1BHJA

Crystal structure of apo-glycine n-methyltransferase (gnmt)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
292
structure length
292
Chain Sequence
VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGAGRDGAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of apo-glycine N-methyltransferase (GNMT).
pubmed rcsb
source organism Rattus norvegicus
molecule tags Methyltransferase
molecule keywords GLYCINE N-METHYLTRANSFERASE
total genus 68
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 1998-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 1bhjA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1bhjA02
1NBHA 3I9FA 2Q41A 3M6VA 3B3GA 1RJEA 1N2XA 3I53A 2IBTA 7MHTA 2FK7A 3FRIA 1D2HA 4CKBA 2YTZA 1TW3A 1EJ0A 3HTXA 1JTFA 2BR3A 4XCXA 5GP1A 2AOTA 2JH9A 3GGDA 5DSXA 2NYUA 1YB2A 3CC8A 3KQVA 1P1BA 3QOXA 2PXAA 2ZTHA 2G71A 3UJDA 4P7GA 1HMYA 2OB2A 3A26A 4HSGA 5CVJA 2CWWA 2WK1A 5EGSA 5ICGA 5E2BA 4CWAA 4C08A 3R9XB 3HA7A 5CVEA 3ME5A 2PY6A 2G8NA 3BKXA 3EVDA 3FUWA 4RX1A 1AF7A 2BR5A 4YV2A 1JG1A 4RTLA 5F2KA 4PYLA 4BP3A 5P8WA 2AZTA 1G60A 3P9CA 1FBNA 2AOWA 4DCMA 2NP7A 2JHAA 3FYCA 4CTKA 3B3JA 3FPFA 3ID6C 2FYTA 1O54A 1INLA 4FZVA 2JJQA 1QAQA 1RI1A 4H0NA 5EPEA 3AY0A 1PRYA 2YQZA 3UA3A 3M70A 2FPOA 4KDRA 4BP1A 1L3IA 5K0CA 2HR1A 3LECA 2FCAA 4GEKA 5CUQA 4X1OA 1L3BA 2GPYA 3G2PA 3OPNA 3FTEA 3LDGA 5DX1A 4FS8A 5EKXA 2JH8A 4KIGA 4YUVA 1D2GA 5BXYA 2IFTA 2PWYA 4RWZA 4HG2A 2FRXA 1VL5A 3PX2A 3V8VA 1JSXA 1NW8A 2ZLBA 3PX3A 2QYOA 4FSXA 2IH4A 5C9ZA 3G5LA 1ZG3A 4IWNA 2BZGA 3A7EA 4HGYA 3VSEA 2PV0A 4YUYA 1IY9A 4E2XA 1QYRA 3LSTA 4FT4A 3KQMA 4HTFB 4M36A 3EVBA 2YUIA 4LECA 5BW5A 5E9WA 3KPWA 1KPHA 1VE3A 2EG5A 3FUUA 3KR9A 4RTNA 3DOUA 4IKPA 3NJRA 2ZZKA 3KPYA 3NW9A 3ELWA 4OBWA 1EG2A 4GOND 3JWIA 1VP9A 2V7EA 5EC8A 2YR0A 4C05A 3FTDA 5F2OA 2FHPA 2ZWVA 2AOUA 3LDUA 1R00A 5CIYA 1WXXA 3R24A 1VQ1A 3R3HA 5EMJA 1X1DA 3EVEA 5DRYA 1ZGJA 5JUWA 2YXDA 2GH1A 3K6RA 4XUCA 4DCGA 4YV1A 3ER8A 3PS9A 3KHKA 2C7PA 3KPUA 4GUAA 2C7QA 2ONZA 4ATNA 1DL5A 5DTRA 2OY0A 4E2YA 1JQDA 1NW6A 4YUZA 4P58A 1Z3CA 5CCXA 4MTLA 5GM1A 1QZZA 4U7PB 4Y2HA 5MHTA 2A14A 2UYQA 3GRZA 3IV6A 3GU3A 4ER5A 4F85A 3HP7A 3G88A 2OBFA 1KYZA 2R6ZA 2YXEA 1I9GA 2JHPA 4GC9A 3PLAE 1RI4A 5FQOA 2HNKA 4XUEA 1O9HA 1ORHA 3C3PA 4XUDA 4P7FA 2OB1A 3BXOA 3DTNA 2PT9A 5F2NA 3FPGA 1JR4A 1G6Q1 3WSTA 5E2AA 2CKDA 2ZZMA 2E5WA 5K0BA 3DR5A 3DMFA 4PCLA 1BOOA 2ZBRA 3IEIA 3NWBA 3EGIA 3THSA 3LKDA 3DH0A 4QTUB 3UZUA 3QV2A 1X19A 2PWPA 3D2LA 3DLCA 4BLUA 5KS2A 5H02A 5E9QA 3SSNA 3UBTA 3I58A 2WA2A 5G02A 1RJFA 2UYOA 4RVDA 3FRHA 5HOQA 3K0BA 3A25A 2I7CA 1XDZA 3FZGA 3EVCA 2GAFA 3LBFA 3P9NA 2JHCA 2HMYB 1XCLA 2I62A 2QM3A 3B3FA 3G2QA 4FSDA 5E1OA 3TPZA 1KXZA 4KVZA 3A7DA 2BM8A 3EGEA 1NW3A 2IDKA 2OYRA 3TR6A 2UZ4A 1WZNA 4FGZA 3EEYA 5EIFA 4CTJA 1MJFA 3AXSA 2P35A 3SR4A 3SX0A 4UOEA 3PT9A 4CXMA 4FR0A 1MHTA 3LHDA 3HEMA 3DULA 2EX4A 1WXWA 3KQPA 4HTFA 4MIKA 1VIDA 3DMHA 2IH5A 1AQIA 1JSZA 3C6MA 3KPJA 5EG5A 5EQJB 3P9KA 4R6WA 4CKEA 2K4MA 5K0FA 5LQKA 1YF3A 4GOLD 4YMHA 1SQGA 3KQWA 3OFJA 2WA1A 1X1CA 4Y30A 5EKUA 3DXYA 3NDJA 4YUXA 4V0QA 2O57A 5CVDA 3UWPA 4RVHA 4AZVA 3L8DA 5LR6A 1FP1D 3UJ6A 1PJZA 3KR0A 4E31A 3BGDA 1WG8A 3GRVA 3OE4A 5EHGA 3BZBA 4MWZA 3HVJA 3FTFA 5FHQA 2PSSA 5M5BA 5T64A 3AXTA 4NECA 1NKVA 5DT2A 5LQJA 2CMHA 2IIPA 2ZW9A 4RYLA 4RTKA 1L9KA 3C6KA 5DPMA 2Z6UA 3OZSA 2XYRA 2IDJA 2P3LA 3GCZA 3MGGA 4HGZA 1YFLA 3DMGA 1FP2A 1RJGA 4KW7A 3A27A 3OE5A 3KQQA 4GBED 3NWEA 2QE6A 3FPHA 3KKZA 3M33A 3P2KA 5KYGA 5T67A 4RV9A 4RSRA 2VP3A 1KP9A 1QAMA 5DM4A 3G8BA 2OPBA 2NXJA 1B42A 1TW2A 1X1AA 1NBIA 3HA5A 3MERA 1BHJA 4ISCA 4YV0A 2AVDA 5LQRA 5GINE 1VBFA 4OBXA 2EFJA 2ZBPA 3T7SA 3T7TA 5CCBA 4GC5A 4L7VA 5GOZA 1WY7A 3UJ7A 4RTPA 2B25A 2P40A 3TMAA 1Q0SA 5K0EA 4EKIA 2PXCA 3BWYA 3LL7A 3U81A 1L1EA 1FJXA 3B5IA 2JG3A 1VLMA 1YZHA 3KQSA 5GIOE 2PJDA 3HCAA 3DXZA 3MCZA 3RODA 5HIKA 3EMBA 1SVUA 1VPTA 3P2EA 3V97A 3Q87B 2VDWA 3H2BA 2I9KA 5EEGA 3FUVA 4LWOA 2ADMA 3MTIA 3T0IA 2GB4A 1G8AA 3PB3A 1V39A 4QTTB 1R8XA 2NNWB 5DXJA 2LD4A 3M6XA 3M4XA 4QDKA 4E2ZA 3T7RA 2PKWA 2AN4A 1XXLA 4C06A 3HCDA 1G38A 1KPGA 3EVZA 1SG9A 3OCJA 3RW9A 4QPPA 4YMGA 5ERGB 5K8VA 3P9IA 2H1RA 3G8AA 2NXCA 2G70A 4X61A 4DF3A 2B2CA 3NMUF 3SSOA 4MHTA 3M6UA 1N7IA 3F4KA 1JQ3A 3TQSA 5E1DA 2ONYA 5DX0A 3SM3A 3I64A 4EMSA 3CGGA 5FHRA 3MCTA 5FADA 1SUIA 3CJTA 3CKKA 4BLVA 2PX4A 5ICCA 3UA4A 2VZ9A 2ZIFA 3GO4A 3HVIA 3LKZA 3M6WA 4PYNA 5E1BA 5HIMA 3OU7A 5K0JA 3RIEA 4OX9Y 3E05A 3ELYA 2PXXA 4EVIA 4POOA 3PFHA 3EVFA 3LX6A 3VC1A 3FPEA 4E33A 2ESRA 5FWAA 4AZWA 1AV6A 2B78A 5T6BA 5LQUA 4RVGA 3LCUA 3KQOA 3E7PA 3FUTA 4PYQA 5HZMA 4RTSA 5ICFA 3UJ8A 4EKGA 5GM2A 1ORIA 4ER7A 1EAMA 4DM3A 5EZSA 1IM8A 1EQAA 4KDCA 4MQ4A 3NVKI 3THRA 3G2OA 2EJUA 2XBMA 5KVAA 5E8JA 2XVMA 4ZTBA 2ZSUA 2ZCJA 2IP2A 2CL5A 4FP9A 5EMLA 1ZQ9A 1KIAA 4WXHA 5D1HA 1QANA 4RTQA 4RTRA 2CMGA 3I5UA 3G2MA 1DUSA 4PCAA 3JWGA 4RVFA 3UJAA 3C0KA 5GIPE 5K0LA 3C3YA 3GRUA 1M0EA 1EIZA 1M6EX 2H11A 5DTMA 4ER3A 1RJDA 1KR5A 2ZWAA 2ZZNA 1N7JA 3TM5A 3BKWA 3A4TA 5IKMA 4PIMA 1JQEA 3DP7A 4DKJA 3GJYA 3IYLW 3R6TA 3SXJA 2EJTA 3OU2A 5K09A 3EVAA 2P3OA 2O0LA 3KR1A 3BGVA 5IH3A 2VDUE 5FUBA 1SQFA 5DM2A 3TKAA 3GXOA 3G89A 3LGAA 5HIIA 5EIWA 5C0OE 1WS6A 3GNLA 1R18A 4A6DA 3ER9A 2ZIEA 5K01A 2P41A 5EZQA 3TLJA 4AZSA 2N47A 3CVOA 2HWKA 4PONA 3CJQA 4A6EA 4DZRA 2XVAA 3FYDA 1QAOA 2Y1XA 5ICEA 5CVUA 1ZHFA 5FQNA 5EMMA 1R74A 1X1BA 3JWJA 2V74B 4PYIA 5DXAA 5FULA 4DQ0A 2Z6QA 3O4FA 3P97A 3UJ9A 2VS1A 4O29A 3SVZA 4GOMD 4BLWA 5HFJA 4F86A 4M7RA 3Q7EA 1Q0TA 4ER0A 1UFKA 2P3QA 4QPNA 8MHTA 4E70A 1R6AA 2DPMA 1F3LA 2B9EA 2HTEA 2PGXA 4PGGA 1BC5A 1D2CA 3HCEA 5FWDA 3KPVA 2O07A 3BT7A 2AOUB 4HH4A 2PX5A 5DWQA 3G7UA 1YZ3A 5DSTA 1P91A 5FCDA 4C07A 1M6YA 3GRRA 3MB5A 2ZFUA 5C1IA 4ER6A 4P7KA 5DM1A 1YUBA 3HVKA 2IBSA 3MQ2A 3R0QA 5E1MA 4DA4A 4C4AA 4BY9E 3EMDA 3SGLA 2ERCA 1XDUA 2GLUA 4PYMA 2AVNA 3FTCA 3CBGA 3LCCA 4EQZA 2XYVA 4RTOA 5DLYA 2BM9A 3X0DA 1JTEA 3P8ZA 2QY6A 1G8SA 5HEKA 3KQYA 1P39A 2AOVA 2F8LA 5KQSA 2P7HA 2AR0A 2PLWA 5LQNA 1UIRA 3HNRA 4KIFA 3GRYA 3E8SA 2OKCA 1RI5A 1IXKA 5FA5A 9MHTA 1KYWA 1XDSA 4JXJA 4PIPA 3ORHA 2Z6AA 4B17A 1EJ6A 3BWMA 2AN3A 1NT2A 1JG3A 3P71T 4PNEA 2P8JA 3GWZA 3UJCA 2H00A 3ELDA 2ZBQA 4LG1A 3DXXA 3VC2A 2IH2A 1JG4A 4GOOD 1XJ5A 2IPXA 4U7TB 2NP6A 2O06A 4K6MA 4R8RA 5B1SA 3UFBA 4AZTA 1NW7A 3CJRA 3NVMB 3EVGA 5FA8A 3EPPA 3O7WA 1SUSA 4IV8A 3BWCA 3TFWA 4WVLA 3OFKA 2HV9A 2VDVE 2NXNA 4OQDA 5DM0A 2PT6A 3O31A 2P1DA 2OZVA 5KQRA 3IHTA 5CVVA 2NXEA 3GIWA 5LQAA 4PINA 1I4WA 3LPMA 4Z2YA 1XTPA 5EMKA 1FPQA 5EVJA 4CKCA 3EEOA 4PYKA 1NV9A 3AWIA 1U2ZA 4DMGA 3PFGA 5HIJA 2PX2A 3GDHA 2QRVA 4E32A 5LQCA 5BP7A 3PTAA 2C7RA 2ORED 3EGVA 5GWXA 3G5TA 3SMQA 5LSAA 3KQTA 2FK8A 3CCFA 4KRGA 1YFJA 2AOTB 5EOVA 2UYCA 3VYWA 2YVLA 3AJDA 1H1DA 1Y8CA 3DLIA 4LWPA 3MAGA 1NV8A 2OO3A 5EHIA 4C03A 4V0RA 1I1NA 1P1CA 4R05A 2O05A 1G55A 4F84A 2C7OA 3NDIA 4QQKA 5CM2Z 3TKYA 3UJBA 5JR3A 1KHHA 3DUWA 3BUSA 1O9GA 1XVAA 3OU6A 4X63A 5E9JA 3B89A 4QVGA 5DRTA 4YUWA 4QVKA 5DTQA 1AQJA 3P2IA 2G1PA 3JWHA 3FUXA 5D1NA 5EEHA 3S68A 3E23A 2AS0A 2AOXA 3TRKA 4RTJA 4IV0A 1RI2A 1VP3A 4QDJA 5K03A 1OR8A 2ZIGA 3HM2A 3ELUA 4P7JA 4OA5A 5HILA 4E30A 4G56A 3B7PA 3KR2A 4QQNA 3LDFA 5FTWA 3FPJA 10MHA 3KU1A 1XCJA 3BWBA 1RI3A 2ZVJA 2UYHA 3REOA 3NTVA 3LBYA 4C04A 2PBFA 2XYQA 5CD1A 1TPYA 4R8SA 4E2WA 4AUKA 3LCVB 3MTEA 4RTMA 2B3TA 3QOWA 4EK9A 2GA9A 4PYOA 2GS9A 1HNNA 3MHTA 4KWCA 4OA8A 2AN5A 3OZRA 3TOSA 1JG2A 4GQBA 1DCTA 3BGIA 3SSMA 2Y1WA 2KW5A 2QRVB 2IGTA 2ZULA 1F38A 4R6XA 1UWVA 3HA3A 3TM4A 5E8RA 2R3SA 2PVCA 3OZTA 2BH2A 4HRAA 1NW5A 2DULA 4X41A 2BR4A 4PYJA 2PX8A 1T43A 3PVCA 4HC4A 3ANXA 1BKYA 3HCFA 4OQEA 1ZGAA 5DX8A 5K0GA 3ERCA 2YX1A 3HCBA 4M37A 1NE2A 4AX8A 2I6GA 4PWYA 2YXLA 4GF5A 5K05A 1KPIA 2P7IA 4X60A 5U4XA 4M38A 4PGHA 1ZKDA 4FT2A 5K0NA 2OXTA 5BW4A 3HVHA 1SKMA 3HCCA 1L3CA 1R8YA 2G72A
chains in the Genus database with same CATH superfamily
1L1RA 3OIYA 1NBHA 1IK4A 3GGGA 3I9FA 1TYCA 1WB5A 1E5QA 2DKOA 3B3GA 3EG9B 1CY7A 3HZRA 4PG4A 3GA5A 3TNJA 3UAYA 4Q3EA 3LC1O 3TLGB 1ETUA 5BWBA 3M4JA 1NJFA 1Y5RA 2ZUDA 4YQEA 4XCXA 3GGDA 1FEZA 1EA5A 3TJRA 2OFFA 1TU3A 2ODTX 2PRKA 4JR2A 4YFYA 1H4SA 1Z0UA 3P9XA 1VIMA 2X7XA 5HF8A 4TMWA 1ZK2A 2QSZA 5L53A 1MRSA 2JVJA 2FCRA 1FP4B 1W88A 2ATXA 2RH5A 2Z3VA 3GNTA 2DQYA 5ICGA 1EX1A 1CP3A 3T3OA 3FHCB 2FJ0A 4FFRA 4IH4A 3P45A 4RK0A 3K71B 1DINA 4PQGA 4D97A 1WEKA 2Q2WA 1JECA 1LA2A 2J3IA 1Q6ZA 4BP3A 1R4MA 1M0TA 3MINA 4YJ2F 4UTVA 2EW8A 4NCXA 1TUGA 4B6OA 2B4AA 3WL8A 1IHXA 3BL8A 4MKHA 3LY9A 3RPEA 2P30A 2XX3A 3VKUA 4DEYA 1NVTA 2HADA 5C8XA 4PZYA 2XCTB 2JLSA 4TWRA 3FPFA 4YMUA 2XA2A 1PR4A 1SC3A 3QLUC 1YJXA 2G63A 1GRVA 1HK7A 1E9CA 2J9ZB 1QAQA 3K4HA 4L4YA 4Q02A 4N3CA 3RV4A 5AVTA 1J4AA 1Q1AA 1ZD2P 1CVLA 3ZQUA 4C7JA 3K2IA 1C3OB 2FUG1 3V1KA 5LVAA 1DZ3A 3JVDA 4MB0A 4X64B 2OXFA 2AFIA 3K92A 3Q3EA 2C92A 4TRJA 5C1OA 4MUYA 3G2PA 1F17A 4G0PA 4XDZA 3KUKA 4B35A 3OPNA 4BJ5A 4F6CA 3NASA 2CUNA 3JPWA 3GVPA 3HKBA 3ICPA 3H2ZA 4UHKA 5DN9A 2ZK7A 2PL1A 5A4JA 2PZGA 3F4LA 3GBSA 4RFVA 4ZAZA 3T7AA 2IXDA 4HY3A 1QGUA 1QGOA 3CZMA 3L1VA 4BMCA 3TDKA 5IHXA 3HZZA 2JGRA 3ZDYB 4NV0A 4FW9A 2OAP1 4R7GA 3WV5A 3CKYA 4JB3A 3GH1A 1KPHA 1U0SY 2JFXA 3KE9A 3KR9A 3GAAA 3DOUA 5LYJA 5C7OO 3JQRA 1VLZA 1QCZA 4KKXB 1P5RA 4MJXA 3TBFA 2PGOA 1ECGA 4RK6A 5G40A 1NI5A 4I4NA 4R8KA 5CYOA 3AYZB 1M0SA 4P8RA 3OQVA 3WBBA 5FPSA 1ZKMA 1DQNA 4CUJA 2NSYA 4HB3A 5BSUA 4B73A 1KAGA 4QHYA 1JKIA 1OWNA 1ZBQA 2JBAB 1VQ1A 3DT6A 2VHUA 2UUAB 3PFKA 3JSXA 1NA5A 1H0KA 1ZGJA 2BI4A 2L69A 3OI7A 4ITUA 1JLHA 1JJ7A 3B6IA 4P6VF 1M10A 1JHQA 2O5RA 2PGNA 1WUYA 2QSJA 2L2QA 3DXFA 3OPMA 2JJ1A 4KYIB 3F7MA 3W2GA 1SBZA 3IMCA 4IQGA 5DBFA 1E1DA 1RLUA 4Y2HA 1ZVVA 4ER5A 1OHHD 1IPFA 3N5KA 3FW1A 3MMXA 2C2HA 1YGPA 2JLRA 2ZYGA 3NV9A 3C15C 4IPTA 4XGRA 4BB9A 3F7NA 2Y0DA 1FDIA 2YN2A 4L8FA 1NRJB 4M6WB 4PQEA 4UREA 4JI0B 1LV8A 1Z5UA 2HNKA 2C5FA 3OZFA 2IPAB 5L3QA 1X2BA 2WNIA 1ORHA 1XB2A 4ASUD 1DDIA 3LZ6A 4UUBA 1Y8QA 1J99A 1OI4A 5K0SA 1RXEA 3LU1A 3RSQA 4BUCA 3WVNA 2O50A 2WZQA 2ZIUB 3RF6A 2COKA 4IXMA 4QZVA 1O8BA 1OAKA 1PT9A 2DCMA 1K6EA 3N0VA 4WQMA 4UE6A 4J7CA 2ZWIA 1YS1X 3QV2A 1SVMA 3T9AA 1KDTA 3G2KA 2R7LA 2CFSA 1W85A 2R68A 4WKOA 3EGWA 4MUBA 1NXPA 1PWEA 1PT6A 2BJHA 2XUZA 3FFBA 4MW6A 2YFHA 1GPWB 1JVNA 4JVNA 3ZX4A 3DKVA 4QNNA 4ZJZA 3PCTA 3L4BC 4KI7A 4MO9A 3H4TA 2JIQA 4MCJA 4D02A 4GSYA 5C37A 4GQIA 2P6UA 4URXR 1ISJA 4TVOA 2E1RA 2H7YA 3QWFA 3EXIB 4LPKA 4R1SA 3WZMA 5BR7A 2H9AA 5K0FA 1VHWA 3LA6A 3NOQA 5EG5A 4HH3C 5FR1A 4CMEA 1HYQA 1PG0A 1FUIA 4O2BF 2PS1A 3QFRA 4Y3UA 1E1MA 4IUDS 2FPIA 2GK4A 2I3AA 4U0JA 4WBXC 5LQSA 4E11A 4US2R 4DW8A 2GNOA 3HBNA 2SKCA 2C83A 3QHAA 4WVFA 5EHGA 4MWZA 4L4RA 2OUKA 1FMCA 2XECA 4HEHA 4AG5A 2V7TA 4PQYA 1JX6A 3D7LA 3OIWA 1A4IA 3IAM1 4IG4A 4QGAA 1YE3A 2YWFA 3PHIA 2JFFA 1A5AB 3MGGA 2B1IA 3VO9A 1R5BA 3OE5A 4D3YA 3NWEA 3DGEC 1COWA 3FTPA 4LYHA 1BS2A 2VP3A 1PHRA 2X4IA 4OFZA 1KP9A 2CVZA 3UWSA 2PUEA 1NOIA 4DHEA 4L75A 1UBLS 2ZYIA 3U1VA 1U7HA 2EFHB 1RRMA 2D2EA 1OXKB 2VLBA 3LXXA 4B84A 2OWDA 2QVGA 3CU5A 3A1WA 3OM8A 3U62A 4C2BA 5I7SA 1FSPA 4R2HA 3H83A 2B25A 2ZSHA 3UW1A 3INTA 1HZJA 3AF0A 3LF2A 1ML4A 1X7YB 4P4NA 3TG8A 4Q9HA 3U3XA 4QYXA 1YZHA 3I23A 2MSNA 1ZEJA 4WEQA 2OHJA 4C7MA 2R8YA 1F8YA 5DGXA 4DV4B 1ZL2A 3FUVA 1L5QA 1TU4A 2JCGA 4K9MA 1PTKA 5JS1A 3PB3A 1DVRA 1F0KA 3TIXB 1R0BA 4QTTB 5CFMA 4L15A 1DKMA 4YWJA 3K8QA 3S2GA 3FZNA 1RQ7A 4MGZR 2VJOA 3HJAA 1KGDA 5LLTA 1PS0A 1IQRA 2HSEA 3PPXA 4M8NE 2ZIZA 2QN3A 3C74A 4YP9A 1KJ8A 5FTLA 2WR8A 3K70D 1KQPA 5AHRA 4LK3A 1HL3A 1QKKA 2WNSA 3CEMA 3Q8LA 4KNYA 2NXCA 3W4JA 5KYWA 1FRFS 4PAMA 3CVYA 1QM5A 4M1ZA 5D84A 2NU9A 4ZYXA 1E8NA 3QE0A 2GBPA 5DIFA 3S2IA 1JQ3A 1KORA 2VUTA 2ZBGA 1C8BA 5AP9A 3AOGA 3E5MA 3V42A 3E4DA 4TMYA 3ZKWB 4EMSA 1PJ3A 3IAAA 4MQMA 4OPMA 1KIFA 1FDTA 2EEPA 2HGZA 2R48A 2PEZA 3MLEA 3EIQA 4AQ7A 1YVPA 1SUIA 2GXUA 5CB4A 2REQA 4FZ3A 2R6AA 5CR9A 5ITZA 1DBPA 1KS2A 3DMYA 1XTTA 3NHBA 4H60A 1G17A 5IJXA 1A9XA 2C31A 4RLQA 1BMDA 4OHYA 4LE1A 5E9AA 3RTGA 4N76A 1P80A 2ESRA 5IHPA 2VJLA 1CUEA 1YB4A 3HFGA 4JP5A 5T6BA 4EY5A 4IOKA 2FX5A 3OX2A 4RTSA 3U5ZB 4R81A 2VTKA 2J3HA 2HRDA 4B46A 1EAMA 1T36B 1H8ED 2Z2KA 1IBLB 1ECJA 2ZAOA 4K6FA 4U3JA 1ZK3A 1USVA 1M54A 1ZM3A 3AUFA 2I7XA 4ZALA 3LXRA 4DQDA 4HH0A 4DYDA 2V3WA 4J94A 2YWRA 5B3LA 3GJ7A 2OC4A 1LC0A 4D4HA 3WOHA 4RTQA 1ZQ9A 3CTMA 4GW3A 4OI0A 1TJNA 1WMDA 5D00A 3N2NA 4NKRA 2PU5A 3WIDA 1U3GA 1ZK4A 2FB9A 2PZBA 3GRUA 4EBBA 1TZCA 2FG7C 1ML3A 4HWSA 1TRHA 1LU9A 2PZMA 3D7KA 3MIIA 1U6IA 3NUQA 4HLNA 3L8MA 4J0KA 4LBWA 3U3RA 4BATA 1JV2B 3BKWA 5HQTA 3IQGX 4K1LA 5AVJA 4AJOA 4GR9A 2ZE5A 1L4EA 1Z6TA 2X8WA 2EJTA 3SXJA 4QXRA 1BXGB 2W8BA 4QUAA 1M1UA 2P65A 3AB8A 3FROA 5K09A 2P3OA 1R10A 3KX2A 4FXOA 1PK7A 3PDIB 4W4TA 3HWX1 4M8SA 4I1SA 3RFVA 1G8KA 3BZUA 3CA8A 1SQFA 1QO9A 1ULAA 3C4JA 3LT4A 1A5ZA 1RC8A 3MLAA 3F6RA 3NBXX 1MAWA 3A14A 4N01A 4BFWA 5JAMA 2JL1A 1AMOA 3VKWA 1I4DD 2N47A 3KVYA 4A6EA 3OUUA 3ZOKA 3LGSA 1NJGA 3IXLA 3NIBA 1JHMA 3PKZA 2JB9A 3BIFA 1YMVA 3RVPA 1P2VA 2GO1A 3VNRA 5IT4A 3K1ZA 5FULA 1UK8A 1YK1A 1PDOA 1JNYA 4TXLA 3T54A 4UBNA 4M7RA 2H54A 5JJ5A 1GG2A 1DTWA 1C1YA 1NX9A 2DPGA 2WV9A 1NLFA 1D4OA 1LDGA 1B2LA 1E60A 2IHKA 4JSYA 1RYDA 3PJEA 1P74A 1DWPA 4M0CA 4WNYA 5SV2A 3ZBTA 3R3VA 1YS2X 3A2NA 5I9TA 1II8B 1OBHA 4DCTA 4YPFA 4QPJC 3LQFA 5TRTA 5IYZB 5JD4A 4OP3A 1ICEA 2A1TR 4UHEA 3P2YA 2NZJA 2XLCA 1YD7A 1E89A 3PGMA 4ARAA 4ER6A 3I76A 2AI2A 3WWCA 4JEHA 1V8PA 2XTNA 1G4UR 3D7MA 2C1XA 3H75A 2G25A 3LUJA 4MTCA 1TJPB 4DEVA 3EGDB 5H8WA 1CB0A 3Q7SA 3VR5D 2O2HA 1EB8A 4J6FA 5J3JA 1KSJA 1UXIA 1XE3A 5DHSA 2IJGX 1MNAA 4AI6A 1NRWA 4LFBB 5DFAA 3GLFB 1HNXB 4J0DA 3AHIA 5BYBA 4TUYA 3TLEA 1UMDA 3ZC3A 2VHTA 3H4IA 1E69A 2C7GA 4WD3A 1CQPA 2AR9A 4QLOA 2JFVA 5ARCA 1PUXA 3GRYA 3LA8A 3I1FA 2EATA 3L8ZA 4MS3B 5IUNC 2ZROA 9MHTA 3DL7A 4X8HA 3CWCA 3Q7QA 1NUSA 2P2NA 4QAQA 3GCXA 4BNGA 1YBMA 3MCVA 4BO2A 1P29A 4LI0A 5IVKA 3ZD6A 4D7AA 2XAUA 4P4TA 3CX7A 1G66A 4C6TA 4PBSA 2YW2A 2ZYSA 4LG1A 1XKQA 2A8YA 3W2IA 4TKUB 2QYSA 4FKBA 4TZKA 3LNTA 1IHOA 1FA9A 2OCIA 2PRJA 4UTNA 8ADHA 5B1SA 5TR9A 4WZZA 3TOVA 4D98A 2JFGA 2VDMB 2O8FB 1PLJA 4GLFA 3WX0A 3D31A 3BWCA 4DC9A 1ZCFA 4RZIA 1DQPA 4KRXA 4JNKA 4IO1A 1BA2A 5D7NA 5DM0A 3RI3A 5ARBA 1TIKA 1PW7A 4FLEA 3D1VA 2OFWA 4MRPA 3LJKA 1N8TA 3KZKA 2PNJA 4CIDA 2A94A 3CZPA 3FNRA 1S9DA 3MD9A 2RCNA 4EJMA 4V38A 3WE7A 2E4ZA 4UUNA 3ONDA 3ZIAA 3ZE0B 5HK9A 1GYPA 2TMYA 1V3VA 3EZ2A 1QZUA 3T5BA 1HH4A 1PL0A 1UFVA 2R47A 3QUBA 1RAAA 1DC5A 3PFGA 3WDLA 5BORA 5LQCA 5DNWA 1B93A 4L57A 3TL2A 5LPNA 2AJLI 3JRNA 5ALMA 1H65A 1YFJA 1V25A 1W5AA 5BN1A 1NP6A 1RMYA 3PC6A 4UC0A 2DFTA 2Q0XA 2ZR7A 4RGYA 1EX9A 4Y2QA 1C3EA 1HDGO 1T34A 2WWRA 4IGAA 4F84A 4YMVA 5GVSA 4JXXA 4KYVA 3DFKA 4B6RA 2I8LA 3OBIA 4QXMA 5JZMA 2WHRA 3KLPX 1G4HA 1QRAA 2JDIA 5HK8A 5E4TA 5WRFA 2X4DA 3I12A 3LHFA 3MMZA 1P72A 1X80B 4FX2A 3NDRA 1IPHA 5F64A 4YCNA 1H9BA 1CFJA 2CGEA 3ISJA 1D2NA 1B1CA 4M22A 5K03A 2F1JA 1M66A 1E61A 1T24A 2OCAA 2GN0A 3A58B 1M33A 2QTNA 1WA5A 3KR2A 3N0WA 5J2UB 2G9VA 1ZJYA 4LC9A 1THGA 2ADOA 1X1RA 2XYQA 2NIPA 5A0FA 1KZ9A 2IZ5A 2Q0QA 1JHDA 4QYMA 5EE5B 2GKSA 2ZSFA 4LOAA 4NENA 1J42A 3B36A 3SKVA 4RTMA 4EHDA 3L0BA 3TYXA 2MYUA 3VPHA 1C1XA 1U6JA 3EZNA 4JY7A 3OZRA 2GZHA 4KWCA 4OA8A 3TOSA 3F98A 3VJMA 4RULA 3MUEA 1A8QA 2RE8A 3MWJA 4FFOA 2VP0A 1ZK0A 4EFLA 1TMOA 5JXIA 1X77A 4LNUB 3NH6A 4KRYA 5DYWA 2VJDA 4BDSA 5AUPB 1W47A 1GTG1 3AUYA 1IG0A 2QP9X 2Y1OA 5ESXA 4TXNA 2C61A 4BVHA 3I52A 1QZXA 2F1KA 2B2NA 4Q6WA 4ZODA 2Q8PA 2I6GA 2I3BA 1RXSA 1FTQA 3LAWA 2A4MA 1P1RA 2MIIA 1BXRB 1IN5A 1TM3E 2HK9A 4MB6A 2PG3A 4QIHA 1S3IA 4LJYA 2GARA 1T13A 2GD0A 2DUUA 2XF2A 5DKFA 3RYFA 4K81B 3WQBA 4YPVA 2AC4A 5L3QB 1NLYA 3HJFA 4N54A 3TUIC 3ZE7A 3E7XA 3MWFA 1LF5A 4PHFA 2CHVA 3PQ8A 1EM6A 4KP7A 1ES9A 2NU6B 4DLYA 1ZW1A 8LDHA 3Q1LA 4HXGA 2VH2A 4DRXB 4QYWA 4NL4H 3M5DA 3TL3A 3FKJA 4X7BA 4ZMRA 5KVCA 2ZYRA 4D57A 4XWTA 3MPUA 3A3YA 4BWGA 4A36A 3U44A 4HMQA 4JQOA 1RT9A 1E62A 2I2XB 5FOVA 2J07A 2P9QA 3QNWA 4H16A 1HE1C 4O2RA 2HA4A 5I4CA 5KDDA 4URUR 4ERXA 3BKXA 2YIVX 1F60A 2A2ZA 3PUXA 2EFYA 5EP1A 3H1BA 3LTEA 3OFND 4FLMA 4Z7QB 3PHLA 1UIMA 1VL8A 4B6JA 1IXRC 3SC6A 5A71A 1RHUA 3P9CA 4YAUA 1C1DB 5JOQA 2E4UA 1Q12A 3HWRA 4AKGA 2ZBFA 4HDMB 5AYVA 4K9KA 2FWBA 2PSFA 5BV0A 1G9SA 3ID6C 2HA3A 3MRXA 4AJNA 4JQYA 1XZBA 1NDUA 1RI1A 1KQGA 3HBLA 1Y7LA 4GP6A 4HWRA 3HWSA 4QRHA 4QTXA 1FRQA 2UUBB 4D56A 2DWPA 4Z9AA 1DT3A 3K96A 3OZXA 4YO8A 2XOKD 3EXIA 1Y81A 1PJQA 1DNPA 2GTHA 2YW9A 4X1OA 4QDXA 4X00A 5FWXA 3L5KA 1QQ5A 3Q0IA 3FCOA 1CKEA 1HE2A 5CB4F 1WVIA 1W0JD 3N6VA 3O3OB 1E2JA 4NMXB 1NT4A 5DHTA 2IH4A 5CXSA 3U1BA 5JATA 1K9SA 1SHUX 5GONF 5L40A 1E2PA 4HGYA 2G77B 2DB3A 2C58A 1Z8HA 3ZXIA 1QYRA 2AEEA 2JLBA 4B3SB 3TDMA 1RZVA 2FMTA 4K9QA 2OD2A 5E9WA 1YS9A 1LWOA 2B5VA 1FXWF 3ND5A 1K08A 2WM9B 4OREX 2I65A 3ZWMA 1RLOA 4NMWA 4N6NA 4RV5A 2HA0A 3LP5A 1QG0A 4ENVA 2ST1A 1WM1A 1NFFA 5JH7B 4F1KA 3H11B 2ZCVA 3VNVA 5F2OA 5KJEA 4RZQA 4DBLC 4RW0A 4BVLA 1T8PA 2OORA 3IDSA 1VI5A 1P9RA 2QT0A 4JSRA 4L0CA 5FTMA 5JO9A 1NPYA 5HS4A 2XHEA 2RAFA 2Z04A 3LVQE 3O3CA 1DC8A 2J3LA 3GNSA 5DWDA 3BH7A 1QFZA 2H4XA 3KSMA 5LOVB 1A98A 3W6NA 4WJLA 2XOEA 1YB1A 1WB6A 2C7PA 1B0AA 1EEHA 3DKKA 1U04A 2JDID 3OQ6A 1W0CA 2NZVG 3K9QO 3GZJA 3LUPA 4QVIA 1MOZA 1M5RA 1RZUA 1QTIA 3TTXA 2VXBA 5CA1F 3SWWA 5CCXA 2PGIA 4Y2UA 3U49A 5KNBA 1AXEA 2UYQA 1XZ8A 2GRAA 5TEWA 1NXXA 4UPDA 3SQLA 1WXFA 3R7DA 1XQXA 2YXEA 5KWIA 3S8EA 4GX2A 3PA8A 2EDCA 4Q7EA 1FL9A 5AOVA 4KH0A 4Z8XA 4P7FA 1GZVA 2XUPA 3TE7A 4BWVA 4KFUA 3F6BX 1FNNA 1QWSA 4KSBA 4UEKA 3VPFA 3LMKA 4LISA 5K3FA 3A1VA 1HT3A 3JARA 2MMGA 2ZQZA 1P4RA 3TW6A 4UHBA 1J2TA 5EIEA 4WGGA 1ADYA 2ZT7A 1TYZA 2Q6IA 1NZFA 5E9QA 3SR3A 3QEBZ 2J7PA 1GGVA 4RSHA 5GV7A 3H5RA 3WGOA 2CEAA 3A4YA 3E5NA 2HQSA 1HLPA 2IIVA 3EIFA 5DJ5A 2JHCA 1XMSA 1RD4A 2I2AA 3DE1X 3HU3A 1NVUQ 3VNAA 5HIAA 2RARA 4KR7A 1SCIA 3LW7A 4L27A 1LLUA 1YJBA 4CODB 5I9LA 3PT5A 2WWHA 3AFHA 3P20A 1Y42X 3PT9A 4GBGA 1DDOA 5LYJB 2PUCA 2IS2A 3PQCA 3WWPA 1FYVA 3LUHA 4FQ8A 3IEPA 4DV0B 1PEYA 1QIMA 4ODIA 3SAJA 4DDUA 1RRPA 2AQ8A 2QL6A 1T1IA 4BEBA 1EHYA 1MFZA 2PL5A 2P68A 1KWKA 5CPBA 5K2MA 2QOEA 3I6YA 4O2AF 5KCZA 1JIXA 3UO8B 2CB9A 4GWGA 1P75A 2CZQA 3E03A 3J7TA 1WRBA 1NFQA 1PCXA 3HLKA 4FFVA 4G67A 5CVDA 4URWR 1AGNA 1FP1D 5FH9A 1SVWA 2Q5EA 1R8JA 3OE4A 3GRVA 2Y67A 3IPCA 3FTFA 1W8IA 5E0KB 3IUPA 4F5ZA 2VDKB 4MAMA 1YQ9A 4BFTA 1KEEA 1QV7A 2C97A 4MV4A 3V1YA 4NV3A 1TIPA 2K2WA 4EL0A 3ZZMA 3TPFA 3JZMA 2Q1TA 1P17A 4D8YA 2JLCA 1Q15A 2HCBA 5REQA 3HCPA 5LP6A 4RLFA 4MEBA 4LOLA 4R31A 1Y6ZA 2EERA 3G1WA 2GZ2A 3KKZA 1I24A 3STUA 5G0WA 1RWQA 2CJXA 3RJ5A 4KBGA 4OHOA 4F1WA 5IVHA 2WZBA 2GM9A 4L6CA 4OHCA 4AECA 1SVIA 2Q21A 3BFKA 3KJNA 3ZZ0A 3HJGA 5JARA 1BHJA 2GPWA 3E1KA 5GINE 3NIDB 3ASZA 2A0XA 2B5WA 3RHZA 1F6WA 1N6PA 4OJKA 1AD2A 4XW2A 1XZNA 3SD7A 4A2PA 2DKNA 3SF8A 3WMEA 4GKAA 3ZZTA 4H77A 1TO2E 2QTFA 4Q39A 1FYDA 2OCDA 3GRFA 4U2FA 3VU3A 3D1LA 4RHTA 1K8ZB 2P9BA 1Q0SA 2PGAA 2W6ID 3AHCA 3MCAA 3UYKA 1G19A 1E3MA 2FQXA 5JXGA 4JVSB 2FG6C 5HVNA 1O5OA 1OF1A 1MG5A 2QXTA 4ABTA 2ZQYA 1B14A 2FPKA 4IHKA 3EK2A 3V97A 2WT4A 2JIZD 2Z30A 3KKLA 2VDWA 3Q87B 4Y8VA 1L5OA 1E4YA 1WVMA 3LO5A 1VL1A 4AMVA 3CB4A 4GKBA 2W6JD 3OY2A 4P32A 4WXPA 3VHQA 1XL0A 2QAJA 1T0HB 1JTVA 1LK7A 4L8VA 1R5JA 5L6MB 3U9LA 1U0NA 5CDFE 4G4GA 4EB0A 2W2OA 2XRZA 4PC2A 2V6FA 2DPHA 2C9ZA 3EVZA 2C00A 2R1TA 4QPPA 3MK31 4MQFB 3BK1A 5ERGB 4GRIA 3S5UA 5AK3A 4Z9YA 3TNDA 3VDNB 1NL3A 2EFGA 1BEZA 2ZTSA 4GWLA 3QNMA 1VRVA 1N3LA 2G70A 4IGFA 3RUAA 3N58A 3LCJA 1ZH4A 3SSOA 4OXKA 1Q0HA 2AZXA 5JEEA 1ZGBA 1Z5PA 2WWWA 4BNJA 1MRNA 3G0GA 5BN3B 3GIDA 2ZI6A 2ZRMA 4W7SA 4XTCS 1K9VF 1N2ZA 3CLVA 1UBEA 3IOYA 4NYIR 1NX6A 3WL6A 5I7OA 3I92A 4J1NA 3GLKA 1EGMB 1QNLA 3HVIA 5TX7A 3ZHZA 2J4FA 2AKEA 1YCGA 1U4NA 1X0XA 5KYYA 1B15A 3JW8A 3KYCA 5U9CA 2O59A 1Z4QA 2H51A 5LLDA 2FEMA 2B78A 4O2BA 5EWMA 1WCWA 4JCOA 4XYGA 3SK0A 3WNZA 3WYEA 3DHWC 2QQ0A 4MVYA 4LY9A 2YMQA 2ZXEA 5LQDA 4GHWA 1T1SA 4RA9A 1J8YF 4ZT5A 3TZCA 4F8YA 2B4TO 2YV1A 3JTMA 2HMUA 4J6EA 3TLXA 1N7GA 1WTCA 1DBVO 1YULA 3Q8KA 2DFNA 4QUBA 4E15A 2WHPB 5I9BA 3JWGA 2P9YA 3JYPA 3UJAA 2IHVA 3D81A 3OQ1A 1QIJA 3H9JA 3LPDA 3PRKE 3GMSA 4I1VA 4GMKA 5KUTA 4C7KA 1CBUA 5LMNB 4BBZA 2JFYA 1SHTX 1ORVA 1J9ZA 3OEYA 4C4PA 4Z3DA 1NI4B 2JZOA 3OLQA 3PU6A 3ZHCA 1QGDA 4MCAA 3TIGA 5DNUA 2GZRA 2PVSA 4PZAA 1ZZGA 5KAMA 4CM7A 1T4CA 4FFDA 4YK7A 1TC1A 4Q1FA 1V6AA 3K1AB 2ONKA 3FPAA 2YNMC 5BWCA 3T5AA 4O4JF 3WQRA 4JZYA 3NIWA 1SULA 1ZIYA 2ZB4A 2NV2B 2VBGA 4XDYA 3ZI4A 4BKPA 2H92A 5AR1A 3HY4A 1WCXA 3C1TA 4NJMB 3PQEA 3ZGXA 1FXWA 1EAYA 4CMCA 3W78A 2CK3A 1KI1A 1IJEA 1H69A 1WU8A 2HJVA 2J32A 3HVUA 4MMZB 1PYOA 3I4LA 1BCRA 3TEMA 2WQ7A 5CVUA 1Q1GA 1NKTA 2C2XA 3PDUA 4Y2XA 3JWJA 4DDKA 3GA0A 2R5FA 3NM4A 3Q7TA 4JT8A 1Q50A 3ZKWA 5DZSA 4J49A 4RV4A 3WNQA 2FOXA 2OORC 2D2FA 3F47A 5CBPA 5E0OA 1J22A 4A82A 4ZT3A 2C4UA 1OAOA 4C1BA 1QTRA 1S02A 1WPRA 1CJSA 1ZA1A 2PGXA 4ETNA 1E2NA 1ENZA 1I2BA 2OLJA 3SDZA 1MIOA 2H4FA 2VDJA 4ZO6A 2RGNC 5JJKA 4K9DA 1JDPA 3MB5A 3OA0A 4TV8F 3B1VA 5CRIA 1NUQA 3WKAA 3QUTA 3D3QA 5DM1A 1UPFA 1N77A 3KXIA 3FJOA 1SK8A 3EQ6A 2GPBA 3RM3A 1N32B 3SYTA 1DCFA 4RJLA 3LY7A 4BVAA 5HEKA 1IZYA 2RI0A 2C5BA 4II7A 1SJ9A 3AP1A 3LYUA 4Q82A 4ZU1X 2R4UA 3GQBB 1IPEA 3S0JA 4KIFA 3FBGA 1EFHA 3WGNA 3E8SA 3WIEA 3DL0A 2R6R1 2J3KA 1A72A 1T2NA 3IFSA 1CY2A 4YA6A 3QXHA 3AUTA 4DMRA 1Y1PA 5CLIA 4DQXA 4TLEA 1E1YA 1Q1ZA 3HB7A 4KN6A 3D3EA 3A2MA 1NT2A 3TLMA 2NU6A 4C4ZA 4J0QA 3FSEA 3VC2A 4H31A 4DS3A 1UODA 5C5CA 3H3FA 4TKMA 3DWIA 4U7TB 5AKXA 2CNWD 1DPFA 2VNAA 1XU4A 2YUTA 2HB6A 1HDRA 4MRSA 4AZTA 4HLCA 2ZJ1A 3LWDA 3T9CA 3EPPA 5LKRA 2DH6A 2EGGA 1Q7TA 2I2FA 5EJ7A 1DKRA 5JFGA 5FAXA 2DLNA 2F00A 4LF9B 1RDFA 2AMJA 3T7IA 3QPUA 3H9EO 1B00A 4RMNA 5KOYA 1C81A 5G1OA 2OZVA 3I05A 5FWXB 1S4QA 3PVZA 1K5HA 4UQOA 1I4WA 1MCZA 4MYDA 2C54A 4Y2SA 4B0PA 1BVUA 3H17A 4AJLA 4PYKA 4BNNA 1IN1A 4BKUA 2R1TB 4OQFA 3NJ4A 1M1XB 4N3GA 1REQB 3KALA 2EZ9A 5K4HA 1N34B 3E3AA 2B4QA 1Y9ZA 2X76A 3SMQA 2HIMA 2ZEJA 3H9UA 1J9GA 3ZE9A 4O33A 2E89A 2W70A 5JSUA 1FMJA 2R66A 1OGYA 4DVJA 2VHVA 4C4OA 4DLUA 5BQ3A 3T1YB 2OO3A 1KP3A 4X85A 1A96A 4TRMA 1RWPA 1ELOA 4JLKA 1P0IA 4YB8A 1ZN7A 3TKYA 3CVWA 4CEHA 5F78A 2Y1EA 3GAFA 1IFXA 3LQQA 3MTAA 1VKHA 3B89A 6REQB 2GHTA 2OD9A 3HUUA 4QVKA 2JIMA 1GL7A 3P2IA 4RL4A 5A2GA 1W30A 1QP4A 4KSCA 3QIAA 4JB8A 2D62A 4L08A 1VP3A 4LZJA 3AUSA 1KZYC 3V34A 1FB5A 8ABPA 1BN6A 5HILA 1FLDA 2O8DA 4TYNA 1EYZA 4KFCA 2J9FB 3KKQA 3JAWA 1BTOA 1XCJA 3UAGA 2BE9A 4A5SA 4UTPA 2VFAA 1KXJA 3S40A 3IUQA 3VU8A 1KARA 2BP7B 2FXIA 1OSNA 4GMHA 5BR1A 2GXAA 4FYWA 2HSZA 3JD2A 3L7MA 3WYGA 3M6LA 3A1UA 4AMYA 1RM3A 4WBNF 4EEKA 5ALDA 5IXJA 1P0CA 4JUAA 3K9GA 2AYXA 4M9SA 4D0NA 1XN1A 4BNMA 1ZMOA 1UBGA 1QFJA 1Y5MA 3HDQA 2Y1WA 3A6DA 2I6XA 4F7DA 1MJ5A 3U48A 2XMGA 3D2CA 3KWLA 5DH9A 4YONB 4P93A 2BH2A 2V7QA 3RSLA 4DB2A 2V1XA 4Q9LA 4Y2VA 2O3JA 1A8PA 4MVCA 1ZISA 3KSAC 4TL8A 1D03A 2PX8A 4FX5A 4M98A 4FGUA 4YCSA 4OQEA 3ERCA 2PYZA 2QN9A 4GYKA 3UPTA 1YU6A 4FR5A 4C3VA 4LDNA 1UL1X 1SUBA 3SZOA 3C7AA 3V8MA 1XJQA 3W5JA 3DVSX 1FTNA 3QVGA 4UBMA 3WTBA 3TMYA 1ZAKA 1QQBA 2JA1A 3HCCA 4MYCA 1RYZA 1CS0A 1T9HA 9ABPA 1P5ZB 4KVFA 3M6VA 3PGKA 3QUAA 1N2XA 2DERA 3PNSA 4MWGA 4Z0HO 1UBTS 1YI8A 3KV1A 1OT5A 1P45A 1Y1SA 2WD7A 2AXEA 4D9CA 5HW0A 2BR3A 2NADA 1KF0A 3OP4A 4CKWB 5CXQA 4W5QA 1HOXA 3DFUA 3L0YA 2BUAA 5H5JA 3BF7A 4TYQA 3BXHA 4F1JA 2W71A 3TBKA 3U4QB 1IB0A 3QBEA 3BTOA 4ZD6A 4LZOA 2IK8A 1E3WA 2PKYX 3EVNA 3RUCA 1RRGA 4O4HF 3SIXA 5AVYA 2XZOA 1JHRA 4KUGA 4KBFA 2Q99A 1Y8AA 4Q4AA 2IEYA 4DM7A 4EJSC 1LDYA 2FW6A 3AW8A 1ZWLA 3HJHA 3I1YA 2XUAA 1NJ6A 4BKQA 3F73A 2XOXA 3RIMA 3AI1A 3T1OA 5JDIA 2GBFA 1FBNA 1U7PA 3LQ2A 4V0MA 1IY1A 3FX2A 2GPAA 3ON5A 2R84A 1ZEMA 3INGA 1KSFX 1E98A 2H8GA 3L0PA 2EKQA 4IIBA 4NYMQ 5KREA 5LXTA 1P2BA 2BMDA 2HOQA 5TS3A 5JDCA 3B2EA 2XCUA 2EAUA 1A5TA 3IOEA 4LZLA 1CJBA 4DMUB 1LTKA 5IC6A 4DXDA 3NOOA 2YS7A 3JYNA 4X1KA 1HSZA 4ZI3A 2BMEA 2WSLA 4C6HA 3QOYA 1JQLB 2JVKA 1NMQA 1ONBA 4M8KA 5LZ8A 2ZRCA 3H4VA 1NWCA 4YI5A 5SY4A 1IAQA 3O8BA 2OBXA 4AKIA 3LC7O 4JODA 2V5VA 2F8TA 2B0CA 4FD2A 1K3FA 4FS8A 2EW1A 1BEEA 1EHIA 3M1YA 2WFMA 3ET4A 1KWGA 1DUVG 5ALWA 2PRIA 1WY5A 1POWA 4E2XA 2HDNB 3FYUA 3Q3JB 4MKRA 3MEQA 2WABA 3MZ0A 1E0DA 1A4RA 4DSOA 1E2KA 4N5NA 3UG6A 3GFGA 4RLHA 5DEOA 4FYJA 5LNK6 4RTNA 4IKPA 3NX4A 4GYJA 1QHHB 1N2OA 4GYYA 4KWIA 4Q03A 4RDHA 4ESHA 5FV4A 4NWIA 4AJ4A 4P3KA 4GOND 5BR8B 1KAEA 1UAYA 4QULA 4FB4A 2VYVD 1SVKA 2OFOA 4QM7A 2WFLA 3ZXYA 3CV3A 2AOUA 3T1NA 1DIOB 4HEA1 5JLAA 3HK2A 1M8GA 3ASYA 1PT8A 4K1XA 1EK6A 2O3UA 2R6JA 3GFFA 5EY5B 4ZT7A 2VATA 2IDMA 4KJXA 4MVJH 4ZV7A 4RJIA 2HL6A 1UANA 5CU7A 4K9RA 5DTRA 4C4TA 4KXNA 3SICE 1JQDA 2IDZA 1U28C 2SHKA 3WSWA 2N1BA 3ZG6A 4Q9NA 5K0TA 4KXWA 2W6MA 3OQHA 2BTQA 1F2UB 2X0DA 4F85A 1FNDA 1BCRB 1QONA 3OPYI 2JIPA 2PQ2A 2C29D 3LGXA 1KYZA 1SU6A 2R6ZA 1W87A 3QYPA 4KX5A 1P0FA 2PO5A 4DYHA 1Y7PA 5KYKA 1DEKA 3U7HB 1O7JA 1RI4A 1ORRA 4C0BA 3D6UA 1M67A 4II2A 3HXOA 2IWRA 1RRFA 3PGXA 1QG2A 4O0MA 3UMSA 5F2NA 1G6Q1 1U0FA 2VUHB 1RKUA 2CKDA 3R0JA 4Q4HA 1KO1A 5GONB 1UMBB 3PL5A 1VHTA 4J7UA 2CHUA 3GT7A 4GE3A 5CDHA 1SZJG 3QPDA 3TRDA 1WWKA 4II3A 4D9GA 2XMPA 3MFYA 1RM4A 2Z5LA 2EJWA 3N7AA 4HXFB 1LTQA 4PPQA 1QIGA 3Q8WA 3K70B 4GLJA 4UJ5A 5BOVA 3UBTA 4FNOA 2ZETA 2XQKA 4QGBA 4A23A 4MUFA 1GG9A 4MDFA 2OHFA 2ZVQX 4TTTS 3RUEA 4OJYA 4UE2A 2QTAA 2QORA 2BAGA 4G5GA 5K0NA 3TNFA 3MJVA 4GD3Q 3ZHSA 4KR3A 1HURA 2ZT6A 5CNJA 4A15A 3IE0A 4W63A 1IDOA 3GGCA 1AGYA 2ILTA 2UZ4A 3DF9A 4CM4A 2JGLA 5J5AA 4YJGA 2OV2A 4PVCA 1YI1A 2BZ1A 1L7BA 4IFTA 4KUEA 3RVQA 3E9MA 3OQIA 1GVNB 1QCCA 1QLWA 1LS1A 9LDBA 3T35A 3QX3A 5CFRA 1NU8A 4JXKA 5BVHB 3VV2A 1YQWA 1K4MA 2Y27A 4F3NA 3VYRB 4D6XA 1G5IA 2YVQA 1QC5B 5SZKB 5C5EA 3DXYA 1GFIA 3GZ4A 3R0VA 3UWPA 4KK3A 2HDOA 4YV7A 3QRWA 3M49A 4H1TA 2QB5A 4ZYWA 2UU9B 1JJVA 1HDCA 3QTLA 1IQUA 2FZVA 3LT5A 4S0XA 5FHQA 4AYTA 2PSSA 3FVTA 2ZKLA 1NI3A 4MMXB 4RS4A 2IY9A 3AXTA 2IIPA 4WERA 2OZPA 3KD3A 1W19A 2EWMA 5JJLA 2WQZA 4LF7B 4LNHA 1KJNA 4RE5A 4KW7A 3A27A 1Z5OA 4GBED 4LF4B 1L5SA 3R20A 2B8JA 2KMLA 2DC1A 3WLKX 1MT0A 4EF6A 5F23A 4J91A 1ZD4A 4EGSA 4KIJA 1P5FA 2VJYA 4TLBA 1XTVA 3CO5A 3HR8A 4UHCA 5FLYA 1BKSB 1PV2A 5E95A 1U1FA 2F43A 4UCQA 4ZGBA 2O7VA 1YZLA 3CEPB 3VTZA 1HRKA 3MPOA 4Z0PA 1Y9JA 2OE2A 3KJXA 1UPBA 4PZ9A 4W82A 5KTMA 1JWBB 2VNSA 3LYHA 4OHWA 2RC5A 1BH2A 2QJWA 2J09A 3PEFA 3Q8MA 2X15A 4W8GA 5K0EA 4S05A 4RACA 2H8KA 2F4NA 4K0RA 3W34A 4UVEA 1LLFA 3TVYA 1A2KC 5M7EA 3FG9A 3NC0C 5GQSA 2PMEA 2WJZB 2UV8A 3WL3A 3IQEA 5KNBH 2WTMA 2PGDA 1BQ4A 1UOOA 3C97A 3O91A 3D6TB 3OKPA 2YN0A 2GXSA 1M1YE 2BGMA 4MZDA 5PGMA 4BEWA 4UD2A 3K0HA 4U5QA 2NVWA 3EWNA 1UPCA 5JI3E 3QQPA 1ZJJA 4NOJA 1USGA 4EPWA 3GLHA 2BZ0A 3O90A 3RYIA 4JU9A 3KVRA 3IEUA 1NR5A 3RVRA 4B3FX 3TFOA 1E2HA 1KJZA 3L79A 4RABA 1PUJA 3JYQA 2ZJBA 4R83A 4HGQA 2PKEA 3ESZA 1XMQB 3DOCA 1HUQA 1RXCA 3BMNB 2C9OA 1EVQA 2H1RA 3PC2A 4FNGA 4JLMA 2HIHA 4Y1RB 1Q1NA 1Z5WA 3N70A 3TIVA 3WGJA 4MWTA 5DW3A 4ERNA 1WVGA 3DLHA 3M1IA 4NESA 3MSCA 1O4WA 2HUPA 2BZSA 4UU8A 2ONYA 1E5VA 4IKOA 1B76A 2ZJZA 1ORDA 2WHPA 4EUNA 1UFRA 2ROQA 5EUQB 1B3BA 5KVQA 5JECA 721PA 4W1PA 3P96A 3DAHA 5TT1A 1FDWA 2ZIFA 2CMKA 2ZR9A 5HIMA 3NT2A 3G17A 4C22A 4GI3A 1M2EA 4KR6A 3PFHA 5JRZA 3FSJX 1KH3A 2FPPB 4HD8A 1Y8QB 3FPEA 4YRNA 1XMOB 1O94C 1VG0B 5M3BA 1EDEA 1JPNA 1BN7A 3C4VA 1H3NA 4XYBA 2I66A 4PYQA 3ZW7A 1AKQA 1QQTA 4DLNA 4Y6QA 2F1RA 2O2YA 2PFSA 2XCIA 1E8DA 4ES6A 5EHXA 2BMVA 2B5OA 3I30X 2H1VA 5HTOA 1AB5A 1CHDA 5JV5A 1X15A 4ENRA 1H5QA 2B98A 4TWZA 4YAOA 3EHEA 4DFDA 5T4HA 2GI4A 1OVMA 2FFRA 4NS1A 4MRMB 3CZ5A 1JA0A 1TDJA 2X0KA 4MVJA 4A16A 1CZHA 4Z1OA 1XOIA 2VOEA 4TMVA 5EZ5A 4HAYA 2WAAA 2PMKA 3L43A 4I7EA 5JS7A 4ZVLA 1NQAO 1HBJA 2A5FA 2AG8A 3KUXA 3X1JA 3FOEC 4IH1A 4IM7A 4LV8B 5IKMA 1HGXA 1PZFA 3NUZA 2UXBB 3HNOA 4RQUA 1DO0A 4RD1A 1OY1A 2QJOA 5CDUA 4GT1A 1YZGA 1OKKA 3QX9A 1OBVA 2JIBA 2PWBA 1MDFA 2ZAYA 4E5VA 2PWZA 3FHLA 2I6FA 5A06A 4BRSA 1JIVA 1SCUA 4L73A 2X5KO 4BNFA 4DJDC 3HLYA 5A4IS 2RG1A 3NT5A 4PNPA 2P41A 3TLJA 5HJEA 2D1YA 1M2VA 4WCDA 2D7JA 2PZJA 2QRZA 3CISA 1X1EA 1YC5A 1GPBA 3HJTA 2IU0A 3D8RA 5JIBA 4MIEA 4KKVA 3UJ9A 4K6GA 1JPUA 3BSYA 4OB7A 4C76A 1V1MA 3TSYA 3IV7A 2AG1A 3AVOA 2R7KA 2A5DA 3REGA 5HKAA 1OQAA 3H2KA 5BVHA 4LWQA 5LU8A 1CIVA 2TS1A 1U0OC 3DWFA 1ISGA 1E96A 2NSHA 3OLWA 1Z06A 3PEEA 1J00A 4G0NA 4E1BA 4EPXA 2B94A 3GMTA 4R1OA 4OCZA 2WAMA 4O2BB 1TGVA 1J1ZA 4B76A 2CNWA 5I7HA 1NBMA 4MRAA 5EJ4A 4ZOCA 4ZA2A 4DV1B 1FU8A 2Y1FA 4KXUA 2WEKA 3T7CA 2RBKA 3ZYZA 3D7RA 4PX5A 1PR3A 1II9A 4C6SA 3BIWA 3OESA 4KAJA 4L8GA 3EGCA 2I2DA 2V4ZA 3OOEA 4RIEA 1MKYA 3BXPA 2J67A 5H4GA 1YZFA 1JTEA 4YX9A 4ZGGA 1W2HA 3D0QA 4JEIA 4K6OA 4CF5A 2R97A 4L6AA 3LFTA 4YDQA 3GUCA 5DHRA 4CCYA 3X44A 5LA6A 2HV8A 4BP8A 3LT0A 1D0SA 3TQHA 3CB2A 4S0ZA 4ZVKA 1E8MA 2BEJA 4J0FA 4M9XA 2Z6AA 1FE8A 3CH7A 1IXSB 2W2TA 4AP6A 5G4KA 3FGNA 3OKAA 3SC3A 3D02A 1WB9A 3FCSB 4YMTA 4X8LA 5JJCA 4JR1A 2JF0A 3FWZA 1X39A 3BULA 1HO3A 1N5KA 2GA8A 3K16A 3M0EA 4G6ZA 3UH1A 3AVVA 2QX6A 4Q7QA 2X1VA 3D4BA 3FDZB 1S3SA 4CEJA 1H1LA 3W6UA 2OTCA 4UXIA 3CJRA 4EAAA 1EWVA 4Q1EA 3K20A 1Z16A 3VRHA 5DLPA 2NQ8A 2H7XA 4CYMA 1JA1A 3ZEAA 4KDFA 4ND8A 4IRMA 4F6RB 5E4YA 2ZVDA 1SPXA 1AHIA 2OYCA 5BMOA 2OT3B 4CQLB 1V9SA 1SUEA 2QVYX 1N5DA 2PFGA 5CHEA 4PG7A 4PINA 3TLAA 3WQHA 3TG2A 1UP7A 5KEIA 1G7RA 3HCOA 4EW2A 2FP4A 4K2HA 3S1AB 4F9EA 2Z8ZA 1Z0SA 4DIMA 4CFZA 1A77A 4G84A 4BGDA 3AWIA 4JK3A 5EN4A 3BQMB 3EXFB 2W4QA 3MELA 5A02A 4N0DA 2QRVA 4NSNA 1NSYA 1BFKA 1VI6A 4XE5A 4U63A 5J40A 4E32A 2VDOB 1D5WA 4U1RA 1ILWA 4OM7A 3FJ1A 2ZS8A 3QU9A 1YB7A 5DI3A 2P0EA 3CR7A 5LSAA 4PO9A 4QUEA 4KRGA 4Y9TA 3C39A 1UQTA 2AFIE 5TGZA 4CHGA 1CUHA 1ZVKA 4XI9A 4CLOA 5DYTA 4FE4A 4RPKA 3RVBA 1JHUA 1LFAA 1MOSA 2E21A 2WJVA 4KXQA 3O94A 4MPDA 4O2AB 5CT5A 2NUAB 1F4LA 1B7GO 2LDXA 1AUQA 2MU1A 1DP4A 2QJRA 4IZ6A 2Q1WA 1H42A 4RJTA 3AUJB 3V33A 4WKGA 3G1TA 1LQUA 2FZ5A 4Q21A 2I33A 4V3BA 2AS0A 3WLFA 1XC7A 1FYWA 1GPUA 3HKEA 2E5LB 3FNIA 4OA5A 1W25A 5AVRA 1IIRA 1Y37A 1PJRA 3H0KA 2QN7A 4G0XA 4PLCA 4E5PA 2BFWA 5DP2A 1J0CA 3FCUB 3KJIA 2NYAA 3NI2A 3IQDB 3UT6A 5H68A 2XZDA 4OTZA 5JNTA 3ASUA 4H6XA 1V11B 2VDLB 4GLBA 2Q6VA 4MVJM 5K8TA 2ZWOA 3ZDEA 3KNZA 4DC1A 1JS1X 2AZMA 1X8LA 1CULC 4HFRA 2DQ4A 2Z83A 1HNNA 2FZCA 3ETCA 4O02B 1JLMA 2AN5A 1E9DA 3RS7A 4F2PA 1JG2A 4IDPA 5I4BA 4LBVA 2CY0A 2OOSA 2WSSD 3L07A 3RJ9A 1DQZA 2ZULA 2REBA 2VHXA 2OV6A 2V7PA 2QAGB 3VDRA 2OESA 5CVTA 4LKOA 4UARA 4TLMB 4BNXA 1KI6B 3W5HA 3QE3A 4FQ7A 3SKXA 2WF5A 3KSBC 4CKCB 1O6ZA 3BMCB 2NV6A 3QYFA 4N0MA 4HWOA 4R7ZA 3UWOA 4QKQA 3GLGB 2ZIWB 1TM2A 3KXDA 1T9AA 2QF7A 3UQZA 3WMGA 3HGMA 3JQ9C 4Q1VA 1I7SB 1U63A 4ZEWA 2FA9A 3FMOB 2Q2QA 2RGUA 5G1NA 2ANCA 2B1RA 3FGPA 4OHFA 4JS0A 4TTQA 1MB4A 2WINI 1ZSYA 5AKGA 1CUYA 3BILA 4CNBA 4D26A 1K8XB 3TNYA 1K7FB 1LSJA 2R8RA 4BLQA 2GF0A 3LHKA 4G2TA 1A9RA 4CIYA 3IIKA 2OUIA 4CBVA 4D4MA 5KX5F 3ZTWA 1QP0A 1Z07A 3OF5A 1USKA 3DO8A 5GP1A 4QSMA 2JH9A 3FJYA 3WLSA 1ECPA 1Z29A 3CC8A 4ZVNA 3UPUA 1RR6A 4TVSA 1XTKA 3UK1A 5HFNA 2ZI3A 1NMYA 4B8ZA 3CS3A 1MT3A 3D7NA 1NVVQ 1YDMA 3M2TA 4BZZA 3S8YA 1RC1A 5EGSA 3M34A 1GLVA 3A3NA 4L8LA 1L7QA 1I8TA 4DA8A 5AW6A 3M3DA 1B8VA 4JROA 3HO1A 4TVBA 3EVDA 1XZEA 2YJZA 2ECPA 4DLWA 4YASA 4RTLA 4F93B 5F2KA 2NXWA 4KQCA 3GR6A 4X3OA 3CUWA 1DC3A 1E20A 1O94A 1F2TA 2HH9A 3EZ7A 3KS9A 2Y0BA 5F5NA 1VG8A 5B1HA 4JNCA 3SE0A 2X0JA 5BVGB 1I01A 1XTJA 4R40A 2I4MA 2PUAA 4XVUA 3MUOA 1RRKA 3PWTA 3ZWVA 3RIGA 1Z33A 3WLJA 2KI5A 1O54A 4ZCQA 1MEJA 2YZGA 5KYXA 3TX2A 2A92A 5A3VA 1E1LA 3OPVA 4JI4B 1UBUS 2C9BA 1O8CA 2JJ2A 1U0RA 5A04A 5BWNA 3MC1A 1ODCA 1SB8A 2I5PO 3PUIA 4GFDA 4JGBA 4R01A 1TLLA 2HMAA 4AZ3A 3QFCA 3CH6A 4QU8A 2F4VB 1PNQA 4V1CI 1NXOA 2EQ5A 4FJ2A 2VHWA 1XNJA 3HR4A 3FTEA 1KAQA 4YUVA 3S2ZA 5GJBA 1SB9A 1RWNA 3V8VA 1YRLA 1VOTA 2FZWA 1CR1A 2HF7A 2XE7A 4KGVA 2WUVA 4BX0A 1Z5VA 3K5PA 5ULLA 1YQDA 2Z43A 2UKDA 1R9GA 3DEHA 4KWEA 5EIHA 3W3AD 5B7GA 3AR9A 3I9LA 4FT4A 3A04A 4HDKB 4QUJA 3IE2A 3R3JA 3KC2A 3RYIB 4EX7A 2E48A 4MW4A 3E5HA 3V7FA 5A5DA 2PPVA 3E3MA 1WQ1R 2ZZKA 5AI9A 3H05A 3HL0A 4W5RA 4AJHA 1Q83A 2RHMA 5LBUA 4KGZA 4C05A 1M2WA 3Q6MA 5B1YA 5IMBA 4F4UA 4L51A 3S5JA 2AYZA 5COAA 4B2IA 1ZXBA 2IF2A 3AU9A 1PX0A 3EVEA 3W5VA 3PQ3A 1AC5A 4D3ZA 1H2RS 4Z4QA 4B3GA 2H5EA 1DEXA 2NV0A 5JS6A 1X13A 1KNQA 3IUNA 2JEZA 2ZG6A 3AJRA 2QPLA 2IS1A 4HQRA 2O3TA 3K0FA 4MGHA 5JJIA 4TKLA 1Y3HA 4D92A 4ZCIA 4YUZA 4ALMA 1SCQA 1Z3CA 4I4LA 2IKQA 5AD1A 2WBLC 3S99A 3NQ41 5IF9A 5BYKA 4ZV9A 3C3CA 1ZMRA 1CNFA 3VVMA 3RRBA 4BFXA 2PKRA 1MPXA 4P33A 4GR5A 5CA0B 2C5GA 2CLMB 1HDXA 4E5NA 3AETB 5CT6A 1P8AA 1TIBA 4LXQA 5FI1B 2XKJE 2EYQA 1I7PA 2DR2A 2H31A 3PXAA 4M1QA 4IF6A 3C3PA 1G5QA 3MFQA 2VNIA 1QRUA 2R8OA 1KYIA 2C3PA 2Q4BA 1VGRA 1NGSA 4ZU3A 4F21A 2QTMA 3MJSA 3DZIA 4LK2A 2YWCA 4D45A 2ID8A 1KNXA 5FWYB 3K53A 3IEIA 1BOFA 1AV7A 1EU1A 1XROA 3LKDA 3PEVA 1UH5A 3HPRA 4HX2A 4TOIA 1M6VB 3ZY3A 4DAOA 3RUPA 5EJ8A 1G20B 3HHEA 1UP6A 5C34B 3IL2A 1LS6A 2O20A 1FSSA 3D43A 5KPDA 3EQ8A 4NDAA 3ZBPA 1BDIA 3CZRA 1Q1EA 2XUOA 3EVCA 3KOXA 3LKVA 3HKEB 2X3YA 3G2QA 4JJGA 4Z2AA 5JEDA 2O0JA 3W5UA 1PV4A 1CR0A 3DG9A 2OP1A 3FSGA 1UJ2A 4PRKA 5CYFA 1Y8RA 4FD3A 2OYRA 4F4DA 1ECCA 3ELBA 2F90A 1A71A 3H1TA 4U6NA 3WQSB 2CHEA 3VKGA 2HD4A 2PL3A 1YRWA 2WOJA 3P5SA 2FFQA 4AY2A 4YY3B 1XMJA 4A0SA 1F1BA 2CFCA 1CUUA 5CA0F 5KVSA 5DBIA 3FGOA 3EFOA 3FYUB 3FWHA 1V16B 3D4OA 3KYDA 4WBSA 5AVOA 1D4AA 1Z2AA 4ALLA 4P0QB 1RABA 2HUNA 4JIGA 2WW8A 1JHAA 4MWCA 1I0ZA 4UBIA 3WA6A 3HH8A 2HRQA 2WA1A 4TWIA 1Y1KE 4LBZA 2O1XA 1TZKA 5AT1A 2CF5A 3EN0A 3G9XA 2XI4A 4WAUA 3D6JA 4YUXA 3RFCA 4AZVA 1MVNA 4B4WA 1M1NB 3UJ6A 4B3MB 2WIJA 1KEVA 1SOWA 1SHLA 2CHQA 1HT0A 4I9UA 2AJ8A 5CB6A 1KDRA 3K8ZA 5PNTA 2W90A 3ONNA 4EKYA 2V55B 5M5BA 5CEJA 4NE9A 1FRZA 3I0MA 4BO6A 4ZRMA 3P0FA 4JI2B 4XIIA 3BD9A 3NH9A 2VQEB 1XYVA 1FP2A 3OE1A 2ID9A 3N07A 3QEOA 2D8AA 4RJKA 2VAPA 4FLFA 4MVJG 3WK5A 3PQ2A 1LX7A 4QBIA 3PHBE 4DDTA 1K88A 3L4JA 4LHSA 4P38A 5DM4A 1L7PA 1ORTA 4QUGA 5KVAA 3GEPA 3F7TA 1L5LA 2G0NA 1N1DA 3BS4A 4O08A 1AUXA 1RRVA 1XRMA 4D9IA 4XASA 3OPXA 5JSKA 2Q2VA 4WBNA 4ZOLA 3OCXA 4Z6KA 2FV8A 2GR9A 2ZRIA 4PNZA 3ZY2A 3R6WA 4X7MA 3PC8C 1VCMA 4XRRA 1SA0B 4Y98A 3BWYA 1L7DA 1GZSA 5CJPA 1U3DA 5DCYA 5SZJA 4CIXA 1I7QB 2JG3A 1FSFA 2GZMA 4QJ5A 2IQ5A 3SBXA 8OHMA 1ZRNA 4MARA 5HNKA 3DXZA 2JLWA 3EW9A 3L4SO 4BGUA 1XFDA 3V48A 2CV2A 3BIXA 4US0R 4MGIR 3Q3CA 4ZO7A 2QV0A 3H3JA 4MUIA 3ICQB 3OLVA 4X8OA 2X4LA 3N2GB 2ORVA 5AI6A 3WXMA 5DXJA 2YVKA 2C4WA 2JFWA 2R4TA 2PCJA 2BFFB 3IRVA 3H5TA 4MZXA 4UJ3A 4E2ZA 5I7RA 2ZB3A 3F71A 4OIFA 2AN9A 2NYVA 5AW1A 3IAS1 2IYZA 2NLOA 4BOYA 2ODQA 1KPGA 1OBFO 2FWMX 2WMYA 1L4BA 2BKXA 3JQ7B 1I6LA 1GKIA 1JXOA 3KQHA 3P0JA 5FUVA 3HADA 3E0QA 2PA0A 4JSTA 4Q9KA 1NR7A 2XR1A 2ETXA 3OAAA 2IRWA 3R5SA 2YV3A 1J70A 3ZIUA 2C5LA 5DHQA 2N46A 2P9ZA 4MHTA 1UK6A 2C2WA 2HMVA 4I19A 1GSOA 3A6FA 2IUYA 3DV2A 2Q1XA 1ACLA 1TA9A 4WEOA 1EFPB 4I4IA 2Y0CA 4C78A 4ZWNA 3KLNA 3EH2A 1SKQA 4Z9XA 1IY2A 1KDYA 3LO8A 1X7WA 4WUTA 3OHMA 3AEXA 4QD3A 3GO4A 4OJQA 3M9LA 5U1PA 3X1ZA 1VHDA 4CCSA 4Y0AA 1PR2A 3RIEA 4G8CA 4M2LA 1G63A 3CLTD 1Z0AA 4BMNA 4F5YA 2FX3A 4RVSA 4U9IS 1ZNXA 4EEXA 2IYVA 1EP2B 1PVOA 3N7UA 1H2WA 1NUTA 1S6YA 1T1GA 3ZJ4A 2WQ6A 4DV5B 4ICIA 1FMLA 2W6OA 4ND1A 3LBHA 1OI2A 3UK2A 4Q3BA 4GI1A 2CMFA 1VGVA 1YAJA 5F4BA 4MWEA 4FYIA 3JQ8A 3THRA 4F2HA 4BB6A 2P67A 2VOJA 4YP7A 5CTAA 5BN5B 3ADKA 5CD9A 1JHZA 4FP9A 2BKLA 1IOLA 1LF0A 3MBIA 2I6UA 3C8DA 1GTMA 1LTHR 2MWMA 5JCPA 1L7OA 2PBRA 3B12A 1T2UA 4G1UC 1GJRA 1V95A 1YZYA 2A5YB 2YNMA 3B1WA 3O82A 3PBKA 5DTMA 3S2UA 3SI7A 4AIIA 4H08A 1KMHA 4DC0A 2GZDA 1N9GA 3OIUA 4ND8B 4OQMA 1US8A 1N7JA 3QX7A 2ZYUX 4H17A 1JQEA 3ULKA 2JI6A 1FFBA 1DARA 4DPMA 1EFRA 4RQAA 2P77A 4RO0A 4E5YA 2TMDA 3TD9A 3Q6NA 3W5AA 2O0LA 3OHSX 4QE3A 3QJ5A 2Q3CA 3IXMA 3KR1A 3HJNA 2OCXA 1GQRA 2E82A 3H97A 3D9QX 5FL7A 6GPBA 1B0PA 2VWQA 1NP7A 1O57A 1Y6JA 4PSUA 1KZ4A 4JBXA 4BFCA 1C2YA 1FS6A 2CC2A 4YMWA 4KQEA 1LH0A 1OXSC 5FUWA 2Y0EA 3SZLA 1JT2A 1RIIA 3D4PA 2M6KA 3P9PA 2Z4SA 3RYHA 3ZGZA 2EKPA 3CX8A 1JILA 3AVQA 4OYLA 1M6VA 1V71A 3EEQA 2VC2B 2JASA 2WD9A 1H2EA 3PDHA 1TK2A 4FHGA 1E6WA 1ZFNA 4P5EA 4A1FA 3N3BC 1ZVMA 4JLSA 3ENZA 1ODLA 2DPMA 1EWYA 1V1RB 3BXEA 4XYEA 1N2CB 1NG9A 1JI0A 3KPVA 2E4VA 3AC0A 4HV4A 2RHJA 1DCMA 4OU5A 5M29A 3ENQA 2IPLA 1M6YA 1L5RA 3GRRA 1Z2PX 4Y9SA 4J3FA 3OCCA 4P7KA 1TEVA 2GYUA 1DXQA 2IHZA 2VF2A 4RCYA 5CGZA 1XVTA 4PG6A 3NXSA 4ZYZA 2I4RA 4LSGA 1ONPA 4DQKA 3S29A 1Z2CA 1G16A 1H22A 2J33A 5IU6A 4K9NA 3IP9A 2IXEA 1X86B 2XYVA 1U7XA 1N5LA 5FNVF 4EQZA 2R11A 3WLLA 1E58A 3K6KA 3CCCA 1N36B 3VU1A 4G1CA 2EFEB 4ZICA 4AO8A 2HT1A 1L4HA 2QD1A 3CVJA 1PGJA 1TD9A 3K4PA 4WXRA 3GP8A 2CHGA 3VAZA 1RI5A 3KL2A 3ZDQA 2PUHA 2PGLA 1FJ2A 3M4YA 3ORHA 4LY3A 4AY4A 1H0RA 4B17A 3IVCA 3UTDA 1PF7E 1T0UA 1K06A 3D6FA 2CT8A 3P71T 4PNEA 5B4UA 3GWZA 3EEIA 5TPZD 4A92A 3BA6A 1F0PA 2C3OA 2H4WA 3CF4A 1XALA 3L0OA 1CJKC 2J7KA 2OV1A 1SXJC 1LQ2A 2I6SA 4UM8B 1J8DA 4TPKA 3GD5A 1IMJA 3TFQA 1C0KA 1OZFA 1Z4JA 4JZKA 5FA8A 3TTTA 4O2LA 3BD8A 1YSCA 3VR0A 1T35A 1CC1S 5F7OA 1QYVA 1WP9A 2O5VA 4FIDA 4NOMA 5IK2D 2VKQA 1BXZA 5GJCA 4XR4A 2J4DA 4UD6A 4M7OA 1P0QA 1QIFA 4JJEA 5K8JB 1E9BA 3VNQA 2LP4Y 3ZWAA 4RD2A 5I45A 1GM5A 1YMQA 3FSRA 5BSGA 2IELA 3CN7A 3IILA 4INAA 4XZ3A 4IXWA 4RIFA 2XMCA 5TVGA 4M8LA 3MRVA 1Z26A 4DMGA 4GS5A 4O1IA 5HIJA 1Q5PA 1E0JA 5EUMA 3DPSA 5BSVA 4KU4A 1Z45A 3CZ4A 2LUOA 3WGGA 3CCFA 1ZS9A 5AM5A 5TPWB 1T2DA 3AJDA 1C3LA 1N0WA 2C96A 2ZRPA 3MAGA 4KITB 1AUPA 5KNCA 4I9GA 2Q50A 1I1NA 4R05A 3X1DA 3AVUA 1WCIA 1QH8B 1WOYA 3NAQA 3MJDA 1EZZA 3H18A 4LAFA 1CUAA 4WESB 2RHOA 5D51S 1PW5A 1TD1A 3GFRA 3OTWA 3TZEA 4ACBA 4CMIB 4ENQA 4YUWA 8AT1A 3CRNA 3JWHA 1CV2A 2ZRNA 2YIJA 3I9MA 4NCHA 4QASA 2AOXA 1OLOA 4NTZA 3R8CA 2ATVA 4NFSA 1HEIA 5BQPA 3H9GA 4E30A 5EXXA 3VDXA 4QQNA 1Y1RA 3G7NA 3C6ZA 2W2KA 4UAUA 3TQIA 1B43A 1T5LA 1GQSA 2HIGA 2WMOB 4HAIA 2BDTA 2VT3A 3AOEA 1AGRA 2XNJA 2QRUA 3GFTA 1ZOOA 3DBRB 5DTEA 1P2GA 3VSBA 1MAHA 3MHTA 3ODGA 4D81A 3N39C 2NUTA 4L9AA 2DRIA 2Z2IA 2LVBA 3VR5A 3B9BA 3CLTC 4GQBA 1U8FO 4P31A 4LZZA 2IUSA 2QRVB 2ZUBA 2O6HA 5CT8A 2HJWA 2ZDQA 3G9ZA 1Z2EA 2BRUC 4WWHA 3G0IA 4XQGA 3PEWA 2GAIA 4WN9A 1Q2XA 4Q3LA 5E8RA 1UOPA 2PVCA 3IBSA 1IOZA 1IK6A 1X7HA 2H2HA 2OZKA 4IHQA 1K8RA 4WI1A 2NO1A 4CLHA 4D6PA 2OG2A 5KC8A 1IEXA 2I67A 3F74A 4X92A 5DX8A 5IJAA 4C89A 4ZHSA 1ZGAA 2YWXA 4BO3A 4FJ1A 1ADCA 5F1YA 1H9CA 1VPDA 2NACA 3RU3A 4E5KA 3DOJA 1GADO 3A9VA 1D1QA 5LMUB 1AK1A 2QI9F 2B9VA 1B8OA 4NBWA 1IXZA 4PZDA 3V2IA 1WQ3A 2VH1A 1E6KA 1GAXA 3JRXA 7MHTA 2VHEA 3FFTA 3NGXA 1OA1A 3O92A 3AONB 4FPXA 1Z0DA 2X23A 3H42B 3HTXA 4JJIA 4U00A 4CTOA 3AUXA 3VPBA 1PL6A 4HDQB 5DSXA 1I51A 1YB2A 1OBOA 5F4ZA 2HCRA 4C4RA 2PM8A 2WUFA 3V2UA 4JVOA 3QOXA 1G20A 4H7FA 3GJ8A 2VI5A 1RW4A 3OE7A 4FR2A 4EH1A 1U9YA 2NSDA 4OQNA 1Q0RA 3GZNB 3PFWO 5G53C 4EA7A 1R0WA 3E9CA 4P7GA 4D9BA 5KSZA 1I3CA 1ZU5A 2FVXA 2ARKA 2JJ8A 3D54D 3LHIA 4OXQA 2QAIA 1EXNA 3L8CA 1MLDA 4ZVUA 2V0CA 1YFZA 3SDSA 4HLUC 5CVEA 3U44B 4NIMA 5HE9A 5KOIA 1KZ6A 3W3AA 4PYRA 4IUCS 3BFJA 1NVGA 3LUFA 2XT9A 5TMEA 3DBIA 4OHMA 5L9AA 1HEUA 4YGYA 2HBQA 5EUBA 4Q16A 3ZWPA 3BBLA 1G291 3B3JA 4YRKA 2H7VA 3IAFA 4ARCA 3CIFA 1S8AA 3GLSA 1VHLA 2QG9A 5KJ1A 1RVV1 1I7LA 1PBTA 5IXSA 3QSYA 1JDUA 2VPWA 4LTMA 4BP1A 3T38A 1LW7A 1H2FA 2AKAB 3DONA 5FA6A 4UAVA 1L2TA 3HU5A 4GEKA 3RSOA 1RKVA 3UAXA 5LKAA 2Q5QA 3NNSA 2GPYA 1GN8A 4CZ2A 2PZEA 3O7MA 4JI5B 5DYYA 4B6SA 5BXYA 2V4MA 4RZ2A 2VP2A 1A69A 2W22A 2FE1A 3WWZA 2GN9A 1FUUA 2QG4A 4HNHA 2H06A 5B30A 2CYCA 2W98A 1DIAA 1N6RA 1VJGA 2IYUA 4IWNA 4J29A 5F1PA 4CEIA 3SNHA 3AVTA 4QUKA 4BV2A 1YDEA 3ED5A 1U2TA 3IBFA 4DPKA 1TEHA 3CLKA 4C0JA 1CUIA 4GOXA 3ITEA 4BU1A 3M83A 2LE0A 3NW9A 2XXBA 3P9RA 2RGRA 1EG2A 3K2BA 4U9HS 5HQ3A 2V7EA 4ZDWA 4KLCA 3CFYA 1DAMA 3FHJA 3DDNA 1VLJA 1U0GA 3L9WA 1UADA 3PEUA 2LKDA 4ZOAA 5AJHA 5JCZA 4JV5B 4IVRA 5DBEX 3IALA 1ZBDA 3VQTA 2ZVPX 2WWYA 1ZINA 4WXYB 3GJXC 3U7GA 4YDRA 4WKBA 3SP1A 4OKNA 4AJKA 3R7NA 2G9NA 1CDOA 3PC7A 4O5OA 3NBAA 1TVKA 1W85B 2VK1A 3DPUA 3FXAA 4MOWA 4P1ZA 1D09A 1TO1E 1JEJA 1T4MA 1FZTA 3ZV6A 2H48A 2ZJYA 3UWMA 1EFPA 4M0KA 5I9IA 2XZTA 1R0LA 5J2TF 1LEHA 2NQTA 2ZE7A 1U80A 1HKUA 1FLNA 2WLTA 2YY7A 1R4NA 3NORA 4E6EA 5KCMA 1K92A 5L3ZA 3SF0A 3H2GA 2A9RA 4NX2A 3S81A 5A4KA 2JIDA 5A7GA 1O9HA 1ZIOA 5TMPA 2AIRA 2OBMA 3KSUA 3F1LA 3VA7A 2PT9A 1KFEB 2W7TA 4B6GA 4CT4B 4DV7B 5F9MA 1Q1QA 1E1QD 3AR6A 4V0OA 4UAGA 2JK0A 2VEDA 1JA9A 5F51A 3S70A 3IEKA 3T5CA 4RSMA 4X6XA 1PVVA 2V9ZA 5IWCA 1X19A 1ZRMA 2G06A 2IF0A 2IYWA 5EGNA 4EPRA 4D74A 4L74A 1N33B 5ICFA 1TT5A 1VDZA 2QM3A 3KUUA 3LSYA 3OP1A 3EGDA 3SQDA 4B2PA 3U61B 3HKCA 3PQ6A 1NW3A 3V5NA 4L8WB 3UT5A 1Z5GA 4PHCA 2YZ7A 3EEYA 3U4IA 4NU8X 2X0NA 3W4IA 4AF8A 4AW9A 2P35A 3B6EA 1BCSB 5FYQA 1WSAA 1NVKA 1FMFA 2C4VA 3WO0A 4CXMA 4IMRA 5IRCD 1SUAA 2RAVA 2FN9A 4GVLA 3SC2B 2IIBA 1VIDA 2V7UA 3I2KA 3ZVRA 3THYB 1OX5A 2CE7A 1UINA 2YHIB 1UKBA 4TN1A 4BNKA 3DL4A 4LYGA 2AI1A 4UXJA 5BQOA 1TFRA 3OFJA 4NONA 3L6UA 4J16A 3DFIA 3GBVA 4IJUA 5HA5A 1BH6A 1FZQA 4JEMA 5AXCA 2G1JA 1OFIA 5TJ9A 2XLBA 3ZHVA 4KSYA 5ALTA 2BEUA 4AY5A 2X42A 2IE8A 5ALEA 4QJ3A 4DUZB 1E32A 1YVRA 5AKIA 1L8XA 3AKYA 3CX6A 4NU6A 5HP4A 4AJ1A 4OHPA 4ZVVA 4ZHQB 3IIJA 4BNZA 5LZ4A 2QZ9A 1SC6A 1J06A 1SQSA 2RHRA 2E4AA 2W43A 3GB9A 5HE8A 4BNUA 3KQQA 1DKLA 1X9GA 4Q7KA 4UNIA 2VSNA 1UJ5A 4QX6A 4BE4A 1ZR2A 4EHKA 1KY5A 3U4MA 4L95C 2NWQA 2VA8A 4FWBA 2FZEA 2NXJ