1BH3A

E1m, a116k mutant of rh. blastica porin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFKYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
molecule keywords PORIN
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1bh3A00
4D5UA 4FMSA 3FYXA 3JTYA 5PRNA 1GFOA 5DL6A 4C69X 4JFBA 1HXUA 2FGRA 3SY7A 2FGQX 3SY9A 3HW9A 2Y2XA 4KR8A 8PRNA 5DL8A 4D65A 5DL7A 3O0EA 3POXA 3VY9X 1HXTA 1HXXA 3POQA 3POUA 5JDPA 4FRXA 1GFPA 2ZFGA 1GFNA 3T20A 2OMFA 2Y0LA 4BUMX 1H6S1 4RJWA 3WI4A 4FSOA 2K4TA 4RJXA 3SYSA 1PRNA 1E54A 2XE1A 4LSHA 2PORA 3SYBA 2ODJA 2O4VA 3T24A 1OPFA 4KR4A 2Y0HA 4FSPA 1OSMA 4KRAA 4FOZA 1MPFA 3EMNX 3NSGA 3T0SA 2PRNA 7PRNA 3HWBA 3WI5A 4GCPA 4GCSA 3UU2A 4LSFA 3A2SX 3VZUX 3VZWX 2XE2A 2XE3A 2Y0KA 1GFQA 5FVNA 2XG6A 4D64A 2QTKA 4FRTA 2ZLDA 1BH3A 3VZTX 3SZDA 3PORA 6PRNA 3SZVA 1BT9A 2J1NA 4AUIA 3PRNA 3VY8X 2XE5A 1GFMA 2J4UP 4LSIA 5DL5A 3K19A 4FT6A 1PHOA 4GCQA 4LSEA 3UPGA
chains in the Genus database with same CATH superfamily
4D5UA 1Q9FA 3G7GA 1P4TA 1T1LA 3NJTA 4FMSA 3FYXA 2XTQA 3PGUA 3AA1B 3BS0A 4AYEC 3JTYA 2MNHA 3QRCA 4E1SA 5PRNA 2M06A 1GFOA 2MHLA 5DL6A 5KAFO 4C69X 5ADXL 4JFBA 4UB8O 5GTHO 4AKRA 1HXUA 3AAEA 2F1CX 3A0HO 2FGRA 3AA7A 3KZIO 4GHBA 1MM5A 2W80C 2X27X 4PJ0O 3SY7A 2FGQX 3DZMA 3SY9A 4RLBA 4JCHA 4C00A 2F1TA 3AA1A 5TISO 3HW9A 2Y2XA 2F1VA 4KR8A 8PRNA 3AAAA 5DL8A 4PR7A 4D65A 3LK2B 4XNLA 2R4PA 4QQ1A 5DL7A 4UB6O 3O0EA 3POXA 4K3CA 1HXTA 1ORMA 3AA0B 3PQUA 1HXXA 3POQA 3VY9X 3POUA 5JDPA 1G90A 3WU2O 3DA4A 4O3YA 5ADXK 4FRXA 1GFPA 2ZFGA 3UAQA 4GF4A 1GFNA 2N2LA 4FZMA 1QJ9A 2KDYA 4AYID 3T20A 2AXTO 2R8AA 2OMFA 1ZHTA 2IWWA 2Y0LA 3BRYA 3LK3B 4BUMX 1H6S1 1MM4A 4RJWA 4FUVA 3WI4A 2K0LA 4FSOA 4IL6O 2K4TA 4AZLA 4RJXA 5G3AA 3SYSA 4B61A 1PRNA 2XE1A 3GP6A 2GE4A 2IWVA 2PORA 2ODJA 4LSHA 2O4VA 5KAIO 3RBHA 3SYBA 4FZLA 4AYDC 4AFKA 3A0BO 2R89A 3BRZA 4K3BA 1IZNA 2JMMA 1IZNB 3LK42 2X9KA 4N59A 5G39A 4O4XA 3T24A 5GTIO 2WJQA 1OPFA 1QJPA 4KR4A 5E79O 2ERVA 4N74A 2Y0HA 4FSPA 1OSMA 4KRAA 2WJRA 4FOZA 4PUXA 5EE2A 3V8UA 3DWNA 1MPFA 3VE2A 4XNKA 5IYUA 4U9CA 4G75A 4N75A 4O3WA 3EMNX 3NSGA 4O4UA 2R88A 2YPVA 3PGSA 4C4VA 3AAEB 3JCUO 5B5EO 5T5FA 3T0SA 2PRNA 4AYNA 7PRNA 3HWBA 4FZNA 2XMXA 3WI5A 4AKMA 3PF1A 4GCPA 4GCSA 3AA0A 4G76A 2LFUA 3KVDD 3LK41 1ZHWA 1Q9GA 3LK2A 1S5LO 4N58A 3UU2A 1ZHXA 1YS5A 4LSFA 3A2SX 3C5OA 3VZUX 5H2FO 2W81C 4FESA 1QJ8A 2KZ7A 3QRAA 2N2MA 2XE2A 3PQSA 3HOEA 5G26A 2XE3A 2Y0KA 3VZWX 4F4BA 1T16A 4RL9A 3LK3A 1GFQA 2WVPA 3AAAB 5FVNA 5B66O 2KZ7B 2XG6A 5AFUK 3AA6A 2R4OA 2QTKA 3AA7B 4FRTA 2YNKA 2ZLDA 1BH3A 3DA3A 1ZHZA 3SZDA 3PORA 2KXPB 3VZTX 4D64A 2R4NA 6PRNA 2LHFA 2JQYA 4LSEA 3DWOX 3SZVA 1BXWA 4CTDA 4E1TA 1BT9A 2J1NA 2KXPA 2R4LA 1ZHYA 3HOLA 1THQA 2XTRA 4O3ZA 2Y7SA 3PRNA 4AUIA 3VY8X 2KC0A 2XE5A 3AA6B 1GFMA 3PGRA 4AKRB 4FQEA 4C4VB 4LSIA 2J4UP 4RLCA 4O49A 5D5DA 4O3XB 5DL5A 3K19A 3TZGA 3VE1A 5GV0A 4Z3TA 5G38A 2M07A 1PHOA 4FT6A 4GCQA 4AYMC 5AFUL 1E54A 3UPGA
chains in the Genus database with same CATH topology
4D5UA 1Q9FA 3G7GA 1P4TA 4FMSA 3FYXA 2XTQA 3AA1B 4AYEC 3JTYA 2MNHA 3QRCA 4E1SA 5PRNA 2M06A 1GFOA 2MHLA 5DL6A 4C69X 5ADXL 4JFBA 1HXUA 3AAEA 4GHBA 4RLCA 2FGRA 3AA7A 3SY7A 1MM5A 2W80C 2X27X 2FGQX 3SY9A 4RLBA 4JCHA 2F1TA 3AA1A 3HW9A 2Y2XA 2F1VA 4KR8A 8PRNA 3AAAA 5DL8A 4D65A 3LK2B 4XNLA 4QQ1A 5DL7A 3O0EA 3POXA 3VY9X 1HXTA 1ORMA 3AA0B 3PQUA 1HXXA 3POQA 3POUA 5JDPA 1G90A 3DA4A 4O3YA 5ADXK 4FRXA 1GFPA 2ZFGA 3UAQA 4GF4A 1GFNA 2N2LA 4FZMA 1QJ9A 2KDYA 4AYID 3T20A 2OMFA 1ZHTA 2Y0LA 3LK3B 4BUMX 1H6S1 1MM4A 4RJWA 4FUVA 3WI4A 2K0LA 4FSOA 2K4TA 4AZLA 4RJXA 3SYSA 4B61A 1PRNA 2XE1A 3GP6A 2GE4A 2PORA 4LSHA 2ODJA 3RBHA 2O4VA 3SYBA 4FZLA 4AYDC 4AFKA 1IZNA 2JMMA 1IZNB 3LK42 4N59A 4O4XA 3T24A 1OPFA 1QJPA 4KR4A 2ERVA 2Y0HA 4FSPA 1OSMA 4KRAA 4FOZA 4PUXA 5EE2A 3V8UA 1MPFA 3VE2A 4XNKA 5IYUA 4U9CA 4G75A 4O3WA 3EMNX 3NSGA 4O4UA 2YPVA 3AAEB 5T5FA 3T0SA 2PRNA 4AYNA 7PRNA 3HWBA 4FZNA 2XMXA 3WI5A 4AKMA 4GCPA 4GCSA 3AA0A 4G76A 2LFUA 3KVDD 3LK41 1ZHWA 1Q9GA 3LK2A 4N58A 3UU2A 1ZHXA 1YS5A 4LSFA 3A2SX 3C5OA 3VZUX 2W81C 4FESA 1QJ8A 2KZ7A 3QRAA 2N2MA 2XE2A 3PQSA 3HOEA 5G26A 2XE3A 2Y0KA 3VZWX 4F4BA 4RL9A 3LK3A 1GFQA 3AAAB 5FVNA 2KZ7B 2XG6A 5AFUK 3AA6A 4AKRA 2QTKA 3AA7B 4FRTA 2YNKA 2ZLDA 1BH3A 3DA3A 1ZHZA 3SZDA 3PORA 2KXPB 3VZTX 4D64A 6PRNA 2LHFA 4LSEA 3SZVA 1BXWA 4E1TA 1BT9A 2J1NA 2KXPA 1ZHYA 3HOLA 1THQA 2XTRA 4O3ZA 2Y7SA 3PRNA 4AUIA 3VY8X 2KC0A 2XE5A 3AA6B 1GFMA 4AKRB 2J4UP 4LSIA 4O49A 5D5DA 4O3XB 5DL5A 3K19A 3TZGA 3VE1A 5GV0A 4Z3TA 2M07A 1PHOA 4FT6A 4GCQA 4AYMC 5AFUL 1E54A 3UPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D5U A;  4FMS A;  3FYX A;  3JTY A;  5PRN A;  1GFO A;  5DL6 A;  4C69 X;  4JFB A;  1HXU A;  2FGR A;  3SY7 A;  2FGQ X;  3SY9 A;  3HW9 A;  2Y2X A;  4KR8 A;  8PRN A;  5DL8 A;  4D65 A;  5DL7 A;  3O0E A;  3POX A;  3VY9 X;  1HXT A;  1HXX A;  3POQ A;  3POU A;  5JDP A;  4FRX A;  1GFP A;  2ZFG A;  1GFN A;  3T20 A;  2OMF A;  2Y0L A;  4BUM X;  1H6S 1;  4RJW A;  3WI4 A;  4FSO A;  2K4T A;  4RJX A;  3SYS A;  1PRN A;  1E54 A;  2XE1 A;  4LSH A;  2POR A;  3SYB A;  2ODJ A;  2O4V A;  3T24 A;  1OPF A;  4KR4 A;  2Y0H A;  4FSP A;  1OSM A;  4KRA A;  4FOZ A;  1MPF A;  3EMN X;  3NSG A;  3T0S A;  2PRN A;  7PRN A;  3HWB A;  3WI5 A;  4GCP A;  4GCS A;  3UU2 A;  4LSF A;  3A2S X;  3VZU X;  3VZW X;  2XE2 A;  2XE3 A;  2Y0K A;  1GFQ A;  5FVN A;  2XG6 A;  4D64 A;  2QTK A;  4FRT A;  2ZLD A;  1BH3 A;  3VZT X;  3SZD A;  3POR A;  6PRN A;  3SZV A;  1BT9 A;  2J1N A;  4AUI A;  3PRN A;  3VY8 X;  2XE5 A;  1GFM A;  2J4U P;  4LSI A;  5DL5 A;  3K19 A;  4FT6 A;  1PHO A;  4GCQ A;  4LSE A;  3UPG A; 
#chains in the Genus database with same CATH topology
 4D5U A;  1Q9F A;  3G7G A;  1P4T A;  1T1L A;  3NJT A;  4FMS A;  3FYX A;  2XTQ A;  3PGU A;  3AA1 B;  3BS0 A;  4AYE C;  3JTY A;  2MNH A;  3QRC A;  4E1S A;  5PRN A;  2M06 A;  1GFO A;  2MHL A;  5DL6 A;  5KAF O;  4C69 X;  5ADX L;  4JFB A;  4UB8 O;  5GTH O;  4AKR A;  1HXU A;  3AAE A;  2F1C X;  3A0H O;  2FGR A;  3AA7 A;  3KZI O;  4GHB A;  1MM5 A;  2W80 C;  2X27 X;  4PJ0 O;  3SY7 A;  2FGQ X;  3DZM A;  3SY9 A;  4RLB A;  4JCH A;  4C00 A;  2F1T A;  3AA1 A;  5TIS O;  3HW9 A;  2Y2X A;  2F1V A;  4KR8 A;  8PRN A;  3AAA A;  5DL8 A;  4PR7 A;  4D65 A;  3LK2 B;  4XNL A;  2R4P A;  4QQ1 A;  5DL7 A;  4UB6 O;  3O0E A;  3POX A;  4K3C A;  1HXT A;  1ORM A;  3AA0 B;  3PQU A;  1HXX A;  3POQ A;  3VY9 X;  3POU A;  5JDP A;  1G90 A;  3WU2 O;  3DA4 A;  4O3Y A;  5ADX K;  4FRX A;  1GFP A;  2ZFG A;  3UAQ A;  4GF4 A;  1GFN A;  2N2L A;  4FZM A;  1QJ9 A;  2KDY A;  4AYI D;  3T20 A;  2AXT O;  2R8A A;  2OMF A;  1ZHT A;  2IWW A;  2Y0L A;  3BRY A;  3LK3 B;  4BUM X;  1H6S 1;  1MM4 A;  4RJW A;  4FUV A;  3WI4 A;  2K0L A;  4FSO A;  4IL6 O;  2K4T A;  4AZL A;  4RJX A;  5G3A A;  3SYS A;  4B61 A;  1PRN A;  2XE1 A;  3GP6 A;  2GE4 A;  2IWV A;  2POR A;  2ODJ A;  4LSH A;  2O4V A;  5KAI O;  3RBH A;  3SYB A;  4FZL A;  4AYD C;  4AFK A;  3A0B O;  2R89 A;  3BRZ A;  4K3B A;  1IZN A;  2JMM A;  1IZN B;  3LK4 2;  2X9K A;  4N59 A;  5G39 A;  4O4X A;  3T24 A;  5GTI O;  2WJQ A;  1OPF A;  1QJP A;  4KR4 A;  5E79 O;  2ERV A;  4N74 A;  2Y0H A;  4FSP A;  1OSM A;  4KRA A;  2WJR A;  4FOZ A;  4PUX A;  5EE2 A;  3V8U A;  3DWN A;  1MPF A;  3VE2 A;  4XNK A;  5IYU A;  4U9C A;  4G75 A;  4N75 A;  4O3W A;  3EMN X;  3NSG A;  4O4U A;  2R88 A;  2YPV A;  3PGS A;  4C4V A;  3AAE B;  3JCU O;  5B5E O;  5T5F A;  3T0S A;  2PRN A;  4AYN A;  7PRN A;  3HWB A;  4FZN A;  2XMX A;  3WI5 A;  4AKM A;  3PF1 A;  4GCP A;  4GCS A;  3AA0 A;  4G76 A;  2LFU A;  3KVD D;  3LK4 1;  1ZHW A;  1Q9G A;  3LK2 A;  1S5L O;  4N58 A;  3UU2 A;  1ZHX A;  1YS5 A;  4LSF A;  3A2S X;  3C5O A;  3VZU X;  5H2F O;  2W81 C;  4FES A;  1QJ8 A;  2KZ7 A;  3QRA A;  2N2M A;  2XE2 A;  3PQS A;  3HOE A;  5G26 A;  2XE3 A;  2Y0K A;  3VZW X;  4F4B A;  1T16 A;  4RL9 A;  3LK3 A;  1GFQ A;  2WVP A;  3AAA B;  5FVN A;  5B66 O;  2KZ7 B;  2XG6 A;  5AFU K;  3AA6 A;  2R4O A;  2QTK A;  3AA7 B;  4FRT A;  2YNK A;  2ZLD A;  1BH3 A;  3DA3 A;  1ZHZ A;  3SZD A;  3POR A;  2KXP B;  3VZT X;  4D64 A;  2R4N A;  6PRN A;  2LHF A;  2JQY A;  4LSE A;  3DWO X;  3SZV A;  1BXW A;  4CTD A;  4E1T A;  1BT9 A;  2J1N A;  2KXP A;  2R4L A;  1ZHY A;  3HOL A;  1THQ A;  2XTR A;  4O3Z A;  2Y7S A;  3PRN A;  4AUI A;  3VY8 X;  2KC0 A;  2XE5 A;  3AA6 B;  1GFM A;  3PGR A;  4AKR B;  4FQE A;  4C4V B;  4LSI A;  2J4U P;  4RLC A;  4O49 A;  5D5D A;  4O3X B;  5DL5 A;  3K19 A;  3TZG A;  3VE1 A;  5GV0 A;  4Z3T A;  5G38 A;  2M07 A;  1PHO A;  4FT6 A;  4GCQ A;  4AYM C;  5AFU L;  1E54 A;  3UPG A; 
#chains in the Genus database with same CATH homology
 4D5U A;  1Q9F A;  3G7G A;  1P4T A;  4FMS A;  3FYX A;  2XTQ A;  3AA1 B;  4AYE C;  3JTY A;  2MNH A;  3QRC A;  4E1S A;  5PRN A;  2M06 A;  1GFO A;  2MHL A;  5DL6 A;  4C69 X;  5ADX L;  4JFB A;  1HXU A;  3AAE A;  4GHB A;  4RLC A;  2FGR A;  3AA7 A;  3SY7 A;  1MM5 A;  2W80 C;  2X27 X;  2FGQ X;  3SY9 A;  4RLB A;  4JCH A;  2F1T A;  3AA1 A;  3HW9 A;  2Y2X A;  2F1V A;  4KR8 A;  8PRN A;  3AAA A;  5DL8 A;  4D65 A;  3LK2 B;  4XNL A;  4QQ1 A;  5DL7 A;  3O0E A;  3POX A;  3VY9 X;  1HXT A;  1ORM A;  3AA0 B;  3PQU A;  1HXX A;  3POQ A;  3POU A;  5JDP A;  1G90 A;  3DA4 A;  4O3Y A;  5ADX K;  4FRX A;  1GFP A;  2ZFG A;  3UAQ A;  4GF4 A;  1GFN A;  2N2L A;  4FZM A;  1QJ9 A;  2KDY A;  4AYI D;  3T20 A;  2OMF A;  1ZHT A;  2Y0L A;  3LK3 B;  4BUM X;  1H6S 1;  1MM4 A;  4RJW A;  4FUV A;  3WI4 A;  2K0L A;  4FSO A;  2K4T A;  4AZL A;  4RJX A;  3SYS A;  4B61 A;  1PRN A;  2XE1 A;  3GP6 A;  2GE4 A;  2POR A;  4LSH A;  2ODJ A;  3RBH A;  2O4V A;  3SYB A;  4FZL A;  4AYD C;  4AFK A;  1IZN A;  2JMM A;  1IZN B;  3LK4 2;  4N59 A;  4O4X A;  3T24 A;  1OPF A;  1QJP A;  4KR4 A;  2ERV A;  2Y0H A;  4FSP A;  1OSM A;  4KRA A;  4FOZ A;  4PUX A;  5EE2 A;  3V8U A;  1MPF A;  3VE2 A;  4XNK A;  5IYU A;  4U9C A;  4G75 A;  4O3W A;  3EMN X;  3NSG A;  4O4U A;  2YPV A;  3AAE B;  5T5F A;  3T0S A;  2PRN A;  4AYN A;  7PRN A;  3HWB A;  4FZN A;  2XMX A;  3WI5 A;  4AKM A;  4GCP A;  4GCS A;  3AA0 A;  4G76 A;  2LFU A;  3KVD D;  3LK4 1;  1ZHW A;  1Q9G A;  3LK2 A;  4N58 A;  3UU2 A;  1ZHX A;  1YS5 A;  4LSF A;  3A2S X;  3C5O A;  3VZU X;  2W81 C;  4FES A;  1QJ8 A;  2KZ7 A;  3QRA A;  2N2M A;  2XE2 A;  3PQS A;  3HOE A;  5G26 A;  2XE3 A;  2Y0K A;  3VZW X;  4F4B A;  4RL9 A;  3LK3 A;  1GFQ A;  3AAA B;  5FVN A;  2KZ7 B;  2XG6 A;  5AFU K;  3AA6 A;  4AKR A;  2QTK A;  3AA7 B;  4FRT A;  2YNK A;  2ZLD A;  1BH3 A;  3DA3 A;  1ZHZ A;  3SZD A;  3POR A;  2KXP B;  3VZT X;  4D64 A;  6PRN A;  2LHF A;  4LSE A;  3SZV A;  1BXW A;  4E1T A;  1BT9 A;  2J1N A;  2KXP A;  1ZHY A;  3HOL A;  1THQ A;  2XTR A;  4O3Z A;  2Y7S A;  3PRN A;  4AUI A;  3VY8 X;  2KC0 A;  2XE5 A;  3AA6 B;  1GFM A;  4AKR B;  2J4U P;  4LSI A;  4O49 A;  5D5D A;  4O3X B;  5DL5 A;  3K19 A;  3TZG A;  3VE1 A;  5GV0 A;  4Z3T A;  2M07 A;  1PHO A;  4FT6 A;  4GCQ A;  4AYM C;  5AFU L;  1E54 A;  3UPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...