A;  3SYS A;  2QTK A;  3FYX A;  4RJW A;  4LSI A;  5FVN A;  7PRN A;  3POR A;  4KR4 A;  1PRN A;  3SZV A;  2ODJ A;  3WI4 A;  5DL7 A;  3JTY A;  4D64 A;  1MPF A;  4FSO A;  3WI5 A;  4LSH A;  4RJX A;  1E54 A;  5JDP A;  3VY9 X;  2XE1 A;  1PHO A;  1GFO A;  4D65 A;  4GCS A;  6PRN A;  1BH3 A;  4FSP A;  2OMF A;  3SYB A;  3VZW X;  3A2S X;  4AUI A;  8PRN A;  1HXX A;  1OSM A;  1GFQ A;  2Y0L A;  3VZT X;  3O0E A;  3T20 A;  3VY8 X;  2O4V A;  2XE3 A;  4GCP A;  5DL5 A;  1GFM A;  3SZD A;  1GFP A;  3VZU X;  1HXT A;  4FRX A;  4FRT A;  5DL8 A;  2FGQ X;  3HWB A;  4BUM X;  4LSF A;  3NSG A;  1BT9 A;  2Y2X A;  1GFN A;  5PRN A;  3POU A;  2J4U P;  1OPF A;  1H6S 1;  2K4T A;  4LSE A;  4KRA A;  4D5U A;  2FGR A;  4FT6 A;  3UU2 A;  2ZFG A;  4KR8 A;  3PRN A;  1HXU A;  2XE2 A;  2ZLD A;  4JFB A;  2Y0K A;  2PRN A;  2POR A;  4FOZ A;  5DL6 A;  3T24 A;  2XG6 A; 
#chains in the Genus database with same CATH topology
 3UPG A;  3A0B O;  3KZI O;  3POQ A;  5G3A A;  2IWV A;  2XE5 A;  4FMS A;  3PQU A;  4AKR B;  4B61 A;  4GCQ A;  2K0L A;  4O4X A;  1ZHT A;  2XTQ A;  4PUX A;  3K19 A;  4FOZ A;  5EE2 A;  2KDY A;  3BRY A;  3HW9 A;  4PJ0 O;  2Y0H A;  3DA4 A;  3BRZ A;  2YNK A;  3JCU O;  2J1N A;  3POX A;  3EMN X;  4N58 A;  1ZHX A;  1T16 A;  3T0S A;  3SY9 A;  3SYS A;  4E1T A;  2QTK A;  4AYM C;  2Y7S A;  4G76 A;  3FYX A;  3TZG A;  4RL9 A;  4JCH A;  4RJW A;  5H2F O;  4LSI A;  2F1V A;  4AKR A;  4O3W A;  5FVN A;  7PRN A;  3POR A;  4KR4 A;  1PRN A;  3AA7 A;  1QJ8 A;  3SZV A;  5DL6 A;  3AA1 A;  2KXP B;  4AKM A;  2KZ7 B;  1QJP A;  2ODJ A;  2AXT O;  5AFU K;  3DA3 A;  3WI4 A;  2LFU A;  2W81 C;  1YS5 A;  4QQ1 A;  5G26 A;  5DL7 A;  3JTY A;  4D64 A;  4O49 A;  2JQY A;  1MPF A;  4FSO A;  4N59 A;  1IZN A;  3WI5 A;  4LSH A;  1T1L A;  4PR7 A;  2X9K A;  4O3X B;  4RJX A;  2GE4 A;  5D5D A;  4FZM A;  1E54 A;  4FZL A;  5G39 A;  3AAA B;  4AYN A;  3LK4 1;  3SY7 A;  3VY9 X;  5B66 O;  2XTR A;  3PGR A;  2W80 C;  5IYU A;  5JDP A;  3AA1 B;  2XE1 A;  3HOL A;  4C69 X;  3PF1 A;  1PHO A;  4FZN A;  4E1S A;  1GFO A;  3DWO X;  3AA0 A;  3LK4 2;  4O3Z A;  3LK2 B;  2YPV A;  4D65 A;  4GCS A;  6PRN A;  4N75 A;  3BS0 A;  1BH3 A;  2R89 A;  2OMF A;  4FSP A;  5KAF O;  3A2S X;  3HOE A;  3SYB A;  3VZW X;  4K3B A;  4AUI A;  4AZL A;  5AFU L;  8PRN A;  4AYI D;  4UB6 O;  1HXX A;  1OSM A;  1GFQ A;  2Y0L A;  4XNL A;  3A0H O;  3O0E A;  3VY8 X;  3VZT X;  3T20 A;  1G90 A;  2XMX A;  3AA6 A;  4C00 A;  2O4V A;  2XE3 A;  4O3Y A;  3WU2 O;  4GCP A;  4CTD A;  5ADX L;  3QRC A;  1ZHY A;  5DL5 A;  4U9C A;  3PGS A;  4GHB A;  4N74 A;  5TIS O;  3DWN A;  3GP6 A;  1GFM A;  3PQS A;  4IL6 O;  4XNK A;  3SZD A;  5KAI O;  1GFP A;  3VZU X;  3KVD D;  1HXT A;  2KZ7 A;  4AYD C;  2KXP A;  4FRX A;  4F4B A;  4AYE C;  4FRT A;  4FUV A;  2MNH A;  3AAE A;  4K3C A;  5DL8 A;  2R4L A;  2FGQ X;  1QJ9 A;  2R4O A;  3HWB A;  3LK3 A;  4FQE A;  4O4U A;  3VE1 A;  4LSF A;  1ZHZ A;  4BUM X;  3NSG A;  2M06 A;  2F1C X;  4RLC A;  4UB8 O;  3PGU A;  1ORM A;  4FES A;  3RBH A;  5B5E O;  1BT9 A;  3AA6 B;  4Z3T A;  5G38 A;  2WJR A;  1S5L O;  2Y2X A;  4RLB A;  1GFN A;  2R4N A;  5PRN A;  2KC0 A;  3POU A;  2J4U P;  1OPF A;  2MHL A;  1H6S 1;  1MM5 A;  3V8U A;  5E79 O;  5ADX K;  2K4T A;  4LSE A;  5GV0 A;  1BXW A;  3AA0 B;  2N2L A;  2R8A A;  3C5O A;  3LK2 A;  3QRA A;  4KRA A;  4AFK A;  4D5U A;  4GF4 A;  2F1T A;  2FGR A;  4FT6 A;  5T5F A;  3NJT A;  1THQ A;  3UU2 A;  3VE2 A;  4C4V A;  2ZFG A;  5GTH O;  3AAA A;  2X27 X;  4KR8 A;  1Q9G A;  3PRN A;  1HXU A;  1MM4 A;  2XE2 A;  2ZLD A;  4G75 A;  3G7G A;  3UAQ A;  3LK3 B;  1IZN B;  1ZHW A;  2LHF A;  2R4P A;  5GTI O;  2JMM A;  3AAE B;  2WJQ A;  4JFB A;  2IWW A;  2N2M A;  1P4T A;  2Y0K A;  2R88 A;  2M07 A;  2PRN A;  3DZM A;  4C4V B;  1Q9F A;  2ERV A;  2WVP A;  2POR A;  3AA7 B;  3T24 A;  2XG6 A; 
#chains in the Genus database with same CATH homology
 3UPG A;  4AKR B;  3POQ A;  2XE5 A;  4FMS A;  3PQU A;  4B61 A;  4C69 X;  4GCQ A;  2K0L A;  4O4X A;  1ZHT A;  2XTQ A;  4PUX A;  3K19 A;  5EE2 A;  3SY7 A;  2KDY A;  3HW9 A;  2Y0H A;  3DA4 A;  2YNK A;  3POX A;  2J1N A;  4N58 A;  3EMN X;  3T0S A;  1ZHX A;  3SY9 A;  3SYS A;  4E1T A;  2QTK A;  4AYM C;  2Y7S A;  4G76 A;  3FYX A;  3TZG A;  4RL9 A;  4JCH A;  4RJW A;  4LSI A;  2F1V A;  4AKR A;  4O3W A;  5FVN A;  7PRN A;  3POR A;  4KR4 A;  1PRN A;  3AA7 A;  1QJ8 A;  3SZV A;  5DL6 A;  3AA1 A;  2KXP B;  4AKM A;  2KZ7 B;  1QJP A;  2ODJ A;  5AFU K;  3DA3 A;  3WI4 A;  2LFU A;  2W81 C;  1YS5 A;  4QQ1 A;  5G26 A;  5DL7 A;  3JTY A;  4D64 A;  4O49 A;  1MPF A;  4FSO A;  4N59 A;  1IZN A;  3WI5 A;  4LSH A;  4RJX A;  4O3X B;  2GE4 A;  5D5D A;  4FZM A;  1E54 A;  4FZL A;  3AAA B;  4AYN A;  3LK4 1;  5JDP A;  3VY9 X;  2XTR A;  2W80 C;  5IYU A;  3AA1 B;  2XE1 A;  3HOL A;  1PHO A;  4FZN A;  4E1S A;  1GFO A;  3AA0 A;  3LK4 2;  4O3Z A;  3LK2 B;  2YPV A;  4D65 A;  4GCS A;  6PRN A;  1BH3 A;  4FSP A;  2OMF A;  3SYB A;  3VZW X;  3A2S X;  3HOE A;  4AUI A;  5AFU L;  4AZL A;  8PRN A;  4AYI D;  1HXX A;  1OSM A;  1GFQ A;  2Y0L A;  4XNL A;  3O0E A;  3VZT X;  3VY8 X;  3T20 A;  1G90 A;  2XMX A;  3AA6 A;  2O4V A;  2XE3 A;  4O3Y A;  4GCP A;  5ADX L;  3QRC A;  1ZHY A;  5DL5 A;  4U9C A;  4GHB A;  3GP6 A;  1GFM A;  3PQS A;  4XNK A;  3SZD A;  1GFP A;  3VZU X;  3KVD D;  1HXT A;  2KZ7 A;  4AYD C;  2KXP A;  4FRX A;  4F4B A;  4AYE C;  4FRT A;  4FUV A;  2MNH A;  3AAE A;  5DL8 A;  2FGQ X;  1QJ9 A;  3HWB A;  3LK3 A;  4O4U A;  3VE1 A;  4BUM X;  4LSF A;  1ZHZ A;  3NSG A;  2M06 A;  4RLC A;  1ORM A;  4FES A;  3RBH A;  1BT9 A;  3AA6 B;  4Z3T A;  2Y2X A;  4RLB A;  1GFN A;  5PRN A;  2KC0 A;  3POU A;  2J4U P;  1OPF A;  2MHL A;  1H6S 1;  1MM5 A;  3V8U A;  5ADX K;  2K4T A;  4LSE A;  5GV0 A;  1BXW A;  3AA0 B;  2N2L A;  3C5O A;  3LK2 A;  3QRA A;  4KRA A;  4AFK A;  4D5U A;  4GF4 A;  2F1T A;  2FGR A;  4FT6 A;  5T5F A;  3VE2 A;  1THQ A;  3UU2 A;  2ZFG A;  3AAA A;  2X27 X;  4KR8 A;  1Q9G A;  3PRN A;  1HXU A;  1MM4 A;  2XE2 A;  2ZLD A;  4G75 A;  3G7G A;  3UAQ A;  3LK3 B;  1IZN B;  1ZHW A;  2LHF A;  2JMM A;  3AAE B;  4JFB A;  2N2M A;  1P4T A;  2Y0K A;  2M07 A;  2PRN A;  1Q9F A;  2ERV A;  2POR A;  4FOZ A;  3AA7 B;  3T24 A;  2XG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...