1BHEA

Polygalacturonase from erwinia carotovora ssp. carotovora
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
376
structure length
376
Chain Sequence
SDSRTVSEPKTPSSCTTLKADSSTATSTIQKALNNCDQGKAVRLSAGSTSVFLSGPLSLPSGVSLLIDKGVTLRAVNNAKSFENAPSSCGVVDKNGKGCDAFITAVSTTNSGIYGPGTIDGQGGVKLQDKKVSWWELAADAKVKKLKQNTPRLIQINKSKNFTLYNVSLINSPNFHVVFSDGDGFTAWKTTIKTPSTARNTDGIDPMSSKNITIAYSNIATGDDNVAIKAYKGRAETRNISILHNDFGTGHGMSIGSETMGVYNVTVDDLKMNGTTNGLRIKSDKSAAGVVNGVRYSNVVMKNVAKPIVIDTVYEKKEGSNVPDWSDITFKDVTSETKGVVVLNGENAKKPIEVTMKNVKLTSDSTWQIKNVNVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLYGALACTURONASE
publication title Crystal structure of polygalacturonase from Erwinia carotovora ssp. carotovora.
pubmed doi rcsb
source organism Pectobacterium carotovorum subsp. carotovorum
molecule tags Glycosidase
total genus 152
structure length 376
sequence length 376
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 1998-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1bheA00
1O8KA 3SUCA 1OGOX 1O8JA 2PECA 4XLCA 4YZ0A 2PYHA 1O8GA 5C1CA 1PE9A 1VBLA 4XKWA 3EQNA 3GRHA 1O8LA 4HWVA 2X3HA 4OJLA 2O0WA 1EE6A 3KRGA 4EW9A 4Z03A 1BN8A 2X85A 1RWRA 2NTQA 1DBGA 2NTPA 1PLUA 2PYGA 3B4NA 4XNFA 2EWEA 1IDKA 3VSTA 1O8DA 2UVEA 1OGMX 4W8QA 4XLHA 1KCDA 1QJVA 4C2LA 1DBOA 2INUA 3ZPPA 1RU4A 3ZSCA 2VJIA 3VMVA 1WMRA 4XLFA 4YZQA 1IA5A 1AIRA 4OZYA 4W8RA 2NSTA 4AVZA 2BSPA 4YELA 4XMYA 1O88A 1K5CA 1RMGA 4NK6A 4XN3A 2INVA 3GQ9A 1OOCA 1JTAA 1O8MA 4XQFA 3VSVA 2X6YA 1O8HA 5C1EA 1O8FA 4XL9A 1H80A 3EQOA 4Z05A 4XKVA 4W8TA 3GQAA 3JURA 4OJOA 2ODLA 1KTWA 1BHEA 2O04A 4URRA 2O1DA 3UW0A 1O8IA 1PXZA 2QX3A 4OJ5A 2O0VA 2VBKA 2X6XA 4MR0A 4XLEA 1O8EA 3B90A 4OZZA 3FY3A 4YZXA 2NTBA 2X6WA 1X0CA 4PMHA 4XR6A 4NK8A 1CZFA 2VJJA 4XM3A 1HG8A 3WWGA 1IDJA 4XN0A 2VBMA 1GQ8A 1XG2A 2NSPA 4MXNA 1NHCA 4XORA 2VBEA 5AMVA 4XOTA 2QXZA 4OJ6A 4XONA 2IQ7A 3LMWA 1OFMA 3B8YA 2NT9A 2QY1A 1KCCA 4YZAA 4I84A 3VSUA 3T9GA 1QCXA 2Z8GA 1OFLA 2NT6A 2O17A 3GQ8A 4XLAA 3VMWA 4U4BA 2UVFA 4Z06A 2NZMA 4U49A 4W8SA 3GQ7A 4XOPA 1JRGA 1IB4A 4YEJA 4OJPA
chains in the Genus database with same CATH superfamily
1O8KA 3SUCA 4OM9A 1OGOX 1O8JA 2PECA 3BH7B 4XLCA 2PYHA 1O8GA 1TYWA 4YZ0A 5C1CA 1QA1A 1PE9A 1VBLA 4XKWA 2J8KA 3EQNA 3GRHA 1O8LA 4HWVA 2BM4A 2X3HA 4OJLA 2O0WA 1EE6A 3KRGA 3LJYA 4EW9A 3ML3A 3PETA 4Z03A 1BN8A 2X85A 1RWRA 2NTQA 4YCQA 1CLWA 1DBGA 2BM5A 1PLUA 2NTPA 2PYGA 3B4NA 2EWEA 4XNFA 5JLVC 1TSPA 2XC1A 1EA0A 1IDKA 3VSTA 1O8DA 1OFDA 3BH6B 2UVEA 3TH0A 1OGMX 4W8QA 4XLHA 1KCDA 1QJVA 4C2LA 1LLWA 3N6ZA 1DBOA 1KQ5A 2INUA 2XTXA 3ZPPA 1RU4A 3ZSCA 2VJIA 2XT4A 3SYJA 3VMVA 2VFOA 1WMRA 4XLFA 1QA3A 2BX6A 4YZQA 1IA5A 3N90A 1AIRA 4OZYA 4W8RA 2NSTA 4AVZA 2BM7A 3RIQA 2BSPA 3LYCA 4YELA 4XMYA 1O88A 1DABA 1K5CA 1RMGA 4NK6A 4XN3A 2INVA 3GQ9A 3SQVA 3NB2A 1OOCA 1WXRA 1JTAA 1O8MA 4XQFA 2W7ZA 3VSVA 2X6YA 1QRBA 1L1IA 1O8HA 1LM1A 2F3LA 5C1EA 1O8FA 4XL9A 1H80A 1HF2A 2VFMA 3EQOA 4Z05A 3SZEA 4XKVA 4W8TA 3GQAA 3DU1X 3SY2A 3JURA 2G0YA 4OJOA 1OFEA 2ODLA 1KTWA 2XTWA 1BHEA 2O04A 2YUHA 2O1DA 4V02C 4URRA 3UW0A 1TYVA 1O8IA 1PXZA 2QX3A 2XTYA 1QA2A 4OJ5A 2O0VA 2VBKA 2X6XA 4MR0A 4XLEA 1O8EA 3B90A 4OZZA 3FY3A 4YZXA 2NTBA 2X6WA 1TYUA 2VFNA 1X0CA 4KH3A 4PMHA 4XR6A 1TYXA 4NK8A 1CZFA 2B0RA 2VJJA 3NAWA 3PSZA 4XM3A 1HG8A 2VFQA 2XT2A 3P4GA 3WWGA 1IDJA 4YDTA 4XN0A 2VBMA 5JMCB 3AK5A 1EZGA 1XG2A 1GQ8A 2NSPA 3JX8A 4MXNA 1NHCA 1QQ1A 2BM6A 1LLZA 4XORA 2VBEA 5AMVA 4OPWA 4XOTA 2QXZA 2QZAA 2V5IA 4OJ6A 4XONA 2IQ7A 3LMWA 4YFOA 1OFMA 3B8YA 2NT9A 2QY1A 1KCCA 4YZAA 4I84A 4YC5A 3VSUA 2J8IA 1K4ZA 1K8FA 5DNSA 3T9GA 1QCXA 2Z8GA 1OFLA 2NT6A 2O17A 3GQ8A 4XLAA 3PSSA 3VMWA 1QRCA 4U4BA 3H09A 2QYUA 2UVFA 2IOUG 4Z06A 4YEIA 2NZMA 4U49A 4W8SA 2O6WA 3GQ7A 4XOPA 1JRGA 1IB4A 4YEJA 2VFPA 4JRAC 4OJPA
chains in the Genus database with same CATH topology
1O8KA 3SUCA 1OGOX 1O8JA 2PECA 4XLCA 4YZ0A 2PYHA 1O8GA 5C1CA 1PE9A 1VBLA 4XKWA 3EQNA 3GRHA 1O8LA 4HWVA 2X3HA 4OJLA 2O0WA 1EE6A 3KRGA 4EW9A 4Z03A 1BN8A 2X85A 1RWRA 2NTQA 1DBGA 2NTPA 1PLUA 2PYGA 3B4NA 4XNFA 2EWEA 1IDKA 3VSTA 1O8DA 2UVEA 1OGMX 4W8QA 4XLHA 1KCDA 1QJVA 4C2LA 1DBOA 2INUA 3ZPPA 1RU4A 3ZSCA 2VJIA 3VMVA 1WMRA 4XLFA 4YZQA 1IA5A 1AIRA 4OZYA 4W8RA 2NSTA 4AVZA 2BSPA 4YELA 4XMYA 1O88A 1K5CA 1RMGA 4NK6A 4XN3A 2INVA 3GQ9A 1OOCA 1JTAA 1O8MA 4XQFA 3VSVA 2X6YA 1O8HA 5C1EA 1O8FA 4XL9A 1H80A 3EQOA 4Z05A 4XKVA 4W8TA 3GQAA 3JURA 4OJOA 2ODLA 1KTWA 1BHEA 2O04A 4URRA 2O1DA 3UW0A 1O8IA 1PXZA 2QX3A 4OJ5A 2O0VA 2VBKA 2X6XA 4MR0A 4XLEA 1O8EA 3B90A 4OZZA 3FY3A 4YZXA 2NTBA 2X6WA 1X0CA 4PMHA 4XR6A 4NK8A 1CZFA 2VJJA 4XM3A 1HG8A 3WWGA 1IDJA 4XN0A 2VBMA 1GQ8A 1XG2A 2NSPA 4MXNA 1NHCA 4XORA 2VBEA 5AMVA 4XOTA 2QXZA 4OJ6A 4XONA 2IQ7A 3LMWA 1OFMA 3B8YA 2NT9A 2QY1A 1KCCA 4YZAA 4I84A 3VSUA 3T9GA 1QCXA 2Z8GA 1OFLA 2NT6A 2O17A 3GQ8A 4XLAA 3VMWA 4U4BA 2UVFA 4Z06A 2NZMA 4U49A 4W8SA 3GQ7A 4XOPA 1JRGA 1IB4A 4YEJA 4OJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8K A;  3SUC A;  1OGO X;  1O8J A;  2PEC A;  4XLC A;  4YZ0 A;  2PYH A;  1O8G A;  5C1C A;  1PE9 A;  1VBL A;  4XKW A;  3EQN A;  3GRH A;  1O8L A;  4HWV A;  2X3H A;  4OJL A;  2O0W A;  1EE6 A;  3KRG A;  4EW9 A;  4Z03 A;  1BN8 A;  2X85 A;  1RWR A;  2NTQ A;  1DBG A;  2NTP A;  1PLU A;  2PYG A;  3B4N A;  4XNF A;  2EWE A;  1IDK A;  3VST A;  1O8D A;  2UVE A;  1OGM X;  4W8Q A;  4XLH A;  1KCD A;  1QJV A;  4C2L A;  1DBO A;  2INU A;  3ZPP A;  1RU4 A;  3ZSC A;  2VJI A;  3VMV A;  1WMR A;  4XLF A;  4YZQ A;  1IA5 A;  1AIR A;  4OZY A;  4W8R A;  2NST A;  4AVZ A;  2BSP A;  4YEL A;  4XMY A;  1O88 A;  1K5C A;  1RMG A;  4NK6 A;  4XN3 A;  2INV A;  3GQ9 A;  1OOC A;  1JTA A;  1O8M A;  4XQF A;  3VSV A;  2X6Y A;  1O8H A;  5C1E A;  1O8F A;  4XL9 A;  1H80 A;  3EQO A;  4Z05 A;  4XKV A;  4W8T A;  3GQA A;  3JUR A;  4OJO A;  2ODL A;  1KTW A;  1BHE A;  2O04 A;  4URR A;  2O1D A;  3UW0 A;  1O8I A;  1PXZ A;  2QX3 A;  4OJ5 A;  2O0V A;  2VBK A;  2X6X A;  4MR0 A;  4XLE A;  1O8E A;  3B90 A;  4OZZ A;  3FY3 A;  4YZX A;  2NTB A;  2X6W A;  1X0C A;  4PMH A;  4XR6 A;  4NK8 A;  1CZF A;  2VJJ A;  4XM3 A;  1HG8 A;  3WWG A;  1IDJ A;  4XN0 A;  2VBM A;  1GQ8 A;  1XG2 A;  2NSP A;  4MXN A;  1NHC A;  4XOR A;  2VBE A;  5AMV A;  4XOT A;  2QXZ A;  4OJ6 A;  4XON A;  2IQ7 A;  3LMW A;  1OFM A;  3B8Y A;  2NT9 A;  2QY1 A;  1KCC A;  4YZA A;  4I84 A;  3VSU A;  3T9G A;  1QCX A;  2Z8G A;  1OFL A;  2NT6 A;  2O17 A;  3GQ8 A;  4XLA A;  3VMW A;  4U4B A;  2UVF A;  4Z06 A;  2NZM A;  4U49 A;  4W8S A;  3GQ7 A;  4XOP A;  1JRG A;  1IB4 A;  4YEJ A;  4OJP A; 
#chains in the Genus database with same CATH topology
 1O8K A;  3SUC A;  4OM9 A;  1OGO X;  1O8J A;  2PEC A;  3BH7 B;  4XLC A;  2PYH A;  1O8G A;  1TYW A;  4YZ0 A;  5C1C A;  1QA1 A;  1PE9 A;  1VBL A;  4XKW A;  2J8K A;  3EQN A;  3GRH A;  1O8L A;  4HWV A;  2BM4 A;  2X3H A;  4OJL A;  2O0W A;  1EE6 A;  3KRG A;  3LJY A;  4EW9 A;  3ML3 A;  3PET A;  4Z03 A;  1BN8 A;  2X85 A;  1RWR A;  2NTQ A;  4YCQ A;  1CLW A;  1DBG A;  2BM5 A;  1PLU A;  2NTP A;  2PYG A;  3B4N A;  2EWE A;  4XNF A;  5JLV C;  1TSP A;  2XC1 A;  1EA0 A;  1IDK A;  3VST A;  1O8D A;  1OFD A;  3BH6 B;  2UVE A;  3TH0 A;  1OGM X;  4W8Q A;  4XLH A;  1KCD A;  1QJV A;  4C2L A;  1LLW A;  3N6Z A;  1DBO A;  1KQ5 A;  2INU A;  2XTX A;  3ZPP A;  1RU4 A;  3ZSC A;  2VJI A;  2XT4 A;  3SYJ A;  3VMV A;  2VFO A;  1WMR A;  4XLF A;  1QA3 A;  2BX6 A;  4YZQ A;  1IA5 A;  3N90 A;  1AIR A;  4OZY A;  4W8R A;  2NST A;  4AVZ A;  2BM7 A;  3RIQ A;  2BSP A;  3LYC A;  4YEL A;  4XMY A;  1O88 A;  1DAB A;  1K5C A;  1RMG A;  4NK6 A;  4XN3 A;  2INV A;  3GQ9 A;  3SQV A;  3NB2 A;  1OOC A;  1WXR A;  1JTA A;  1O8M A;  4XQF A;  2W7Z A;  3VSV A;  2X6Y A;  1QRB A;  1L1I A;  1O8H A;  1LM1 A;  2F3L A;  5C1E A;  1O8F A;  4XL9 A;  1H80 A;  1HF2 A;  2VFM A;  3EQO A;  4Z05 A;  3SZE A;  4XKV A;  4W8T A;  3GQA A;  3DU1 X;  3SY2 A;  3JUR A;  2G0Y A;  4OJO A;  1OFE A;  2ODL A;  1KTW A;  2XTW A;  1BHE A;  2O04 A;  2YUH A;  2O1D A;  4V02 C;  4URR A;  3UW0 A;  1TYV A;  1O8I A;  1PXZ A;  2QX3 A;  2XTY A;  1QA2 A;  4OJ5 A;  2O0V A;  2VBK A;  2X6X A;  4MR0 A;  4XLE A;  1O8E A;  3B90 A;  4OZZ A;  3FY3 A;  4YZX A;  2NTB A;  2X6W A;  1TYU A;  2VFN A;  1X0C A;  4KH3 A;  4PMH A;  4XR6 A;  1TYX A;  4NK8 A;  1CZF A;  2B0R A;  2VJJ A;  3NAW A;  3PSZ A;  4XM3 A;  1HG8 A;  2VFQ A;  2XT2 A;  3P4G A;  3WWG A;  1IDJ A;  4YDT A;  4XN0 A;  2VBM A;  5JMC B;  3AK5 A;  1EZG A;  1XG2 A;  1GQ8 A;  2NSP A;  3JX8 A;  4MXN A;  1NHC A;  1QQ1 A;  2BM6 A;  1LLZ A;  4XOR A;  2VBE A;  5AMV A;  4OPW A;  4XOT A;  2QXZ A;  2QZA A;  2V5I A;  4OJ6 A;  4XON A;  2IQ7 A;  3LMW A;  4YFO A;  1OFM A;  3B8Y A;  2NT9 A;  2QY1 A;  1KCC A;  4YZA A;  4I84 A;  4YC5 A;  3VSU A;  2J8I A;  1K4Z A;  1K8F A;  5DNS A;  3T9G A;  1QCX A;  2Z8G A;  1OFL A;  2NT6 A;  2O17 A;  3GQ8 A;  4XLA A;  3PSS A;  3VMW A;  1QRC A;  4U4B A;  3H09 A;  2QYU A;  2UVF A;  2IOU G;  4Z06 A;  4YEI A;  2NZM A;  4U49 A;  4W8S A;  2O6W A;  3GQ7 A;  4XOP A;  1JRG A;  1IB4 A;  4YEJ A;  2VFP A;  4JRA C;  4OJP A; 
#chains in the Genus database with same CATH homology
 1O8K A;  3SUC A;  1OGO X;  1O8J A;  2PEC A;  4XLC A;  4YZ0 A;  2PYH A;  1O8G A;  5C1C A;  1PE9 A;  1VBL A;  4XKW A;  3EQN A;  3GRH A;  1O8L A;  4HWV A;  2X3H A;  4OJL A;  2O0W A;  1EE6 A;  3KRG A;  4EW9 A;  4Z03 A;  1BN8 A;  2X85 A;  1RWR A;  2NTQ A;  1DBG A;  2NTP A;  1PLU A;  2PYG A;  3B4N A;  4XNF A;  2EWE A;  1IDK A;  3VST A;  1O8D A;  2UVE A;  1OGM X;  4W8Q A;  4XLH A;  1KCD A;  1QJV A;  4C2L A;  1DBO A;  2INU A;  3ZPP A;  1RU4 A;  3ZSC A;  2VJI A;  3VMV A;  1WMR A;  4XLF A;  4YZQ A;  1IA5 A;  1AIR A;  4OZY A;  4W8R A;  2NST A;  4AVZ A;  2BSP A;  4YEL A;  4XMY A;  1O88 A;  1K5C A;  1RMG A;  4NK6 A;  4XN3 A;  2INV A;  3GQ9 A;  1OOC A;  1JTA A;  1O8M A;  4XQF A;  3VSV A;  2X6Y A;  1O8H A;  5C1E A;  1O8F A;  4XL9 A;  1H80 A;  3EQO A;  4Z05 A;  4XKV A;  4W8T A;  3GQA A;  3JUR A;  4OJO A;  2ODL A;  1KTW A;  1BHE A;  2O04 A;  4URR A;  2O1D A;  3UW0 A;  1O8I A;  1PXZ A;  2QX3 A;  4OJ5 A;  2O0V A;  2VBK A;  2X6X A;  4MR0 A;  4XLE A;  1O8E A;  3B90 A;  4OZZ A;  3FY3 A;  4YZX A;  2NTB A;  2X6W A;  1X0C A;  4PMH A;  4XR6 A;  4NK8 A;  1CZF A;  2VJJ A;  4XM3 A;  1HG8 A;  3WWG A;  1IDJ A;  4XN0 A;  2VBM A;  1GQ8 A;  1XG2 A;  2NSP A;  4MXN A;  1NHC A;  4XOR A;  2VBE A;  5AMV A;  4XOT A;  2QXZ A;  4OJ6 A;  4XON A;  2IQ7 A;  3LMW A;  1OFM A;  3B8Y A;  2NT9 A;  2QY1 A;  1KCC A;  4YZA A;  4I84 A;  3VSU A;  3T9G A;  1QCX A;  2Z8G A;  1OFL A;  2NT6 A;  2O17 A;  3GQ8 A;  4XLA A;  3VMW A;  4U4B A;  2UVF A;  4Z06 A;  2NZM A;  4U49 A;  4W8S A;  3GQ7 A;  4XOP A;  1JRG A;  1IB4 A;  4YEJ A;  4OJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...