1BHLA

Cacodylated catalytic domain of hiv-1 integrase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
133
Chain Sequence
b'SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 43
structure length 133
sequence length 151
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bhlA00
4OLAA 1U04A 4YFUA 1DTTA 3C6TA 3TAGA 3G0ZA 1F21A 1RDBA 4HUFA 1BCOA 3V1RA 2Z1JA 1NK8A 4FK2A 3G10A 3CFRA 4FLZA 1LV5A 1GOAA 2PZSA 1XWLA 3DRRA 2VG5A 5HRPA 1X9MA 3SQ1A 3NCIA 3NH1A 1WLJA 3HP9A 4W5RA 3OYBA 3OYJA 3WNFA 3QEWA 4PWDA 2KQ2A 4CJQA 4PY5A 2G8FA 1EP4A 4DU4A 4KPYA 4G1QA 3WNGA 1J9AA 4M3XA 5K14A 1KSPA 3VA0A 3RMBA 2E6LA 3HYFA 1JLAA 4O4GA 1SKSA 1TL3A 2B5JA 4CERA 1T03A 4HHTA 2X74A 3PV8A 1IO2A 3L8BA 4LH5A 3DLEA 3LAKA 4CHNA 3OS0A 4DQRA 5CYMA 3JYTA 2OPSA 4DFJA 5FRNA 4Z4IA 1Q8IA 4B9SA 1IKYA 5SWMA 4FLWA 3F9KA 1X9WA 1UA1A 4C8NA 3L2WA 2YHBA 3SJJA 1W9HA 4OVLA 3K5NA 1SKWA 1WAJA 4KI6A 3DRPA 1SL1A 5CYQA 2YHAA 3HL8A 3NGIA 2IOCA 1QQCA 5C24A 4OGCA 2GUIA 5KRSA 2D0AA 3LWLA 3HP6A 4JRQA 3RR7A 3ISNC 3SUNA 4J2DA 1TAQA 3OY9A 1BHLA 1TK0A 2G8WA 2ATQA 2GV9A 3KKSA 1Q9XA 2RPIA 4IBNA 1RT6A 5J2NA 1NKCA 2KTQA 1HNIA 4Y1CA 5HRRA 1RTJA 4N5SA 3NGZA 2FBXA 2RF2A 4DTNA 4J2AA 2Z1HA 3HVTA 3DRSA 1S6PA 4JLHA 4Z0UA 3DMJA 1VSMA 4KO0A 2BDPA 3AVLA 2F8TA 4B9UA 4C8LA 1I3AA 1JL2A 1ZBFA 4B08A 1MU2A 1RT4A 3KLEA 4O0JA 4PA1A 1VSFA 1X1PA 4BDZA 3DYAA 4BDYA 3PX4A 4BACA 4DQSA 3PY8A 2DFEA 3EYZA 2AJQA 4ELUA 3P1GA 1KFSA 3HPOA 3I0RA 1B9FA 2KW4A 4H8KA 3VQ6A 4KB0A 4FJNA 3U3YA 4CJFA 3LP1A 3OVNA 3WNEA 1RDCA 1TKZA 1Z25A 5FRMA 4FJIA 3V81A 4AHVA 4RW6A 1VSHA 3T1AA 4EP4A 3SNNA 3SZ2A 4E1MA 4M3UA 2A1SA 2NUBA 4JS4A 1C1BA 1KFDA 3ZT3A 1NKEA 1VRTA 4Y1DA 2YKMA 1B9DA 2JLEA 3DM2A 4LSLA 1C1AA 3CQ8A 1BISA 1KVAA 3MEEA 1FXXA 2HHVA 4B8CA 3CFPA 2OZSA 3AVGA 3D45A 4CHOA 1RTHA 2XRIA 4DS4A 3AVBA 4AHTA 1D9DA 4KHYA 3HT3A 3ZSXA 1LW2A 4CHZA 3D0PA 1C6VA 3L2RA 4O44A 4CJUA 1G15A 1ZBIA 3RTVA 2E4LA 2IAJA 3OYFA 4M45A 1YTAA 3TABA 4PQUA 4FCYA 1JLFA 3BGRA 1NK6A 1L3TA 3V6DA 3DLKA 4MFBA 1RBUA 3OYCA 3ULDA 2B4JA 4I2QA 3VN5A 1RT7A 3QEXA 1U49A 4DTPA 4KHUA 4IG0A 3IRXA 2ZQBA 4ELTA 1NOZA 4FLYA 1IKVA 1UOCA 1TL1A 2WONA 4IG3A 1NK4A 4CGGA 4CEOA 2KZZA 5SZTA 3QO9A 4E7LA 2F96A 4DQQA 4CK2A 1IKXA 4KRFA 1VSJA 3VA3A 3LP3A 3AVJA 4HUGA 3K5LA 4GMJB 5C42A 3U6FA 3HJFA 1WSHA 1YVUA 3HPHA 5C25A 3PUFA 1C0TA 1ZBUA 2XHBA 1RBVA 2KFNA 5HP1A 1UAXA 4KHQA 3THVA 3TAFA 2Q3SA 4QCLA 1NKBA 1RBSA 3AVAA 3K5OA 1SL0A 4ZTJA 1HNVA 1VSEA 3KLHA 1S1VA 4CJRA 2VG7A 4KB1A 5HRNA 4XIUA 4KFBA 3IAYA 1SL2A 3RRGA 1NK7A 4W5OA 2VWKA 4DTUA 4DU3A 1WSJA 2ITGA 3NBPA 4CGHA 4FM1A 1EKEA 1D8YA 2P5OA 3NFAA 3OYHA 5KGXA 4FJXA 1TAUA 1LWFA 3QLHA 2X6SA 4I9QA 3MAQA 4DSJA 1FK9A 1KVBA 4KTWA 1KCFA 3WNHA 3TAEA 4JS5A 4CGJA 3SUOA 2XY6A 2P51A 2FBYA 1QSLA 4CF9A 3AVNA 4B9TA 1HQUA 3RMCA 2PYLA 4NYFA 4KAZA 2DFFA 3A2FA 4FW1A 3V1QA 3O4NA 3CFOA 4CFAA 1UA0A 1C1CA 2HB5A 3CYMA 2VWJA 4FLTA 4BWJA 3U3GA 4CEZA 3AVKA 1U48A 4DTJA 1B92A 4HVJA 3O3HA 1TKXA 4ZHRA 1LAVA 4LSNA 2IC3A 3KK3A 2KFZA 4FW2A 4CFCA 4FJ8A 1KVCA 1BI4B 3DI6A 3CM6A 4I2PA 4OKKA 1TK8A 4OJRA 4DSLA 4UQGA 1T05A 3LANA 4CEQA 4M41A 3SV3A 4DSEA 3HVRA 1SKRA 4F2SA 4PUOA 3OYLA 1HMVA 4MQ3A 3VQEA 3KD1E 4NYNA 3UIQA 1HYZA 2OPPA 4FJHA 4LH4A 3M8PA 3TAQA 4E19A 5T7BA 3OYKA 4E7KA 1A5VA 1JXBA 2YV0X 3OYDA 1NJYA 1N5YA 2R7YA 1TKDA 2X78A 3F73A 3I8DA 3L3UA 2Y1JA 4FJ9A 3TANA 3L2UA 5HBMA 2RKIA 3EZ5A 4HUEA 3AVFA 1YT3A 3AA3A 3VQ7A 3SYZA 1KRPA 4GW6A 1JLQA 4CF8A 4CIGA 1HRHA 4K8ZA 4DS5A 4ID1A 2OPRA 3ZSWA 1WSGA 4CHPA 4DFMA 1D9FA 4IKFA 2HW3A 1WSFA 3L3VA 1QSYA 2YNHA 3NF9A 3L2QA 2QK9A 1S9EA 3SQ2A 1DTQA 1TKTA 1VSIA 3I0SA 1HYVA 3QNNA 4J2EA 3QIPA 1BGXT 3KTQA 2PYJA 3C6UA 3IG1A 3VQCA 4DTOA 1BQNA 1JKHA 2GBZA 4O0IA 3RMDA 1ZBLA 3H08A 3P5JA 3TAMA 3HM9A 5DK5A 2YNGA 1Z26A 3MXJA 4F4KA 4FLVA 2D5RA 5EU7A 3S9HA 4Z4HA 5HLFA 3LZIA 1TK5A 1Q9YA 5J1EA 4E0DA 3OYMA 4M3YA 1HYSA 1ASWA 2LSNA 4CEFA 3O3FA 5JS1A 3ZT4A 1J53A 1S1TA 4H4OA 2ZD1A 3EY1A 2A1RA 1XHZA 3ZT2A 1ZYQA 3ZSYA 3AO4A 2QXFA 4M42A 2BE2A 4I9LA 1QTMA 3V9WA 3RRHA 1IH7A 4FK4A 4NCBA 2HNYA 4ZTFA 1U45A 4DF4A 1CZ9A 4DF8A 1SUQA 4CJVA 3SQ0A 2RN2A 4KHSA 4FM0A 3LPUA 4DLGA 2G8VA 4CK3A 3NF6A 3K59A 3HO1A 2O4IA 3OYGA 1JXEA 4CK1A 2D0CA 1RTDA 1S1UA 3AO3A 1T7PA 1O1WA 1NK0A 1C0MA 1JLBA 1ITGA 4B3OA 1RCHA 4CEEA 4DFKA 4CEDA 3M8RA 4CFDA 3NF8A 2HVHA 3SPYA 3S3MA 2EHGA 4CJTA 5I3UA 2O4GA 4QOZB 3AO1A 1R0AA 4Z4GA 4CECA 4CF0A 4HTUA 2OA8A 3QINA 1WSEA 3VQ9A 3OYAA 5J2QA 3RMAA 1VSKA 1CXUA 4DFPA 1NJZA 3MXIA 4AILC 3NH0A 3K5MA 2QKBA 2DTUA 3K2PA 1NJXA 1TGOA 2YNIA 1IG9A 4DTRA 3S3OA 1NK5A 4CJ3A 3VQ4A 4CGIA 4DMNA 5FDLA 2G8HA 1FKOA 1RILA 4FLUA 3VQQA 1T8EA 2HHSA 5J2PA 3M8QA 3TI0A 4FJLA 3SCXA 4W5TA 4Z4FA 1NOYA 4B8AB 1S6QA 3KLFA 4B9VA 3ASMA 1VSDA 3B6PA 2P1JA 4E7JA 4N41A 4Z4EA 2DY4A 1D5AA 3T19A 1KTQA 5DMRA 2G8KA 5KRTA 3DOKA 3M8SA 1I39A 2G8UA 1RDAA 3NHGA 3NDKA 1GOBA 2YKNA 4CJEA 3T3FA 1U4BA 4BWMA 4DQIA 2D0BA 4CGDA 4OPKA 4OLBA 4KREA 4Q0BA 1RBRA 4DSKA 3KLIA 1EX4A 3B6OA 3NF7A 3AVIA 5HRSA 4FJKA 3PO4A 1SV5A 2X6NA 4CFBA 3LP2A 2QKKA 1VSLA 4FJGA 4GVMA 1N6QA 4HCBA 3NAEA 2E6MA 1XI1A 4KHWA 3SUPA 1S1WA 5J2MA 4OKJA 4N76A 1BCMA 2DFHA 2PY5A 3NGYA 4H4MA 3ITHA 3NE6A 3NH2A 1ASUA 2XY5A 4EP5A 4CE9A 4M3WA 3HK2A 4J2BA 3AA4A 3ZCMA 3QEIA 3OYEA 3V9XA 4E7HA 4KTZA 2Z1IA 3DLGA 4BE0A 1KLNA 1XHXA 2WOMA 4DU1A 3SPZA 2ETJA 4RG8A 3QETA 4M3RA 3KLGA 4OGEA 3PX0A 1IKWA 4KHNA 3LP0A 1S9GA 4CJ5A 1NJWA 1JL1A 2FBVA 4HCCA 4R5PA 2IGIA 2HHWA 4OPJA 2ZE2A 4DTXA 3DOLA 3E01A 4RW4A 1X9SA 4BE2A 4E1NA 3LDSA 4CCHA 3VQPA 4Q5VA 2JGUA 3O4QA 1S5JA 3KKRA 3OJSA 4JRPA 4F8RA 4CJLA 3DLRA 2I5JA 3OS1A 3V9UA 2W42A 1WSIA 1W0HA 2HNZA 3LPTA 3IS9A 1EXQA 1S1XA 4FVMA 2XY8A 3O3GA 4EZ6A 2HHTA 1L3UA 4W5NA 4LY7A 4OKEA 3ZT0A 4FM2A 1TVRA 2HHUA 1HJRA 1BIUA 3AA2A 4BE1A 3HXMA 4DQPA 3SUQA 5CY4A 3K58A 3ZSVA 1BIZA 4B9MA 4EZ9A 4ID5A 1U47A 3QEVA 1TV6A 4RW8A 1RT3A 4L8RB 4NCAA 5E41A 1WN7A 3AVHA 1RNHA 3ZT1A 4FJ5A 1FKPA 3TR8A 4E3SA 3PX6A 4KV8A 3SQ4A 4FYDA 1KLMA 2Z1GA 3KIOA 3JSMA 4ICLA 3VQ8A 4BDPA 3HSTB 1RT2A 3LALA 2B6AA 3QERA 2HVIA 4AHSA 4K8XA 1K6YA 3KK1A 4FZXC 3TWHA 1ZBHA 2BANA 3MXMA 1QS4A 1JLGA 4FJMA 4RW7A 3AO2A 3PO5A 5D3GA 1HPZA 4AHUA 1LWEA 4B9NA 1JLEA 4CGFA 4IFVA 3V9SA 3QEPA 5I42A 4F3OA 4FZZA 5CZ2A 2G8IA 2XO7A 4FJJA 4ELVA 1BI4A 2KZMA 1WAFA 4CEAA 3DLBA 4NCGA 2XY7A 1BQMA 2HNDA 1CXQA 4WE1A 3VQDA 3OYIA 3V1OA 2Y1IA 3C94A 1REVA 3QIOA 1RDDA 1Y97A 3AV9A 1UWBA 4LD0A 4DTSA 5KI6A 4Z4CA 5KTQA 1RT1A 4M3TA 3RR8A 1LAWA 4O55A 4AHRA 3OS2A 2F8SA 3AVCA 3C95A 4CF1A 2HHQA 2OYQA 3TARA 1RT5A 4CJPA 4F3TA 1YTUA 4AH9A 3LAMA 4KI4A 3VQBA 1J54A 4F2RA 2BGGA 1VRUA 4DSIA 1LW0A 1QE1A 3OJUA 4CEBA 4DG1A 3KK2A 4FJ7A 1VK0A 4CHQA 4AHCA 3K57A 4FK0A 4CJKA 2HMIA 1EETA 3AVMA 4FZYA 2HHXA 3RWUA 4N56A 2IS3A 3L2VA 4KTQA 4O5BA 4DWIA 3FFIA 3SI6A 4CJSA 1QHTA 1XC9A 4CF2A 1QSSA 1DLOA 4C8MA 2OZMA 3KJVA 3OYNA 5FROA 4E89A 4IFYA 4CJWA 1BL3A 1CZBA 3ZSRA 3LZJA 2P5GA 1A5XA 3CG7A 3VQ5A 3P83D 3VQAA 4YNQA 4E7IA 4FXDA 4B9LA 1CLQA 5HROA 5KGWA 3SV4A 3MEDA 3ALYA 4RW9A 3LWMA 3BDPA 4DLEA 4FLXA 3ZSOA 3CM5A 1L3SA 1L3VA 4I7FA 1L5UA 4C8KA 1GOCA 3QNOA 4CJ4A 3MECA 3V4IA 3S3NA 1A5WA 4CESA 4DTMA 3AO5A 1J5OA 5JS2A 2VG6A 1RTIA 3MEGA 1ASVA 4DSFA 5CZ1A 1HQEA 2EX3A 3V9ZA 3AA5X 1NK9A 1JLCA 4W5QA 4IDKA 4M3ZA 4QAGA 1C0UA 2OPQA 3ZSQA 4C8OA 4CHYA 3TAPA 4KKOA 3QESA 3DLHA 1RBTA 3ZSZA 4CIFA 4N47A 3HPGA 4TSXA 3KD5E 1LWCA 2YNFA 4CIEA 2IDOA 2FBTA 2FC0A 1WNSA
chains in the Genus database with same CATH superfamily
3SJHA 3C6TA 2GELA 3G0ZA 1F21A 4HUFA 1NK8A 4FLZA 2ZJQL 1Q18A 2HBMA 5KPZA 3NCIA 1GLJO 4DR2K 2KQ2A 2G8FA 4KPYA 2YHYA 3WNGA 2V52B 1J9AA 4M3XA 3CJ9A 4NXNK 1SKSA 2AP1A 2B5JA 4HHTA 3ZLJA 3CIPA 5JVHL 1IO2A 3LAKA 1HNXK 4FLWA 1X9WA 3CMAN 4DV2K 4C8NA 3L2WA 5LJWA 4OVLA 5BRFA 3NGIA 2IOCA 5C24A 3HP6A 3ISNC 3OY9A 1BHLA 4DKWA 1TK0A 1EQYA 3EE8A 1JJ2M 3KKSA 1X9JA 1NLVA 4Y1CA 5KQ8A 3M6GA 2FBXA 3THWB 4JLHA 4Z0UA 4GKJK 3QBXA 4DHYA 1YJNN 4B9UA 1JL2A 1ZBFA 3FE1A 1MU2A 2P9UB 1N34K 4C8LA 4H5WA 1RT4A 3KLEA 4O0JA 4PA1A 4JYAK 1VSFA 3AGRA 3VTIA 3DYAA 4BDYA 4BDZA 1KD1O 3P1GA 1KFSA 5CE3A 5KPTA 4KB0A 3VQ6A 1RDCA 4LFCK 4RW6A 1VSHA 3O5BA 3VGKA 4BREA 1FJGK 3SNNA 1VQ7N 4M3UA 2A1SA 1C1BA 1N36K 1VRTA 4JI2K 1C1AA 1BISA 3ENHA 4BRDA 3CFPA 2I7PA 5H1SQ 2OZSA 4FWPA 3AVBA 4AHTA 1D9DA 2ITMA 3D0PA 1D4XA 4CJUA 1G15A 4BR5A 3RTVA 2IAJA 3TABA 3O08A 2QWOA 4CD1A 1JLFA 4ILHA 2ZGYA 3I8BA 5AZJA 4MFBA 3OYCA 3H3NO 3CERA 1RT7A 1U49A 2Q0UA 4K25A 4G9ZA 4YOYA 1NWKA 3U4LA 3IRXA 2ZQBA 3LDPA 5HOOA 3N4QA 4JI5K 4CEOA 3G25A 1WB9A 3F5TA 1KAXA 2FXUA 3QO9A 2O8FB 3LP3A 3AVJA 4GMJB 4DV5K 1C0TA 3CF5L 3QDKA 2HBKA 3TAFA 4QCLA 3BZCA 1RBSA 3AVAA 1KQSM 3LDNA 3H1VX 2QM1A 5HRNA 4LF9K 4KFBA 3HZ6A 3ZEUB 1JCFA 1NK7A 3ZETA 1QQNA 3NBPA 1EKEA 4C1NI 3U9ZA 2P5OA 4FJXA 3C65A 4FWMA 1KVBA 4JI1K 1NJIO 4BC4A 1KAZA 4IEIA 2FBYA 1QSLA 1HQUA 1NGHA 4DV3K 4NYFA 3RMCA 2DFFA 3A2FA 1GLAG 1WOQA 5BPMA 2VWJA 4BRCA 3AVKA 3QMLA 1V4TA 3O3HA 2Q0RA 3QBWA 2HSTA 4X64K 4LSNA 5GAEP 3KK3A 1GLDG 3C6HA 3GG4A 4ILJA 1TK8A 4OJRA 4DR3K 5TKYA 1T05A 2P9PA 4DSEA 3HVRA 1SKRA 2E20A 3CCEN 1HMVA 2V51B 3KD1E 3UIQA 5CR4A 4YDUC 4UY8O 3OYKA 1JXBA 2YV0X 3EKSA 1TKDA 3DLLL 3I8DA 3L3UA 2RKIA 4JNEA 3AA3A 4YDUA 1JLQA 4CF8A 4CHPA 2HW3A 1G99A 2ZGZA 1QSYA 4LF8K 1DTQA 3I33A 5KPRA 3QNNA 2PYJA 3C6UA 4DTOA 1BQNA 2GBZA 5AFUH 2E2PA 3HM9A 2UUCK 2A41A 3KZBA 4F4KA 2D5RA 4Z4HA 5AZIB 4E0DA 5J1EA 4LFBK 3O1WA 3J81O 2LSNA 3Q7BA 4YOTA 3O3FA 4B1UB 4RCHA 3WXIA 1HUXA 2ZD1A 4CVNE 1C0GA 4I6MA 3RRHA 4JHDB 3SQ0A 5AJ3K 4FM0A 3NF6A 2O4IA 3AO3A 3SBGA 1JLBA 4C1NK 4CEEA 3WXKA 4DFKA 1HKCA 1NMNA 2FF3B 4EHUA 3SPYA 3A8YA 3S3MA 4CJTA 4A57A 1EWRA 5MLCQ 1GLLO 4JEPA 5EY4A 5J2QA 1VSKA 2RE2A 3EEQA 1NJZA 3MXIA 2DTUA 4KH4A 3K2PA 2YNIA 3S3OA 3VQ4A 2GEMA 4CGIA 4DMNA 1NGEA 1X3MA 5FDLA 2F9WA 5ADXH 4FLUA 1GLFO 2Q97A 4BRIA 4ISFA 1VQKN 2QWNA 3M8QA 4W5TA 4B8AB 4GV9A 2PFUA 1QQMA 1D5AA 2G8KA 2KKZA 3VGMA 3FZHA 4CJ7A 4FWKA 1QQOA 4BWMA 2D0BA 5AQIA 4CGDA 4FWNA 3B6OA 1SV5A 4CFBA 1N6QA 4FWQA 3GE1A 4CZHA 4KHWA 1S1WA 4N76A 3PLAA 3HOSA 3NH2A 2XY5A 4J2BA 3AA4A 3ZCMA 2NRRA 4FOEA 1XHXA 4JKCA 1JCEA 3KLGA 4OGEA 4KHNA 5AQRA 1JL1A 3VEWA 4OPJA 2O8FA 3MWPA 4EIAA 4OO1J 1X9SA 2JGUA 4F8RA 3OJSA 3KKRA 2I5JA 1WSIA 1W0HA 1EXQA 3LL3A 2RHKA 3ZT0A 2IVOA 3SAGA 4XH5A 3ZEUA 2E2NA 3SLCA 3K58A 4Y0WA 4L3QA 4M7YA 1T6DA 1RNHA 4FJ5A 2QWLA 3FFKB 4YOWA 4B1XB 1T3VA 2H3GX 3ID8A 2ZJRL 2HVIA 3MCAB 4FZXC 3H46O 4FJMA 3B8AX 2ZM6K 1YAGA 5D3GA 1BO5O 4AHUA 3R6MA 4NB4A 4IFVA 3R3LA 2HHHK 2XO7A 5AQMA 4BG8A 4LF5K 2XY7A 3VQDA 3OYIA 3AV9A 3P39A 1QVGM 5KTQA 3RR8A 4O55A 4AHRA 3AVCA 3QICA 3WXLA 3HRGA 4AH9A 5E26A 2D0PA 3UKRB 1J54A 3OBYA 4IOXA 4DSIA 3KK2A 4DG1A 1VK0A 4O8UA 1BA0A 4AHCA 4CHQA 3K57A 4CJKA 3RWUA 2IS3A 3L2VA 1VQ9N 3SI6A 2P9LB 4CJSA 1QHTA 4HTLA 4CBUA 1N33K 1A5XA 3CG7A 3VQAA 1XC3A 4U7BA 2P9SB 2UUAK 3A5NC 3BDPA 3EE9A 2E8AA 5AQGA 4FLXA 4I7FA 4C8KA 3MN5A 4CJ4A 1K8KB 1J5OA 4FVUA 2VG6A 1RTIA 1ASVA 1HQEA 2EX3A 1NK9A 2HMPA 4W5QA 1RDUA 1C0UA 2OPQA 4CIFA 3HPGA 3L4IA 4CIEA 1NGJA 2FC0A 1BIZA 3NHGA 2NNWA 4WCEL 5DM7L 2W6LA 4FK2A 1BCOA 4B1YB 3G10A 5IWAK 1LV5A 3DRRA 1WLJA 4PHTX 3WNFA 3QEWA 3J7ZO 5C10A 4PWDA 4CJQA 4E1JA 1EP4A 3ULEA 4G1QA 5K14A 4IOAL 3THYB 1TL3A 2A3ZA 1HNWK 5AQSA 1T03A 4LH5A 1OH7A 3NMUA 4DQRA 3OS0A 2OPSA 4B9SA 5SWMA 4LC9B 3K5NA 2QI2A 3DRPA 2E1YA 2YHAA 3HL8A 1QQCA 2GUIA 5KRSA 3KHYA 2VGNA 3RR7A 5ELZA 4J2DA 4FL9A 3R9PA 5M1PA 3WXJA 4CI6A 3ID6A 1Q9XA 4IBNA 1RT6A 4AQYK 2F4VK 1HNIA 1DKGD 5HRRA 4N5SA 3NGZA 2HOEA 2RF2A 4PKIA 3DRSA 1S6PA 3DMJA 3P38A 2GUPA 5C2FA 4M7XA 1VQNN 3PX4A 3PY8A 4BACA 4EFHA 5AQKA 1E4FT 3THXB 2AJQA 2Q36A 3VEVA 4ELUA 4H5RA 3I0RA 1HKGA 3OVNA 3WNEA 3VGLA 5FRMA 3K9KA 1S22A 4FWOA 4EP4A 3SZ2A 4E1MA 3O9TA 1KFDA 4Z94A 3T7ZA 3DM2A 4CW7B 5M1OA 3AAPA 1XMOK 3FZMA 2P9IB 2KHOA 3D45A 1RTHA 4CHOA 4DS4A 4KHYA 2FSKA 1OH8A 4EHTA 4CHZA 1C6VA 1WUAA 4WFAL 4O44A 2E4LA 3OYFA 4M45A 4PQUA 5AQPA 1BOTO 4IO8A 1NK6A 3V6DA 4DB3A 3DLKA 3ULDA 1CZAN 2B4JA 4KHUA 5A2QO 4ELTA 1BWFO 4FLYA 1NK4A 1TL1A 4IG3A 4MDAA 1NGCA 5SZTA 2F96A 4DQQA 4CK2A 1VQMN 5BN8A 3HI0A 3HJFA 5BREA 4QS7A 1YVUA 3HPHA 1VQLN 1ZBUA 2XHBA 2FSJA 1RBVA 5HP1A 1VAZA 1NKBA 3QFUA 3NVKA 3K5OA 1HNVA 3O9UA 4CJRA 4BRNA 4XIUA 3DXMB 4IJAA 3IAYA 3CMEN 1SL2A 3UKRA 4W5OA 1YJWN 3HBTA 2ITGA 1KXPA 3OYHA 4JN4A 5AQZA 1LWFA 2X6SA 4I9QA 3MAQA 4KTWA 2P9KB 3WNHA 3FGUA 4CGJA 2P9LA 4BVOA 4JV5K 1H1VA 1YJ9N 3IUCA 3AVNA 2A5XA 4KAZA 3MWTA 4CFAA 2HB5A 5EXWA 1NGDA 4BWJA 3E9LA 1U48A 4DTJA 1B92A 2P9SA 1W7AA 2Q1NA 4JI3K 1SZ2A 4FW2A 4FJ8A 3FR0A 3BF3A 4I2PA 4OKKA 3G4SN 4DSLA 4M41A 4M63C 3SV3A 3C7NB 4F2SA 3OYLA 1K8KA 3TAQA 5T7BA 3EL2A 3MX5A 2QXLA 4K43A 3CJBA 5HBMA 5FPDA 4ISEA 3AVFA 1YT3A 1KRPA 1U2VB 3CCJN 4CIGA 5AQVA 4BR7A 1NG9A 4JI6K 4ID1A 3ZSWA 2Q2RA 3MK6A 3BY5A 3ZX3A 4BRFA 1WSFA 3L3VA 4OX9K 2YNHA 3NF9A 4NO7A 4FOIA 1S9EA 3SQ2A 1TKTA 3I0SA 3O9RA 5C12A 4J2EA 3QIPA 3KTQA 3IG1A 1JKHA 4O0IA 4MO5A 3RMDA 3P5JA 3TAMA 2W41A 2YHXA 2YNGA 1Z26A 2FF6A 2HBJA 3MXJA 4DCHA 5EU7A 5M1FA 4FLVA 5HLFA 3LZIA 1TK5A 1Q9YA 4M3YA 1ASWA 5JS1A 3CQXA 3ENOA 3ZT2A 3ZSYA 2QXFA 4M42A 1XUPO 1QTMA 2E88A 4DF4A 1CZ9A 4DF8A 4CK3A 3IDHA 3R1XA 1WBBA 1JXEA 4CK1A 2D0CA 1S1UA 3CJ7A 3OA9A 4OPHA 2NLXA 3CC2N 2HVHA 1NBWA 5I3UA 2O4GA 4K42A 1S72N 4CECA 4CF0A 3JAMO 3QINA 3VQ9A 3OYAA 2F7TA 1CXUA 2O8EA 1IBKK 1ATRA 5AQQA 2HBLA 3K5MA 2QKBA 5LMUK 4BGAA 4DV0K 1TGOA 3CC7N 3THXA 4MO4A 4GV6A 5AR0A 3RSEA 3CCUN 4JKBA 1FKOA 1RILA 1T8EA 3VQQA 3FZKA 3H3OB 1IBMK 4B1WB 2ASMA 1NGFA 4FSVA 3TI0A 3SCXA 3FZFA 4Z4FA 3KLFA 4B9VA 4Z4EA 3ASMA 3VENA 3B6PA 2P1JA 3SAFA 3L4QA 5DMRA 1I39A 4BROA 4BRHA 1GOBA 2YKNA 4CJEA 5GAGP 3CQYA 4H0VB 4OLBA 3NF7A 1EX4A 5HRSA 4FJKA 4BG9A 3PO4A 3LP2A 3KWGA 3O9QA 3ZX2A 5EVZA 1XI1A 3SUPA 3Q7CA 4OKJA 2V7ZA 1MA9B 3NGYA 3NE6A 4KTZA 2Z1IA 3DLGA 4BE0A 1KLNA 2WOMA 4DU1A 4EAHD 2ETJA 4RG8A 4YY3K 1IKWA 1S9GA 1EO1A 3VOVA 4JKGB 2HHWA 2YHWA 4RTFD 4E1NA 4DV6K 3VQPA 4JI7K 3DLRA 1Q81O 2W42A 3LPTA 4BC2A 5AQTA 4FVMA 3O3GA 1L3UA 2VWBA 4LY7A 3DXMA 3DXKB 1HJRA 2ASOA 1BIUA 3HXMA 4DQPA 3SUQA 3TSPA 3ZSVA 4B9MA 4ID5A 1W2BM 1U47A 4RW8A 3AVHA 3CJAA 4GNIA 3CHWA 4QS9A 4JK7A 4FYDA 2P9NB 1KLMA 4HWIA 4PKHA 4ICLA 3VQ8A 4BDPA 3HSTB 4U67L 1RT2A 3LALA 2B6AA 3D2EB 4AHSA 1E4GT 4K8XA 3KK1A 3JXUA 3TWHA 1ZBHA 2QWRA 1QS4A 2CH5A 1NU0A 5ADXA 4RW7A 2PBDA 3FZLA 1HPZA 5I42A 3QEPA 1M90O 4F3OA 1K8AO 1WAFA 3DLBA 1BQMA 2HNDA 3V1OA 3QIOA 3C7NA 1UWBA 3WXMB 4DTSA 4RWTA 2HHQA 3QB0A 4GY2B 2OYQA 2NRHA 3JS6A 4F3TA 5BRHA 2BUPA 4KI4A 3VQBA 4B3TK 3IMXA 2BGGA 3U8XA 3OJUA 3THWA 3AVMA 2HHXA 4BR9A 3J7YP 4KTQA 3CJ1A 4DWIA 4FO0A 1XC9A 2P9UA 1RGIA 3P31A 3KJVA 5FROA 4E89A 4IFYA 2WUSA 4H03B 4CJWA 2UUBK 1RDWX 1T44A 4B1ZA 3OTOK 1HR0K 4FXDA 3VQ5A 4E7IA 5TKWA 2F9TA 5C2DA 1ILYA 5KGWA 4RW9A 3ALYA 3LWMA 4YORA 2VGMA 1ATSA 3NVMA 3ZSOA 5GINA 1L3SA 1L3VA 5LY3A 1GOCA 3QNOA 3V4IA 1E3MA 4DSFA 4LFAK 1JLCA 2CGLA 4QAGA 3ZSQA 4CHYA 3SMSA 4A5BA 3TAPA 4IZ9A 3QESA 3A0IX 5F2RA 3ZSZA 4WQ5A 5JMVA 4TSXA 1LWCA 1N5YA 3M3ZA 4OLAA 4XEIA 1U04A 4YFUA 1DTTA 3UKUB 4KBOA 1RDBA 4K41A 2Z1JA 4JK8A 4BR0A 3ATVA 4WF9L 2BTFA 4IOCL 1BG3A 2PZSA 5AQUA 1XWLA 3VEXA 5HRPA 1X9MA 3SQ1A 4H5TA 3NH1A 3ZX0A 2BH1A 3OYBA 4GKKK 2NRVA 4PY5A 4BY9C 3LDLA 4DU4A 4KHPK 1ESVA 2E6LA 3HYFA 4O4GA 4CERA 2X74A 3BP8A 5F1XA 3L8BA 3D7EO 4CHNA 3JYTA 4DFJA 4Z4IA 1IKYA 3MDQA 1KC8O 1UA1A 4A2BA 1W9HA 1SKWA 5M1NA 3KVGA 5CYQA 4BR2A 3LWLA 3VF4A 2D0AA 3H1QA 2NRZA 1TAQA 3A5OC 2G8WA 1P8ZA 2ATQA 2GV9A 2O8DB 2RPIA 2KTQA 1RTJA 4DTNA 3HVTA 2WBNA 1VSMA 2BDPA 2JWKA 4CZKA 2F8TA 3GBTA 3BZKA 4WFNL 5GIOA 1X1PA 2NRWA 2D1KA 4DQSA 3H45C 1X3NA 2KW4A 4H8KA 4FJNA 3U3YA 1YHQN 4JKGA 3HOTA 4FJIA 4AHVA 3EZWA 2YJFA 4JS4A 1NKEA 4BRKA 5GADP 3TU5A 2YKMA 4LSLA 3G71N 3CQ8A 3EKUA 3MEEA 3VEZA 2HHVA 3CPWM 4B8CA 3AVGA 1NGGA 2HF3A 3HT3A 3ZSXA 4JI0K 5CHIA 1QZ6A 3DAWA 5IT9O 1MWMA 1N8RO 3T1YK 4FCYA 1L3TA 3BGRA 4BRGA 5LJVA 1RBUA 3O9SA 4I2QA 4O8KA 5FPMA 1YVNA 2VQFK 4ILGB 3D2EA 1Q86O 1IKVA 5AZIA 5EOYA 4CGGA 3CCVN 1VSJA 2PAVA 1OH5A 3U6FA 3VMFB 1BU6O 5C25A 4JHDA 2ZWHA 2CGJA 2KFNA 1UAXA 3THVA 1NGAA 3FLCO 1BA1A 3KLHA 2VG7A 3TTFA 2A42A 2V7YA 3RRGA 3SBTA 4DTUA 4BR4A 4DU3A 4GV3A 4JKDA 1WSJA 4FM1A 1D8YA 3QLHA 2QEXN 4DSJA 5JLHA 3LDOA 3SUOA 4JS5A 3P4IA 4CF9A 4B9TA 1TUUA 3V1QA 3O4NA 3CYMA 5FPEA 1ZC6A 4FLTA 3MMVA 3S41A 5BPLA 4HVJA 1TKXA 4MLHA 4ZHRA 1LAVA 3TSQA 3GDQA 2KFZA 3EO3A 3AARA 4CFCA 3SAHA 1KVCA 1BI4B 3CM6A 3LANA 4CEQA 4BRQA 4FJHA 2OPPA 4LH4A 3M8PA 4E19A 3I56N 1QHAA 1A5VA 3OYDA 1NJYA 4IFEA 4CZLA 4DR1K 3F2KA 2X78A 3F73A 3TANA 5M1QA 5F0XA 3QFPA 3VQ7A 3SYZA 4LF6K 2OTJN 2QWPA 4CBXA 1WBDA 5GAHP 3UKUA 2OPRA 5AQJA 4DQ8A 3W3DA 1VSIA 2CH6A 4IXCA 1BGXT 3VQCA 3H08A 3OW2M 2YCHA 1TYQB 4R79A 5LL6Z 3S9HA 2FLOA 2D0OA 5FPNA 3OYMA 1HYSA 3CI5A 4CEFA 3ZT4A 5AQYA 1S1TA 3EY1A 2A1RA 5BRDA 1ZYQA 2BE2A 4I9LA 3V9WA 1U45A 4KHSA 1GLCG 3AAQA 4DLGA 4DR7K 2G8VA 3HO1A 1OH6A 3HSCA 1RTDA 1O1WA 1NK0A 1C0MA 4WYBA 1ITGA 1RCHA 4CEDA 3TTCA 3M8RA 3F9MA 3NF8A 3CETA 1HKBA 4QOZB 3AO1A 1Q7YO 3ATUA 3GOIA 5JICA 3NH0A 2JWLA 1N32K 3ENBA 3MN9A 1IG9A 4A59A 4DTRA 4BGBA 1VQPN 2G8HA 5C15A 2HHSA 2OCEA 3IFRA 5J2PA 4FJLA 1S6QA 4N41A 1VSDA 2P9PB 1KTQA 3M8SA 2UXDK 5C0YA 4JAXA 3T3FA 1ZBSA 1U4BA 4X65K 4KREA 3CCQN 1ZXOA 4NLBA 1J5EK 2X6NA 2VYPA 4BC3A 2NRTA 4FJGA 2UXBK 4HCBA 3LM9A 4JKEA 4H0XB 3HM8A 2DFHA 3M5RA 4H4MA 1ASUA 4M3WA 3OYEA 3V9XA 2E5LK 5EX5A 3WEEB 4X62K 1DEJA 4M3RA 3LP0A 4A2AA 3CCMN 1VQ8N 2Q31A 4HCCA 2IGIA 3ZYYX 4DTXA 3E01A 4RW4A 4CCHA 4Q5VA 4JRPA 1S5JA 4CJLA 4BVPA 2E2OA 3IS9A 3RVCA 1S1XA 2XY8A 2YJEA 4I6MB 1DGKN 4A61A 4W5NA 4NLCA 4JKAA 2ZF5O 3VESA 4FM2A 1TVRA 2HHUA 4H0PA 4V19S 5CY4A 4BQLA 4MLEA 3UB5A 4L8RB 5E41A 1FKPA 3TR8A 3PX6A 1MDUB 3KIOA 4DR4K 2A6AA 4CZEA 3J7AP 3THYA 3VETA 1C0FA 4B3RK 1NM1A 2BANA 1JLGA 1IV0A 3PO5A 1LWEA 4FZZA 3V9SA 2KZMA 5CZ2A 2G8IA 1SAZA 4CZFA 3LM2A 1BI4A 1VQON 5E84A 4CEAA 4ELVA 4NCGA 4WE1A 1CXQA 1M1KO 2NRXA 2Y1IA 3J80O 3CD6N 4LD0A 3PIOL 5KI6A 1LAWA 3OS2A 2F8SA 3C95A 5M1KA 4CF1A 3LDQA 1RT5A 2QA4N 1YTUA 1EWQA 4B9QA 1J6ZA 2E2QA 1VRUA 1HPMA 1Z6RA 2HMIA 4N56A 3A5LC 3CPEA 4O5BA 5GIPA 1HJOA 3FFIA 3GL1A 4CF2A 1DLOA 1XMQK 1KAYA 4C8MA 2OZMA 3N4PA 3E9PA 2KLAA 1BL3A 1CZBA 3ZSRA 2P5GA 1CLQA 2IIRA 3T1HK 5HROA 2ASPA 3MEDA 1TYQA 3HTVA 3MECA 2GX9A 4CESA 3AO5A 5JS2A 2A40A 1YIJN 1NMDA 2P9IA 5CZ1A 3MCPA 3AA5X 4IDKA 3MN6A 1P90A 4H0OA 1Z05A 3DLHA 1YF5L 4YHHK 4DR5K 2QWMA 1WNSA 3L6QA 3KWIA 3TAGA 5AFUA 3V1RA 2GWJA 3K9JA 3CFRA 2O8BB 1GOAA 2VG5A 3HP9A 4W5RA 3OYJA 4C23A 2W40A 4B3SK 1KSPA 3CJCA 3VERA 4AM6A 3VA0A 3RMBA 1JLAA 4A62A 4LF7K 4FWLA 4BC5A 3OHRA 3VF2A 2FSNA 3PV8A 3O4WA 4KH5A 3DLEA 3VEYA 5CYMA 5FRNA 1YITN 1Q8IA 4BRPA 3F9KA 3TPQA 3U9DA 2YHBA 3SJJA 1WAJA 4KI6A 1SL1A 2GWKA 4OGCA 4JRQA 2QWQA 4CBWA 1YXQA 3SUNA 3D2FB 2P9KA 1NGIA 1T6CA 5J2NA 1NKCA 4DR6K 4J2AA 1RFQA 3VTHA 1U6ZA 1V4SA 2Z1HA 3DWLA 3O1BA 3CC4N 3CCRN 4KO0A 3AVLA 1I3AA 5AQLA 4B08A 4YOXA 4DV7K 1Y64A 4A5AA 3BEXA 1W97L 3WEEA 3VEOA 2DFEA 4H5NA 3EYZA 3HPOA 1B9FA 3TSUA 4CJFA 3LP1A 2AA4A 1TKZA 1Z25A 3V81A 3T1AA 2E1ZA 3EN9A 2NUBA 4CZMA 3ZT3A 4Y1DA 1B9DA 2JLEA 3E1YA 1KVAA 1QZ5A 1FXXA 1I94K 2XRIA 2WTUA 1U2VA 4JI8K 4IWVA 4K0KK 1LW2A 2D4WA 3L2RA 1ZBIA 1YTAA 1JCGA 2OTLN 2IVNA 3J8AA 1HX1A 4WQ4C 3VN5A 4H0YB 3QEXA 4JKFA 4DTPA 4IG0A 1NOZA 4CZJA 1UOCA 2WONA 3O8MA 2VCPA 5AQFA 4DUZK 5AQOA 3ULEB 2KZZA 4BQZA 4E7LA 4WQ4A 4KRFA 1IKXA 4WQ5C 3VA3A 3DJCA 5JLFA 1XNQK 4HUGA 3K5LA 5C42A 1WSHA 5AQNA 3PUFA 4KHQA 2Q3SA 4FPBA 1TUYA 5I9EB 1SL0A 4ZTJA 3H6EA 1VSEA 5LMNK 1S1VA 4KB1A 4DV1K 1S3XA 3WT0A 2VWKA 4CGHA 1OVYA 3NFAA 5KGXA 4WFBL 1TAUA 1FK9A 3TAEA 1KCFA 2XY6A 2P51A 2GTDA 4X66K 2PYLA 1OVQA 2HF4A 4FW1A 1UA0A 3CFOA 1C1CA 4BRAA 4XH1A 3W0LA 3U3GA 4CEZA 2UXCK 2IC3A 1NGBA 3PIPL 1XQSC 3T69A 3DI6A 4UQGA 2UYTA 4PUOA 4MQ3A 3VQEA 4NYNA 1HYZA 4E7KA 2R7YA 2Y1JA 4FJ9A 3L2UA 3EZ5A 4HUEA 3TTDA 3E66A 4GW6A 5AQWA 1HRHA 4K8ZA 4DS5A 3AGKA 5JVGL 2EWSA 1WSGA 4DFMA 4IKFA 1D9FA 2O8BA 2O8CB 2QK9A 3L2QA 2UU9K 2YI1A 1HYVA 4NXMK 5BR8K 1ZBLA 2DPNA 5DK5A 3A5MC 5B8HA 4F9OA 1VQ4N 1J53A 4H4OA 4PL8A 4DV4K 1XHZA 3AO4A 3E9OA 1IH7A 4FK4A 4NCBA 2HNYA 4ZTFA 2W6KA 4AM7A 1SUQA 1VHXA 4IJNA 2RN2A 4AF1A 4CJVA 3DXKA 3LPUA 3CCLN 4LF4K 3K59A 3OYGA 4JD2B 4ISGA 1T7PA 4B3OA 3OBWA 4YOUA 2VQEK 3O80A 1K9MO 3D2FA 4CFDA 2OANA 2P9NA 1ATNA 4YOVA 2EHGA 1YI2N 4KH6A 1R0AA 4Z4GA 1O13A 4HTUA 2OA8A 1WSEA 4PL7A 3RMAA 5BN9A 4DFPA 3WQUA 3O6WA 3C6AA 4AILC 1QVFM 4B1VA 3G6EN 4MDBA 1Q82O 3BF1A 4H0TB 1NJXA 1NK5A 4JKHA 4CJ3A 4GVEA 4DUYK 1LCUA 1DT9A 3MN7A 1BDGA 5AQHA 1NOYA 3C0BA 4E7JA 2DY4A 1SS6A 3T19A 1IBLK 5KRTA 3DOKA 2G8UA 1RDAA 4FWRA 3NDKA 4IO9L 4QS8A 4DQIA 4OPKA 5FLXO 4Q0BA 1RBRA 4DSKA 3KLIA 3R8EA 3AVIA 3CCSN 2YX6A 2QKKA 1VSLA 4GVMA 1LOTB 3NAEA 2E6MA 5J2MA 1BCMA 3IKMA 2PY5A 3WUHA 3ITHA 3D6RA 3HK2A 4EP5A 4JI4K 4O5FA 4CE9A 3QEIA 4E7HA 3SPZA 3QETA 3PX0A 4CJ5A 1NJWA 2QTDA 2FBVA 4R5PA 5AQXA 2ZE2A 3DOLA 4BE2A 3LDSA 5BR9A 3O4QA 3OS1A 3V9UA 2HNZA 3M1FA 4EZ6A 5BPNA 2HHTA 3VPZA 4OKEA 1SQKA 3SK3A 3AA2A 4BE1A 2IVPA 3AY9A 1K73O 4EZ9A 3QEVA 1TV6A 4JK9A 3SMPA 3VF6A 1IG8A 1RT3A 2QW9A 4NCAA 1WN7A 3ZT1A 3BUZB 5AZJB 4E3SA 4KV8A 1GLBG 3SQ4A 3KK7A 1NNEA 4PKGA 2Z1GA 3JSMA 2NZTA 3QERA 1K6YA 4CZIA 4XH4A 2O8EB 3MXMA 5HL7L 1OKJA 3AO2A 4B3MK 4FWSA 4B9NA 1JLEA 4CGFA 3CXCM 4FJJA 3RSEB 3K0SA 2WFBA 3MX2A 1BUPA 4BRMA 3C94A 1REVA 1RDDA 1Y97A 4Z4CA 1VQ6N 1RT1A 4M3TA 1HNZK 3TARA 4CJPA 3LAMA 2O8DA 3ZETB 4F2RA 2WC9A 3L0QA 1LW0A 1QE1A 4CD3A 4CEBA 4FJ7A 4FK0A 4FZYA 1EETA 1R59O 5KQDA 4BRLA 1QSSA 4IDHA 2O8CA 1IJJA 3OYNA 4OPAA 3LZJA 2I7NA 4YNQA 3P83D 3PSFA 4J8FA 4B9LA 3I55N 4CZGA 2J4RA 3SV4A 1XNRK 3WQTA 4DLEA 3CM5A 1L5UA 2ZJPL 3S3NA 1A5WA 4DTMA 5DM6L 3MEGA 1MWKA 2CGKA 3UE5A 4IEEA 1GLEG 3V9ZA 1YUWA 4M3ZA 4FPAA 3PSIA 4C8OA 1HLUA 4KKOA 1RBTA 4N47A 4H5VA 1VQ5N 1FW6A 4JD2A 3KD5E 2YNFA 2IDOA 2FBTA
chains in the Genus database with same CATH topology
4OLAA 1U04A 4YFUA 1DTTA 3C6TA 3TAGA 3G0ZA 1F21A 1RDBA 4HUFA 1BCOA 3V1RA 2Z1JA 1NK8A 4FK2A 3G10A 3CFRA 4FLZA 1LV5A 1GOAA 2PZSA 1XWLA 3DRRA 2VG5A 5HRPA 1X9MA 3SQ1A 3NCIA 3NH1A 1WLJA 3HP9A 4W5RA 3OYBA 3OYJA 3WNFA 3QEWA 4PWDA 2KQ2A 4CJQA 4PY5A 2G8FA 1EP4A 4DU4A 4KPYA 4G1QA 3WNGA 1J9AA 4M3XA 5K14A 1KSPA 3VA0A 3RMBA 2E6LA 3HYFA 1JLAA 4O4GA 1SKSA 1TL3A 2B5JA 4CERA 1T03A 4HHTA 2X74A 3PV8A 1IO2A 3L8BA 4LH5A 3DLEA 3LAKA 4CHNA 3OS0A 4DQRA 5CYMA 3JYTA 2OPSA 4DFJA 5FRNA 4Z4IA 1Q8IA 4B9SA 1IKYA 5SWMA 4FLWA 3F9KA 1X9WA 1UA1A 4C8NA 3L2WA 2YHBA 3SJJA 1W9HA 4OVLA 3K5NA 1SKWA 1WAJA 4KI6A 3DRPA 1SL1A 5CYQA 2YHAA 3HL8A 3NGIA 2IOCA 1QQCA 5C24A 4OGCA 2GUIA 5KRSA 2D0AA 3LWLA 3HP6A 4JRQA 3RR7A 3ISNC 3SUNA 4J2DA 1TAQA 3OY9A 1BHLA 1TK0A 2G8WA 2ATQA 2GV9A 3KKSA 1Q9XA 2RPIA 4IBNA 1RT6A 5J2NA 1NKCA 2KTQA 1HNIA 4Y1CA 5HRRA 1RTJA 4N5SA 3NGZA 2FBXA 2RF2A 4DTNA 4J2AA 2Z1HA 3HVTA 3DRSA 1S6PA 4JLHA 4Z0UA 3DMJA 1VSMA 4KO0A 2BDPA 3AVLA 2F8TA 4B9UA 4C8LA 1I3AA 1JL2A 1ZBFA 4B08A 1MU2A 1RT4A 3KLEA 4O0JA 4PA1A 1VSFA 1X1PA 4BDZA 3DYAA 4BDYA 3PX4A 4BACA 4DQSA 3PY8A 2DFEA 3EYZA 2AJQA 4ELUA 3P1GA 1KFSA 3HPOA 3I0RA 1B9FA 2KW4A 4H8KA 3VQ6A 4KB0A 4FJNA 3U3YA 4CJFA 3LP1A 3OVNA 3WNEA 1RDCA 1TKZA 1Z25A 5FRMA 4FJIA 3V81A 4AHVA 4RW6A 1VSHA 3T1AA 4EP4A 3SNNA 3SZ2A 4E1MA 4M3UA 2A1SA 2NUBA 4JS4A 1C1BA 1KFDA 3ZT3A 1NKEA 1VRTA 4Y1DA 2YKMA 1B9DA 2JLEA 3DM2A 4LSLA 1C1AA 3CQ8A 1BISA 1KVAA 3MEEA 1FXXA 2HHVA 4B8CA 3CFPA 2OZSA 3AVGA 3D45A 4CHOA 1RTHA 2XRIA 4DS4A 3AVBA 4AHTA 1D9DA 4KHYA 3HT3A 3ZSXA 1LW2A 4CHZA 3D0PA 1C6VA 3L2RA 4O44A 4CJUA 1G15A 1ZBIA 3RTVA 2E4LA 2IAJA 3OYFA 4M45A 1YTAA 3TABA 4PQUA 4FCYA 1JLFA 3BGRA 1NK6A 1L3TA 3V6DA 3DLKA 4MFBA 1RBUA 3OYCA 3ULDA 2B4JA 4I2QA 3VN5A 1RT7A 3QEXA 1U49A 4DTPA 4KHUA 4IG0A 3IRXA 2ZQBA 4ELTA 1NOZA 4FLYA 1IKVA 1UOCA 1TL1A 2WONA 4IG3A 1NK4A 4CGGA 4CEOA 2KZZA 5SZTA 3QO9A 4E7LA 2F96A 4DQQA 4CK2A 1IKXA 4KRFA 1VSJA 3VA3A 3LP3A 3AVJA 4HUGA 3K5LA 4GMJB 5C42A 3U6FA 3HJFA 1WSHA 1YVUA 3HPHA 5C25A 3PUFA 1C0TA 1ZBUA 2XHBA 1RBVA 2KFNA 5HP1A 1UAXA 4KHQA 3THVA 3TAFA 2Q3SA 4QCLA 1NKBA 1RBSA 3AVAA 3K5OA 1SL0A 4ZTJA 1HNVA 1VSEA 3KLHA 1S1VA 4CJRA 2VG7A 4KB1A 5HRNA 4XIUA 4KFBA 3IAYA 1SL2A 3RRGA 1NK7A 4W5OA 2VWKA 4DTUA 4DU3A 1WSJA 2ITGA 3NBPA 4CGHA 4FM1A 1EKEA 1D8YA 2P5OA 3NFAA 3OYHA 5KGXA 4FJXA 1TAUA 1LWFA 3QLHA 2X6SA 4I9QA 3MAQA 4DSJA 1FK9A 1KVBA 4KTWA 1KCFA 3WNHA 3TAEA 4JS5A 4CGJA 3SUOA 2XY6A 2P51A 2FBYA 1QSLA 4CF9A 3AVNA 4B9TA 1HQUA 3RMCA 2PYLA 4NYFA 4KAZA 2DFFA 3A2FA 4FW1A 3V1QA 3O4NA 3CFOA 4CFAA 1UA0A 1C1CA 2HB5A 3CYMA 2VWJA 4FLTA 4BWJA 3U3GA 4CEZA 3AVKA 1U48A 4DTJA 1B92A 4HVJA 3O3HA 1TKXA 4ZHRA 1LAVA 4LSNA 2IC3A 3KK3A 2KFZA 4FW2A 4CFCA 4FJ8A 1KVCA 1BI4B 3DI6A 3CM6A 4I2PA 4OKKA 1TK8A 4OJRA 4DSLA 4UQGA 1T05A 3LANA 4CEQA 4M41A 3SV3A 4DSEA 3HVRA 1SKRA 4F2SA 4PUOA 3OYLA 1HMVA 4MQ3A 3VQEA 3KD1E 4NYNA 3UIQA 1HYZA 2OPPA 4FJHA 4LH4A 3M8PA 3TAQA 4E19A 5T7BA 3OYKA 4E7KA 1A5VA 1JXBA 2YV0X 3OYDA 1NJYA 1N5YA 2R7YA 1TKDA 2X78A 3F73A 3I8DA 3L3UA 2Y1JA 4FJ9A 3TANA 3L2UA 5HBMA 2RKIA 3EZ5A 4HUEA 3AVFA 1YT3A 3AA3A 3VQ7A 3SYZA 1KRPA 4GW6A 1JLQA 4CF8A 4CIGA 1HRHA 4K8ZA 4DS5A 4ID1A 2OPRA 3ZSWA 1WSGA 4CHPA 4DFMA 1D9FA 4IKFA 2HW3A 1WSFA 3L3VA 1QSYA 2YNHA 3NF9A 3L2QA 2QK9A 1S9EA 3SQ2A 1DTQA 1TKTA 1VSIA 3I0SA 1HYVA 3QNNA 4J2EA 3QIPA 1BGXT 3KTQA 2PYJA 3C6UA 3IG1A 3VQCA 4DTOA 1BQNA 1JKHA 2GBZA 4O0IA 3RMDA 1ZBLA 3H08A 3P5JA 3TAMA 3HM9A 5DK5A 2YNGA 1Z26A 3MXJA 4F4KA 4FLVA 2D5RA 5EU7A 3S9HA 4Z4HA 5HLFA 3LZIA 1TK5A 1Q9YA 5J1EA 4E0DA 3OYMA 4M3YA 1HYSA 1ASWA 2LSNA 4CEFA 3O3FA 5JS1A 3ZT4A 1J53A 1S1TA 4H4OA 2ZD1A 3EY1A 2A1RA 1XHZA 3ZT2A 1ZYQA 3ZSYA 3AO4A 2QXFA 4M42A 2BE2A 4I9LA 1QTMA 3V9WA 3RRHA 1IH7A 4FK4A 4NCBA 2HNYA 4ZTFA 1U45A 4DF4A 1CZ9A 4DF8A 1SUQA 4CJVA 3SQ0A 2RN2A 4KHSA 4FM0A 3LPUA 4DLGA 2G8VA 4CK3A 3NF6A 3K59A 3HO1A 2O4IA 3OYGA 1JXEA 4CK1A 2D0CA 1RTDA 1S1UA 3AO3A 1T7PA 1O1WA 1NK0A 1C0MA 1JLBA 1ITGA 4B3OA 1RCHA 4CEEA 4DFKA 4CEDA 3M8RA 4CFDA 3NF8A 2HVHA 3SPYA 3S3MA 2EHGA 4CJTA 5I3UA 2O4GA 4QOZB 3AO1A 1R0AA 4Z4GA 4CECA 4CF0A 4HTUA 2OA8A 3QINA 1WSEA 3VQ9A 3OYAA 5J2QA 3RMAA 1VSKA 1CXUA 4DFPA 1NJZA 3MXIA 4AILC 3NH0A 3K5MA 2QKBA 2DTUA 3K2PA 1NJXA 1TGOA 2YNIA 1IG9A 4DTRA 3S3OA 1NK5A 4CJ3A 3VQ4A 4CGIA 4DMNA 5FDLA 2G8HA 1FKOA 1RILA 4FLUA 3VQQA 1T8EA 2HHSA 5J2PA 3M8QA 3TI0A 4FJLA 3SCXA 4W5TA 4Z4FA 1NOYA 4B8AB 1S6QA 3KLFA 4B9VA 3ASMA 1VSDA 3B6PA 2P1JA 4E7JA 4N41A 4Z4EA 2DY4A 1D5AA 3T19A 1KTQA 5DMRA 2G8KA 5KRTA 3DOKA 3M8SA 1I39A 2G8UA 1RDAA 3NHGA 3NDKA 1GOBA 2YKNA 4CJEA 3T3FA 1U4BA 4BWMA 4DQIA 2D0BA 4CGDA 4OPKA 4OLBA 4KREA 4Q0BA 1RBRA 4DSKA 3KLIA 1EX4A 3B6OA 3NF7A 3AVIA 5HRSA 4FJKA 3PO4A 1SV5A 2X6NA 4CFBA 3LP2A 2QKKA 1VSLA 4FJGA 4GVMA 1N6QA 4HCBA 3NAEA 2E6MA 1XI1A 4KHWA 3SUPA 1S1WA 5J2MA 4OKJA 4N76A 1BCMA 2DFHA 2PY5A 3NGYA 4H4MA 3ITHA 3NE6A 3NH2A 1ASUA 2XY5A 4EP5A 4CE9A 4M3WA 3HK2A 4J2BA 3AA4A 3ZCMA 3QEIA 3OYEA 3V9XA 4E7HA 4KTZA 2Z1IA 3DLGA 4BE0A 1KLNA 1XHXA 2WOMA 4DU1A 3SPZA 2ETJA 4RG8A 3QETA 4M3RA 3KLGA 4OGEA 3PX0A 1IKWA 4KHNA 3LP0A 1S9GA 4CJ5A 1NJWA 1JL1A 2FBVA 4HCCA 4R5PA 2IGIA 2HHWA 4OPJA 2ZE2A 4DTXA 3DOLA 3E01A 4RW4A 1X9SA 4BE2A 4E1NA 3LDSA 4CCHA 3VQPA 4Q5VA 2JGUA 3O4QA 1S5JA 3KKRA 3OJSA 4JRPA 4F8RA 4CJLA 3DLRA 2I5JA 3OS1A 3V9UA 2W42A 1WSIA 1W0HA 2HNZA 3LPTA 3IS9A 1EXQA 1S1XA 4FVMA 2XY8A 3O3GA 4EZ6A 2HHTA 1L3UA 4W5NA 4LY7A 4OKEA 3ZT0A 4FM2A 1TVRA 2HHUA 1HJRA 1BIUA 3AA2A 4BE1A 3HXMA 4DQPA 3SUQA 5CY4A 3K58A 3ZSVA 1BIZA 4B9MA 4EZ9A 4ID5A 1U47A 3QEVA 1TV6A 4RW8A 1RT3A 4L8RB 4NCAA 5E41A 1WN7A 3AVHA 1RNHA 3ZT1A 4FJ5A 1FKPA 3TR8A 4E3SA 3PX6A 4KV8A 3SQ4A 4FYDA 1KLMA 2Z1GA 3KIOA 3JSMA 4ICLA 3VQ8A 4BDPA 3HSTB 1RT2A 3LALA 2B6AA 3QERA 2HVIA 4AHSA 4K8XA 1K6YA 3KK1A 4FZXC 3TWHA 1ZBHA 2BANA 3MXMA 1QS4A 1JLGA 4FJMA 4RW7A 3AO2A 3PO5A 5D3GA 1HPZA 4AHUA 1LWEA 4B9NA 1JLEA 4CGFA 4IFVA 3V9SA 3QEPA 5I42A 4F3OA 4FZZA 5CZ2A 2G8IA 2XO7A 4FJJA 4ELVA 1BI4A 2KZMA 1WAFA 4CEAA 3DLBA 4NCGA 2XY7A 1BQMA 2HNDA 1CXQA 4WE1A 3VQDA 3OYIA 3V1OA 2Y1IA 3C94A 1REVA 3QIOA 1RDDA 1Y97A 3AV9A 1UWBA 4LD0A 4DTSA 5KI6A 4Z4CA 5KTQA 1RT1A 4M3TA 3RR8A 1LAWA 4O55A 4AHRA 3OS2A 2F8SA 3AVCA 3C95A 4CF1A 2HHQA 2OYQA 3TARA 1RT5A 4CJPA 4F3TA 1YTUA 4AH9A 3LAMA 4KI4A 3VQBA 1J54A 4F2RA 2BGGA 1VRUA 4DSIA 1LW0A 1QE1A 3OJUA 4CEBA 4DG1A 3KK2A 4FJ7A 1VK0A 4CHQA 4AHCA 3K57A 4FK0A 4CJKA 2HMIA 1EETA 3AVMA 4FZYA 2HHXA 3RWUA 4N56A 2IS3A 3L2VA 4KTQA 4O5BA 4DWIA 3FFIA 3SI6A 4CJSA 1QHTA 1XC9A 4CF2A 1QSSA 1DLOA 4C8MA 2OZMA 3KJVA 3OYNA 5FROA 4E89A 4IFYA 4CJWA 1BL3A 1CZBA 3ZSRA 3LZJA 2P5GA 1A5XA 3CG7A 3VQ5A 3P83D 3VQAA 4YNQA 4E7IA 4FXDA 4B9LA 1CLQA 5HROA 5KGWA 3SV4A 3MEDA 3ALYA 4RW9A 3LWMA 3BDPA 4DLEA 4FLXA 3ZSOA 3CM5A 1L3SA 1L3VA 4I7FA 1L5UA 4C8KA 1GOCA 3QNOA 4CJ4A 3MECA 3V4IA 3S3NA 1A5WA 4CESA 4DTMA 3AO5A 1J5OA 5JS2A 2VG6A 1RTIA 3MEGA 1ASVA 4DSFA 5CZ1A 1HQEA 2EX3A 3V9ZA 3AA5X 1NK9A 1JLCA 4W5QA 4IDKA 4M3ZA 4QAGA 1C0UA 2OPQA 3ZSQA 4C8OA 4CHYA 3TAPA 4KKOA 3QESA 3DLHA 1RBTA 3ZSZA 4CIFA 4N47A 3HPGA 4TSXA 3KD5E 1LWCA 2YNFA 4CIEA 2IDOA 2FBTA 2FC0A 1WNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLA A;  1U04 A;  4YFU A;  1DTT A;  3C6T A;  3TAG A;  3G0Z A;  1F21 A;  1RDB A;  4HUF A;  1BCO A;  3V1R A;  2Z1J A;  1NK8 A;  4FK2 A;  3G10 A;  3CFR A;  4FLZ A;  1LV5 A;  1GOA A;  2PZS A;  1XWL A;  3DRR A;  2VG5 A;  5HRP A;  1X9M A;  3SQ1 A;  3NCI A;  3NH1 A;  1WLJ A;  3HP9 A;  4W5R A;  3OYB A;  3OYJ A;  3WNF A;  3QEW A;  4PWD A;  2KQ2 A;  4CJQ A;  4PY5 A;  2G8F A;  1EP4 A;  4DU4 A;  4KPY A;  4G1Q A;  3WNG A;  1J9A A;  4M3X A;  5K14 A;  1KSP A;  3VA0 A;  3RMB A;  2E6L A;  3HYF A;  1JLA A;  4O4G A;  1SKS A;  1TL3 A;  2B5J A;  4CER A;  1T03 A;  4HHT A;  2X74 A;  3PV8 A;  1IO2 A;  3L8B A;  4LH5 A;  3DLE A;  3LAK A;  4CHN A;  3OS0 A;  4DQR A;  5CYM A;  3JYT A;  2OPS A;  4DFJ A;  5FRN A;  4Z4I A;  1Q8I A;  4B9S A;  1IKY A;  5SWM A;  4FLW A;  3F9K A;  1X9W A;  1UA1 A;  4C8N A;  3L2W A;  2YHB A;  3SJJ A;  1W9H A;  4OVL A;  3K5N A;  1SKW A;  1WAJ A;  4KI6 A;  3DRP A;  1SL1 A;  5CYQ A;  2YHA A;  3HL8 A;  3NGI A;  2IOC A;  1QQC A;  5C24 A;  4OGC A;  2GUI A;  5KRS A;  2D0A A;  3LWL A;  3HP6 A;  4JRQ A;  3RR7 A;  3ISN C;  3SUN A;  4J2D A;  1TAQ A;  3OY9 A;  1BHL A;  1TK0 A;  2G8W A;  2ATQ A;  2GV9 A;  3KKS A;  1Q9X A;  2RPI A;  4IBN A;  1RT6 A;  5J2N A;  1NKC A;  2KTQ A;  1HNI A;  4Y1C A;  5HRR A;  1RTJ A;  4N5S A;  3NGZ A;  2FBX A;  2RF2 A;  4DTN A;  4J2A A;  2Z1H A;  3HVT A;  3DRS A;  1S6P A;  4JLH A;  4Z0U A;  3DMJ A;  1VSM A;  4KO0 A;  2BDP A;  3AVL A;  2F8T A;  4B9U A;  4C8L A;  1I3A A;  1JL2 A;  1ZBF A;  4B08 A;  1MU2 A;  1RT4 A;  3KLE A;  4O0J A;  4PA1 A;  1VSF A;  1X1P A;  4BDZ A;  3DYA A;  4BDY A;  3PX4 A;  4BAC A;  4DQS A;  3PY8 A;  2DFE A;  3EYZ A;  2AJQ A;  4ELU A;  3P1G A;  1KFS A;  3HPO A;  3I0R A;  1B9F A;  2KW4 A;  4H8K A;  3VQ6 A;  4KB0 A;  4FJN A;  3U3Y A;  4CJF A;  3LP1 A;  3OVN A;  3WNE A;  1RDC A;  1TKZ A;  1Z25 A;  5FRM A;  4FJI A;  3V81 A;  4AHV A;  4RW6 A;  1VSH A;  3T1A A;  4EP4 A;  3SNN A;  3SZ2 A;  4E1M A;  4M3U A;  2A1S A;  2NUB A;  4JS4 A;  1C1B A;  1KFD A;  3ZT3 A;  1NKE A;  1VRT A;  4Y1D A;  2YKM A;  1B9D A;  2JLE A;  3DM2 A;  4LSL A;  1C1A A;  3CQ8 A;  1BIS A;  1KVA A;  3MEE A;  1FXX A;  2HHV A;  4B8C A;  3CFP A;  2OZS A;  3AVG A;  3D45 A;  4CHO A;  1RTH A;  2XRI A;  4DS4 A;  3AVB A;  4AHT A;  1D9D A;  4KHY A;  3HT3 A;  3ZSX A;  1LW2 A;  4CHZ A;  3D0P A;  1C6V A;  3L2R A;  4O44 A;  4CJU A;  1G15 A;  1ZBI A;  3RTV A;  2E4L A;  2IAJ A;  3OYF A;  4M45 A;  1YTA A;  3TAB A;  4PQU A;  4FCY A;  1JLF A;  3BGR A;  1NK6 A;  1L3T A;  3V6D A;  3DLK A;  4MFB A;  1RBU A;  3OYC A;  3ULD A;  2B4J A;  4I2Q A;  3VN5 A;  1RT7 A;  3QEX A;  1U49 A;  4DTP A;  4KHU A;  4IG0 A;  3IRX A;  2ZQB A;  4ELT A;  1NOZ A;  4FLY A;  1IKV A;  1UOC A;  1TL1 A;  2WON A;  4IG3 A;  1NK4 A;  4CGG A;  4CEO A;  2KZZ A;  5SZT A;  3QO9 A;  4E7L A;  2F96 A;  4DQQ A;  4CK2 A;  1IKX A;  4KRF A;  1VSJ A;  3VA3 A;  3LP3 A;  3AVJ A;  4HUG A;  3K5L A;  4GMJ B;  5C42 A;  3U6F A;  3HJF A;  1WSH A;  1YVU A;  3HPH A;  5C25 A;  3PUF A;  1C0T A;  1ZBU A;  2XHB A;  1RBV A;  2KFN A;  5HP1 A;  1UAX A;  4KHQ A;  3THV A;  3TAF A;  2Q3S A;  4QCL A;  1NKB A;  1RBS A;  3AVA A;  3K5O A;  1SL0 A;  4ZTJ A;  1HNV A;  1VSE A;  3KLH A;  1S1V A;  4CJR A;  2VG7 A;  4KB1 A;  5HRN A;  4XIU A;  4KFB A;  3IAY A;  1SL2 A;  3RRG A;  1NK7 A;  4W5O A;  2VWK A;  4DTU A;  4DU3 A;  1WSJ A;  2ITG A;  3NBP A;  4CGH A;  4FM1 A;  1EKE A;  1D8Y A;  2P5O A;  3NFA A;  3OYH A;  5KGX A;  4FJX A;  1TAU A;  1LWF A;  3QLH A;  2X6S A;  4I9Q A;  3MAQ A;  4DSJ A;  1FK9 A;  1KVB A;  4KTW A;  1KCF A;  3WNH A;  3TAE A;  4JS5 A;  4CGJ A;  3SUO A;  2XY6 A;  2P51 A;  2FBY A;  1QSL A;  4CF9 A;  3AVN A;  4B9T A;  1HQU A;  3RMC A;  2PYL A;  4NYF A;  4KAZ A;  2DFF A;  3A2F A;  4FW1 A;  3V1Q A;  3O4N A;  3CFO A;  4CFA A;  1UA0 A;  1C1C A;  2HB5 A;  3CYM A;  2VWJ A;  4FLT A;  4BWJ A;  3U3G A;  4CEZ A;  3AVK A;  1U48 A;  4DTJ A;  1B92 A;  4HVJ A;  3O3H A;  1TKX A;  4ZHR A;  1LAV A;  4LSN A;  2IC3 A;  3KK3 A;  2KFZ A;  4FW2 A;  4CFC A;  4FJ8 A;  1KVC A;  1BI4 B;  3DI6 A;  3CM6 A;  4I2P A;  4OKK A;  1TK8 A;  4OJR A;  4DSL A;  4UQG A;  1T05 A;  3LAN A;  4CEQ A;  4M41 A;  3SV3 A;  4DSE A;  3HVR A;  1SKR A;  4F2S A;  4PUO A;  3OYL A;  1HMV A;  4MQ3 A;  3VQE A;  3KD1 E;  4NYN A;  3UIQ A;  1HYZ A;  2OPP A;  4FJH A;  4LH4 A;  3M8P A;  3TAQ A;  4E19 A;  5T7B A;  3OYK A;  4E7K A;  1A5V A;  1JXB A;  2YV0 X;  3OYD A;  1NJY A;  1N5Y A;  2R7Y A;  1TKD A;  2X78 A;  3F73 A;  3I8D A;  3L3U A;  2Y1J A;  4FJ9 A;  3TAN A;  3L2U A;  5HBM A;  2RKI A;  3EZ5 A;  4HUE A;  3AVF A;  1YT3 A;  3AA3 A;  3VQ7 A;  3SYZ A;  1KRP A;  4GW6 A;  1JLQ A;  4CF8 A;  4CIG A;  1HRH A;  4K8Z A;  4DS5 A;  4ID1 A;  2OPR A;  3ZSW A;  1WSG A;  4CHP A;  4DFM A;  1D9F A;  4IKF A;  2HW3 A;  1WSF A;  3L3V A;  1QSY A;  2YNH A;  3NF9 A;  3L2Q A;  2QK9 A;  1S9E A;  3SQ2 A;  1DTQ A;  1TKT A;  1VSI A;  3I0S A;  1HYV A;  3QNN A;  4J2E A;  3QIP A;  1BGX T;  3KTQ A;  2PYJ A;  3C6U A;  3IG1 A;  3VQC A;  4DTO A;  1BQN A;  1JKH A;  2GBZ A;  4O0I A;  3RMD A;  1ZBL A;  3H08 A;  3P5J A;  3TAM A;  3HM9 A;  5DK5 A;  2YNG A;  1Z26 A;  3MXJ A;  4F4K A;  4FLV A;  2D5R A;  5EU7 A;  3S9H A;  4Z4H A;  5HLF A;  3LZI A;  1TK5 A;  1Q9Y A;  5J1E A;  4E0D A;  3OYM A;  4M3Y A;  1HYS A;  1ASW A;  2LSN A;  4CEF A;  3O3F A;  5JS1 A;  3ZT4 A;  1J53 A;  1S1T A;  4H4O A;  2ZD1 A;  3EY1 A;  2A1R A;  1XHZ A;  3ZT2 A;  1ZYQ A;  3ZSY A;  3AO4 A;  2QXF A;  4M42 A;  2BE2 A;  4I9L A;  1QTM A;  3V9W A;  3RRH A;  1IH7 A;  4FK4 A;  4NCB A;  2HNY A;  4ZTF A;  1U45 A;  4DF4 A;  1CZ9 A;  4DF8 A;  1SUQ A;  4CJV A;  3SQ0 A;  2RN2 A;  4KHS A;  4FM0 A;  3LPU A;  4DLG A;  2G8V A;  4CK3 A;  3NF6 A;  3K59 A;  3HO1 A;  2O4I A;  3OYG A;  1JXE A;  4CK1 A;  2D0C A;  1RTD A;  1S1U A;  3AO3 A;  1T7P A;  1O1W A;  1NK0 A;  1C0M A;  1JLB A;  1ITG A;  4B3O A;  1RCH A;  4CEE A;  4DFK A;  4CED A;  3M8R A;  4CFD A;  3NF8 A;  2HVH A;  3SPY A;  3S3M A;  2EHG A;  4CJT A;  5I3U A;  2O4G A;  4QOZ B;  3AO1 A;  1R0A A;  4Z4G A;  4CEC A;  4CF0 A;  4HTU A;  2OA8 A;  3QIN A;  1WSE A;  3VQ9 A;  3OYA A;  5J2Q A;  3RMA A;  1VSK A;  1CXU A;  4DFP A;  1NJZ A;  3MXI A;  4AIL C;  3NH0 A;  3K5M A;  2QKB A;  2DTU A;  3K2P A;  1NJX A;  1TGO A;  2YNI A;  1IG9 A;  4DTR A;  3S3O A;  1NK5 A;  4CJ3 A;  3VQ4 A;  4CGI A;  4DMN A;  5FDL A;  2G8H A;  1FKO A;  1RIL A;  4FLU A;  3VQQ A;  1T8E A;  2HHS A;  5J2P A;  3M8Q A;  3TI0 A;  4FJL A;  3SCX A;  4W5T A;  4Z4F A;  1NOY A;  4B8A B;  1S6Q A;  3KLF A;  4B9V A;  3ASM A;  1VSD A;  3B6P A;  2P1J A;  4E7J A;  4N41 A;  4Z4E A;  2DY4 A;  1D5A A;  3T19 A;  1KTQ A;  5DMR A;  2G8K A;  5KRT A;  3DOK A;  3M8S A;  1I39 A;  2G8U A;  1RDA A;  3NHG A;  3NDK A;  1GOB A;  2YKN A;  4CJE A;  3T3F A;  1U4B A;  4BWM A;  4DQI A;  2D0B A;  4CGD A;  4OPK A;  4OLB A;  4KRE A;  4Q0B A;  1RBR A;  4DSK A;  3KLI A;  1EX4 A;  3B6O A;  3NF7 A;  3AVI A;  5HRS A;  4FJK A;  3PO4 A;  1SV5 A;  2X6N A;  4CFB A;  3LP2 A;  2QKK A;  1VSL A;  4FJG A;  4GVM A;  1N6Q A;  4HCB A;  3NAE A;  2E6M A;  1XI1 A;  4KHW A;  3SUP A;  1S1W A;  5J2M A;  4OKJ A;  4N76 A;  1BCM A;  2DFH A;  2PY5 A;  3NGY A;  4H4M A;  3ITH A;  3NE6 A;  3NH2 A;  1ASU A;  2XY5 A;  4EP5 A;  4CE9 A;  4M3W A;  3HK2 A;  4J2B A;  3AA4 A;  3ZCM A;  3QEI A;  3OYE A;  3V9X A;  4E7H A;  4KTZ A;  2Z1I A;  3DLG A;  4BE0 A;  1KLN A;  1XHX A;  2WOM A;  4DU1 A;  3SPZ A;  2ETJ A;  4RG8 A;  3QET A;  4M3R A;  3KLG A;  4OGE A;  3PX0 A;  1IKW A;  4KHN A;  3LP0 A;  1S9G A;  4CJ5 A;  1NJW A;  1JL1 A;  2FBV A;  4HCC A;  4R5P A;  2IGI A;  2HHW A;  4OPJ A;  2ZE2 A;  4DTX A;  3DOL A;  3E01 A;  4RW4 A;  1X9S A;  4BE2 A;  4E1N A;  3LDS A;  4CCH A;  3VQP A;  4Q5V A;  2JGU A;  3O4Q A;  1S5J A;  3KKR A;  3OJS A;  4JRP A;  4F8R A;  4CJL A;  3DLR A;  2I5J A;  3OS1 A;  3V9U A;  2W42 A;  1WSI A;  1W0H A;  2HNZ A;  3LPT A;  3IS9 A;  1EXQ A;  1S1X A;  4FVM A;  2XY8 A;  3O3G A;  4EZ6 A;  2HHT A;  1L3U A;  4W5N A;  4LY7 A;  4OKE A;  3ZT0 A;  4FM2 A;  1TVR A;  2HHU A;  1HJR A;  1BIU A;  3AA2 A;  4BE1 A;  3HXM A;  4DQP A;  3SUQ A;  5CY4 A;  3K58 A;  3ZSV A;  1BIZ A;  4B9M A;  4EZ9 A;  4ID5 A;  1U47 A;  3QEV A;  1TV6 A;  4RW8 A;  1RT3 A;  4L8R B;  4NCA A;  5E41 A;  1WN7 A;  3AVH A;  1RNH A;  3ZT1 A;  4FJ5 A;  1FKP A;  3TR8 A;  4E3S A;  3PX6 A;  4KV8 A;  3SQ4 A;  4FYD A;  1KLM A;  2Z1G A;  3KIO A;  3JSM A;  4ICL A;  3VQ8 A;  4BDP A;  3HST B;  1RT2 A;  3LAL A;  2B6A A;  3QER A;  2HVI A;  4AHS A;  4K8X A;  1K6Y A;  3KK1 A;  4FZX C;  3TWH A;  1ZBH A;  2BAN A;  3MXM A;  1QS4 A;  1JLG A;  4FJM A;  4RW7 A;  3AO2 A;  3PO5 A;  5D3G A;  1HPZ A;  4AHU A;  1LWE A;  4B9N A;  1JLE A;  4CGF A;  4IFV A;  3V9S A;  3QEP A;  5I42 A;  4F3O A;  4FZZ A;  5CZ2 A;  2G8I A;  2XO7 A;  4FJJ A;  4ELV A;  1BI4 A;  2KZM A;  1WAF A;  4CEA A;  3DLB A;  4NCG A;  2XY7 A;  1BQM A;  2HND A;  1CXQ A;  4WE1 A;  3VQD A;  3OYI A;  3V1O A;  2Y1I A;  3C94 A;  1REV A;  3QIO A;  1RDD A;  1Y97 A;  3AV9 A;  1UWB A;  4LD0 A;  4DTS A;  5KI6 A;  4Z4C A;  5KTQ A;  1RT1 A;  4M3T A;  3RR8 A;  1LAW A;  4O55 A;  4AHR A;  3OS2 A;  2F8S A;  3AVC A;  3C95 A;  4CF1 A;  2HHQ A;  2OYQ A;  3TAR A;  1RT5 A;  4CJP A;  4F3T A;  1YTU A;  4AH9 A;  3LAM A;  4KI4 A;  3VQB A;  1J54 A;  4F2R A;  2BGG A;  1VRU A;  4DSI A;  1LW0 A;  1QE1 A;  3OJU A;  4CEB A;  4DG1 A;  3KK2 A;  4FJ7 A;  1VK0 A;  4CHQ A;  4AHC A;  3K57 A;  4FK0 A;  4CJK A;  2HMI A;  1EET A;  3AVM A;  4FZY A;  2HHX A;  3RWU A;  4N56 A;  2IS3 A;  3L2V A;  4KTQ A;  4O5B A;  4DWI A;  3FFI A;  3SI6 A;  4CJS A;  1QHT A;  1XC9 A;  4CF2 A;  1QSS A;  1DLO A;  4C8M A;  2OZM A;  3KJV A;  3OYN A;  5FRO A;  4E89 A;  4IFY A;  4CJW A;  1BL3 A;  1CZB A;  3ZSR A;  3LZJ A;  2P5G A;  1A5X A;  3CG7 A;  3VQ5 A;  3P83 D;  3VQA A;  4YNQ A;  4E7I A;  4FXD A;  4B9L A;  1CLQ A;  5HRO A;  5KGW A;  3SV4 A;  3MED A;  3ALY A;  4RW9 A;  3LWM A;  3BDP A;  4DLE A;  4FLX A;  3ZSO A;  3CM5 A;  1L3S A;  1L3V A;  4I7F A;  1L5U A;  4C8K A;  1GOC A;  3QNO A;  4CJ4 A;  3MEC A;  3V4I A;  3S3N A;  1A5W A;  4CES A;  4DTM A;  3AO5 A;  1J5O A;  5JS2 A;  2VG6 A;  1RTI A;  3MEG A;  1ASV A;  4DSF A;  5CZ1 A;  1HQE A;  2EX3 A;  3V9Z A;  3AA5 X;  1NK9 A;  1JLC A;  4W5Q A;  4IDK A;  4M3Z A;  4QAG A;  1C0U A;  2OPQ A;  3ZSQ A;  4C8O A;  4CHY A;  3TAP A;  4KKO A;  3QES A;  3DLH A;  1RBT A;  3ZSZ A;  4CIF A;  4N47 A;  3HPG A;  4TSX A;  3KD5 E;  1LWC A;  2YNF A;  4CIE A;  2IDO A;  2FBT A;  2FC0 A;  1WNS A; 
#chains in the Genus database with same CATH topology
 3SJH A;  3C6T A;  2GEL A;  3G0Z A;  1F21 A;  4HUF A;  1NK8 A;  4FLZ A;  2ZJQ L;  1Q18 A;  2HBM A;  5KPZ A;  3NCI A;  1GLJ O;  4DR2 K;  2KQ2 A;  2G8F A;  4KPY A;  2YHY A;  3WNG A;  2V52 B;  1J9A A;  4M3X A;  3CJ9 A;  4NXN K;  1SKS A;  2AP1 A;  2B5J A;  4HHT A;  3ZLJ A;  3CIP A;  5JVH L;  1IO2 A;  3LAK A;  1HNX K;  4FLW A;  1X9W A;  3CMA N;  4DV2 K;  4C8N A;  3L2W A;  5LJW A;  4OVL A;  5BRF A;  3NGI A;  2IOC A;  5C24 A;  3HP6 A;  3ISN C;  3OY9 A;  1BHL A;  4DKW A;  1TK0 A;  1EQY A;  3EE8 A;  1JJ2 M;  3KKS A;  1X9J A;  1NLV A;  4Y1C A;  5KQ8 A;  3M6G A;  2FBX A;  3THW B;  4JLH A;  4Z0U A;  4GKJ K;  3QBX A;  4DHY A;  1YJN N;  4B9U A;  1JL2 A;  1ZBF A;  3FE1 A;  1MU2 A;  2P9U B;  1N34 K;  4C8L A;  4H5W A;  1RT4 A;  3KLE A;  4O0J A;  4PA1 A;  4JYA K;  1VSF A;  3AGR A;  3VTI A;  3DYA A;  4BDY A;  4BDZ A;  1KD1 O;  3P1G A;  1KFS A;  5CE3 A;  5KPT A;  4KB0 A;  3VQ6 A;  1RDC A;  4LFC K;  4RW6 A;  1VSH A;  3O5B A;  3VGK A;  4BRE A;  1FJG K;  3SNN A;  1VQ7 N;  4M3U A;  2A1S A;  1C1B A;  1N36 K;  1VRT A;  4JI2 K;  1C1A A;  1BIS A;  3ENH A;  4BRD A;  3CFP A;  2I7P A;  5H1S Q;  2OZS A;  4FWP A;  3AVB A;  4AHT A;  1D9D A;  2ITM A;  3D0P A;  1D4X A;  4CJU A;  1G15 A;  4BR5 A;  3RTV A;  2IAJ A;  3TAB A;  3O08 A;  2QWO A;  4CD1 A;  1JLF A;  4ILH A;  2ZGY A;  3I8B A;  5AZJ A;  4MFB A;  3OYC A;  3H3N O;  3CER A;  1RT7 A;  1U49 A;  2Q0U A;  4K25 A;  4G9Z A;  4YOY A;  1NWK A;  3U4L A;  3IRX A;  2ZQB A;  3LDP A;  5HOO A;  3N4Q A;  4JI5 K;  4CEO A;  3G25 A;  1WB9 A;  3F5T A;  1KAX A;  2FXU A;  3QO9 A;  2O8F B;  3LP3 A;  3AVJ A;  4GMJ B;  4DV5 K;  1C0T A;  3CF5 L;  3QDK A;  2HBK A;  3TAF A;  4QCL A;  3BZC A;  1RBS A;  3AVA A;  1KQS M;  3LDN A;  3H1V X;  2QM1 A;  5HRN A;  4LF9 K;  4KFB A;  3HZ6 A;  3ZEU B;  1JCF A;  1NK7 A;  3ZET A;  1QQN A;  3NBP A;  1EKE A;  4C1N I;  3U9Z A;  2P5O A;  4FJX A;  3C65 A;  4FWM A;  1KVB A;  4JI1 K;  1NJI O;  4BC4 A;  1KAZ A;  4IEI A;  2FBY A;  1QSL A;  1HQU A;  1NGH A;  4DV3 K;  4NYF A;  3RMC A;  2DFF A;  3A2F A;  1GLA G;  1WOQ A;  5BPM A;  2VWJ A;  4BRC A;  3AVK A;  3QML A;  1V4T A;  3O3H A;  2Q0R A;  3QBW A;  2HST A;  4X64 K;  4LSN A;  5GAE P;  3KK3 A;  1GLD G;  3C6H A;  3GG4 A;  4ILJ A;  1TK8 A;  4OJR A;  4DR3 K;  5TKY A;  1T05 A;  2P9P A;  4DSE A;  3HVR A;  1SKR A;  2E20 A;  3CCE N;  1HMV A;  2V51 B;  3KD1 E;  3UIQ A;  5CR4 A;  4YDU C;  4UY8 O;  3OYK A;  1JXB A;  2YV0 X;  3EKS A;  1TKD A;  3DLL L;  3I8D A;  3L3U A;  2RKI A;  4JNE A;  3AA3 A;  4YDU A;  1JLQ A;  4CF8 A;  4CHP A;  2HW3 A;  1G99 A;  2ZGZ A;  1QSY A;  4LF8 K;  1DTQ A;  3I33 A;  5KPR A;  3QNN A;  2PYJ A;  3C6U A;  4DTO A;  1BQN A;  2GBZ A;  5AFU H;  2E2P A;  3HM9 A;  2UUC K;  2A41 A;  3KZB A;  4F4K A;  2D5R A;  4Z4H A;  5AZI B;  4E0D A;  5J1E A;  4LFB K;  3O1W A;  3J81 O;  2LSN A;  3Q7B A;  4YOT A;  3O3F A;  4B1U B;  4RCH A;  3WXI A;  1HUX A;  2ZD1 A;  4CVN E;  1C0G A;  4I6M A;  3RRH A;  4JHD B;  3SQ0 A;  5AJ3 K;  4FM0 A;  3NF6 A;  2O4I A;  3AO3 A;  3SBG A;  1JLB A;  4C1N K;  4CEE A;  3WXK A;  4DFK A;  1HKC A;  1NMN A;  2FF3 B;  4EHU A;  3SPY A;  3A8Y A;  3S3M A;  4CJT A;  4A57 A;  1EWR A;  5MLC Q;  1GLL O;  4JEP A;  5EY4 A;  5J2Q A;  1VSK A;  2RE2 A;  3EEQ A;  1NJZ A;  3MXI A;  2DTU A;  4KH4 A;  3K2P A;  2YNI A;  3S3O A;  3VQ4 A;  2GEM A;  4CGI A;  4DMN A;  1NGE A;  1X3M A;  5FDL A;  2F9W A;  5ADX H;  4FLU A;  1GLF O;  2Q97 A;  4BRI A;  4ISF A;  1VQK N;  2QWN A;  3M8Q A;  4W5T A;  4B8A B;  4GV9 A;  2PFU A;  1QQM A;  1D5A A;  2G8K A;  2KKZ A;  3VGM A;  3FZH A;  4CJ7 A;  4FWK A;  1QQO A;  4BWM A;  2D0B A;  5AQI A;  4CGD A;  4FWN A;  3B6O A;  1SV5 A;  4CFB A;  1N6Q A;  4FWQ A;  3GE1 A;  4CZH A;  4KHW A;  1S1W A;  4N76 A;  3PLA A;  3HOS A;  3NH2 A;  2XY5 A;  4J2B A;  3AA4 A;  3ZCM A;  2NRR A;  4FOE A;  1XHX A;  4JKC A;  1JCE A;  3KLG A;  4OGE A;  4KHN A;  5AQR A;  1JL1 A;  3VEW A;  4OPJ A;  2O8F A;  3MWP A;  4EIA A;  4OO1 J;  1X9S A;  2JGU A;  4F8R A;  3OJS A;  3KKR A;  2I5J A;  1WSI A;  1W0H A;  1EXQ A;  3LL3 A;  2RHK A;  3ZT0 A;  2IVO A;  3SAG A;  4XH5 A;  3ZEU A;  2E2N A;  3SLC A;  3K58 A;  4Y0W A;  4L3Q A;  4M7Y A;  1T6D A;  1RNH A;  4FJ5 A;  2QWL A;  3FFK B;  4YOW A;  4B1X B;  1T3V A;  2H3G X;  3ID8 A;  2ZJR L;  2HVI A;  3MCA B;  4FZX C;  3H46 O;  4FJM A;  3B8A X;  2ZM6 K;  1YAG A;  5D3G A;  1BO5 O;  4AHU A;  3R6M A;  4NB4 A;  4IFV A;  3R3L A;  2HHH K;  2XO7 A;  5AQM A;  4BG8 A;  4LF5 K;  2XY7 A;  3VQD A;  3OYI A;  3AV9 A;  3P39 A;  1QVG M;  5KTQ A;  3RR8 A;  4O55 A;  4AHR A;  3AVC A;  3QIC A;  3WXL A;  3HRG A;  4AH9 A;  5E26 A;  2D0P A;  3UKR B;  1J54 A;  3OBY A;  4IOX A;  4DSI A;  3KK2 A;  4DG1 A;  1VK0 A;  4O8U A;  1BA0 A;  4AHC A;  4CHQ A;  3K57 A;  4CJK A;  3RWU A;  2IS3 A;  3L2V A;  1VQ9 N;  3SI6 A;  2P9L B;  4CJS A;  1QHT A;  4HTL A;  4CBU A;  1N33 K;  1A5X A;  3CG7 A;  3VQA A;  1XC3 A;  4U7B A;  2P9S B;  2UUA K;  3A5N C;  3BDP A;  3EE9 A;  2E8A A;  5AQG A;  4FLX A;  4I7F A;  4C8K A;  3MN5 A;  4CJ4 A;  1K8K B;  1J5O A;  4FVU A;  2VG6 A;  1RTI A;  1ASV A;  1HQE A;  2EX3 A;  1NK9 A;  2HMP A;  4W5Q A;  1RDU A;  1C0U A;  2OPQ A;  4CIF A;  3HPG A;  3L4I A;  4CIE A;  1NGJ A;  2FC0 A;  1BIZ A;  3NHG A;  2NNW A;  4WCE L;  5DM7 L;  2W6L A;  4FK2 A;  1BCO A;  4B1Y B;  3G10 A;  5IWA K;  1LV5 A;  3DRR A;  1WLJ A;  4PHT X;  3WNF A;  3QEW A;  3J7Z O;  5C10 A;  4PWD A;  4CJQ A;  4E1J A;  1EP4 A;  3ULE A;  4G1Q A;  5K14 A;  4IOA L;  3THY B;  1TL3 A;  2A3Z A;  1HNW K;  5AQS A;  1T03 A;  4LH5 A;  1OH7 A;  3NMU A;  4DQR A;  3OS0 A;  2OPS A;  4B9S A;  5SWM A;  4LC9 B;  3K5N A;  2QI2 A;  3DRP A;  2E1Y A;  2YHA A;  3HL8 A;  1QQC A;  2GUI A;  5KRS A;  3KHY A;  2VGN A;  3RR7 A;  5ELZ A;  4J2D A;  4FL9 A;  3R9P A;  5M1P A;  3WXJ A;  4CI6 A;  3ID6 A;  1Q9X A;  4IBN A;  1RT6 A;  4AQY K;  2F4V K;  1HNI A;  1DKG D;  5HRR A;  4N5S A;  3NGZ A;  2HOE A;  2RF2 A;  4PKI A;  3DRS A;  1S6P A;  3DMJ A;  3P38 A;  2GUP A;  5C2F A;  4M7X A;  1VQN N;  3PX4 A;  3PY8 A;  4BAC A;  4EFH A;  5AQK A;  1E4F T;  3THX B;  2AJQ A;  2Q36 A;  3VEV A;  4ELU A;  4H5R A;  3I0R A;  1HKG A;  3OVN A;  3WNE A;  3VGL A;  5FRM A;  3K9K A;  1S22 A;  4FWO A;  4EP4 A;  3SZ2 A;  4E1M A;  3O9T A;  1KFD A;  4Z94 A;  3T7Z A;  3DM2 A;  4CW7 B;  5M1O A;  3AAP A;  1XMO K;  3FZM A;  2P9I B;  2KHO A;  3D45 A;  1RTH A;  4CHO A;  4DS4 A;  4KHY A;  2FSK A;  1OH8 A;  4EHT A;  4CHZ A;  1C6V A;  1WUA A;  4WFA L;  4O44 A;  2E4L A;  3OYF A;  4M45 A;  4PQU A;  5AQP A;  1BOT O;  4IO8 A;  1NK6 A;  3V6D A;  4DB3 A;  3DLK A;  3ULD A;  1CZA N;  2B4J A;  4KHU A;  5A2Q O;  4ELT A;  1BWF O;  4FLY A;  1NK4 A;  1TL1 A;  4IG3 A;  4MDA A;  1NGC A;  5SZT A;  2F96 A;  4DQQ A;  4CK2 A;  1VQM N;  5BN8 A;  3HI0 A;  3HJF A;  5BRE A;  4QS7 A;  1YVU A;  3HPH A;  1VQL N;  1ZBU A;  2XHB A;  2FSJ A;  1RBV A;  5HP1 A;  1VAZ A;  1NKB A;  3QFU A;  3NVK A;  3K5O A;  1HNV A;  3O9U A;  4CJR A;  4BRN A;  4XIU A;  3DXM B;  4IJA A;  3IAY A;  3CME N;  1SL2 A;  3UKR A;  4W5O A;  1YJW N;  3HBT A;  2ITG A;  1KXP A;  3OYH A;  4JN4 A;  5AQZ A;  1LWF A;  2X6S A;  4I9Q A;  3MAQ A;  4KTW A;  2P9K B;  3WNH A;  3FGU A;  4CGJ A;  2P9L A;  4BVO A;  4JV5 K;  1H1V A;  1YJ9 N;  3IUC A;  3AVN A;  2A5X A;  4KAZ A;  3MWT A;  4CFA A;  2HB5 A;  5EXW A;  1NGD A;  4BWJ A;  3E9L A;  1U48 A;  4DTJ A;  1B92 A;  2P9S A;  1W7A A;  2Q1N A;  4JI3 K;  1SZ2 A;  4FW2 A;  4FJ8 A;  3FR0 A;  3BF3 A;  4I2P A;  4OKK A;  3G4S N;  4DSL A;  4M41 A;  4M63 C;  3SV3 A;  3C7N B;  4F2S A;  3OYL A;  1K8K A;  3TAQ A;  5T7B A;  3EL2 A;  3MX5 A;  2QXL A;  4K43 A;  3CJB A;  5HBM A;  5FPD A;  4ISE A;  3AVF A;  1YT3 A;  1KRP A;  1U2V B;  3CCJ N;  4CIG A;  5AQV A;  4BR7 A;  1NG9 A;  4JI6 K;  4ID1 A;  3ZSW A;  2Q2R A;  3MK6 A;  3BY5 A;  3ZX3 A;  4BRF A;  1WSF A;  3L3V A;  4OX9 K;  2YNH A;  3NF9 A;  4NO7 A;  4FOI A;  1S9E A;  3SQ2 A;  1TKT A;  3I0S A;  3O9R A;  5C12 A;  4J2E A;  3QIP A;  3KTQ A;  3IG1 A;  1JKH A;  4O0I A;  4MO5 A;  3RMD A;  3P5J A;  3TAM A;  2W41 A;  2YHX A;  2YNG A;  1Z26 A;  2FF6 A;  2HBJ A;  3MXJ A;  4DCH A;  5EU7 A;  5M1F A;  4FLV A;  5HLF A;  3LZI A;  1TK5 A;  1Q9Y A;  4M3Y A;  1ASW A;  5JS1 A;  3CQX A;  3ENO A;  3ZT2 A;  3ZSY A;  2QXF A;  4M42 A;  1XUP O;  1QTM A;  2E88 A;  4DF4 A;  1CZ9 A;  4DF8 A;  4CK3 A;  3IDH A;  3R1X A;  1WBB A;  1JXE A;  4CK1 A;  2D0C A;  1S1U A;  3CJ7 A;  3OA9 A;  4OPH A;  2NLX A;  3CC2 N;  2HVH A;  1NBW A;  5I3U A;  2O4G A;  4K42 A;  1S72 N;  4CEC A;  4CF0 A;  3JAM O;  3QIN A;  3VQ9 A;  3OYA A;  2F7T A;  1CXU A;  2O8E A;  1IBK K;  1ATR A;  5AQQ A;  2HBL A;  3K5M A;  2QKB A;  5LMU K;  4BGA A;  4DV0 K;  1TGO A;  3CC7 N;  3THX A;  4MO4 A;  4GV6 A;  5AR0 A;  3RSE A;  3CCU N;  4JKB A;  1FKO A;  1RIL A;  1T8E A;  3VQQ A;  3FZK A;  3H3O B;  1IBM K;  4B1W B;  2ASM A;  1NGF A;  4FSV A;  3TI0 A;  3SCX A;  3FZF A;  4Z4F A;  3KLF A;  4B9V A;  4Z4E A;  3ASM A;  3VEN A;  3B6P A;  2P1J A;  3SAF A;  3L4Q A;  5DMR A;  1I39 A;  4BRO A;  4BRH A;  1GOB A;  2YKN A;  4CJE A;  5GAG P;  3CQY A;  4H0V B;  4OLB A;  3NF7 A;  1EX4 A;  5HRS A;  4FJK A;  4BG9 A;  3PO4 A;  3LP2 A;  3KWG A;  3O9Q A;  3ZX2 A;  5EVZ A;  1XI1 A;  3SUP A;  3Q7C A;  4OKJ A;  2V7Z A;  1MA9 B;  3NGY A;  3NE6 A;  4KTZ A;  2Z1I A;  3DLG A;  4BE0 A;  1KLN A;  2WOM A;  4DU1 A;  4EAH D;  2ETJ A;  4RG8 A;  4YY3 K;  1IKW A;  1S9G A;  1EO1 A;  3VOV A;  4JKG B;  2HHW A;  2YHW A;  4RTF D;  4E1N A;  4DV6 K;  3VQP A;  4JI7 K;  3DLR A;  1Q81 O;  2W42 A;  3LPT A;  4BC2 A;  5AQT A;  4FVM A;  3O3G A;  1L3U A;  2VWB A;  4LY7 A;  3DXM A;  3DXK B;  1HJR A;  2ASO A;  1BIU A;  3HXM A;  4DQP A;  3SUQ A;  3TSP A;  3ZSV A;  4B9M A;  4ID5 A;  1W2B M;  1U47 A;  4RW8 A;  3AVH A;  3CJA A;  4GNI A;  3CHW A;  4QS9 A;  4JK7 A;  4FYD A;  2P9N B;  1KLM A;  4HWI A;  4PKH A;  4ICL A;  3VQ8 A;  4BDP A;  3HST B;  4U67 L;  1RT2 A;  3LAL A;  2B6A A;  3D2E B;  4AHS A;  1E4G T;  4K8X A;  3KK1 A;  3JXU A;  3TWH A;  1ZBH A;  2QWR A;  1QS4 A;  2CH5 A;  1NU0 A;  5ADX A;  4RW7 A;  2PBD A;  3FZL A;  1HPZ A;  5I42 A;  3QEP A;  1M90 O;  4F3O A;  1K8A O;  1WAF A;  3DLB A;  1BQM A;  2HND A;  3V1O A;  3QIO A;  3C7N A;  1UWB A;  3WXM B;  4DTS A;  4RWT A;  2HHQ A;  3QB0 A;  4GY2 B;  2OYQ A;  2NRH A;  3JS6 A;  4F3T A;  5BRH A;  2BUP A;  4KI4 A;  3VQB A;  4B3T K;  3IMX A;  2BGG A;  3U8X A;  3OJU A;  3THW A;  3AVM A;  2HHX A;  4BR9 A;  3J7Y P;  4KTQ A;  3CJ1 A;  4DWI A;  4FO0 A;  1XC9 A;  2P9U A;  1RGI A;  3P31 A;  3KJV A;  5FRO A;  4E89 A;  4IFY A;  2WUS A;  4H03 B;  4CJW A;  2UUB K;  1RDW X;  1T44 A;  4B1Z A;  3OTO K;  1HR0 K;  4FXD A;  3VQ5 A;  4E7I A;  5TKW A;  2F9T A;  5C2D A;  1ILY A;  5KGW A;  4RW9 A;  3ALY A;  3LWM A;  4YOR A;  2VGM A;  1ATS A;  3NVM A;  3ZSO A;  5GIN A;  1L3S A;  1L3V A;  5LY3 A;  1GOC A;  3QNO A;  3V4I A;  1E3M A;  4DSF A;  4LFA K;  1JLC A;  2CGL A;  4QAG A;  3ZSQ A;  4CHY A;  3SMS A;  4A5B A;  3TAP A;  4IZ9 A;  3QES A;  3A0I X;  5F2R A;  3ZSZ A;  4WQ5 A;  5JMV A;  4TSX A;  1LWC A;  1N5Y A;  3M3Z A;  4OLA A;  4XEI A;  1U04 A;  4YFU A;  1DTT A;  3UKU B;  4KBO A;  1RDB A;  4K41 A;  2Z1J A;  4JK8 A;  4BR0 A;  3ATV A;  4WF9 L;  2BTF A;  4IOC L;  1BG3 A;  2PZS A;  5AQU A;  1XWL A;  3VEX A;  5HRP A;  1X9M A;  3SQ1 A;  4H5T A;  3NH1 A;  3ZX0 A;  2BH1 A;  3OYB A;  4GKK K;  2NRV A;  4PY5 A;  4BY9 C;  3LDL A;  4DU4 A;  4KHP K;  1ESV A;  2E6L A;  3HYF A;  4O4G A;  4CER A;  2X74 A;  3BP8 A;  5F1X A;  3L8B A;  3D7E O;  4CHN A;  3JYT A;  4DFJ A;  4Z4I A;  1IKY A;  3MDQ A;  1KC8 O;  1UA1 A;  4A2B A;  1W9H A;  1SKW A;  5M1N A;  3KVG A;  5CYQ A;  4BR2 A;  3LWL A;  3VF4 A;  2D0A A;  3H1Q A;  2NRZ A;  1TAQ A;  3A5O C;  2G8W A;  1P8Z A;  2ATQ A;  2GV9 A;  2O8D B;  2RPI A;  2KTQ A;  1RTJ A;  4DTN A;  3HVT A;  2WBN A;  1VSM A;  2BDP A;  2JWK A;  4CZK A;  2F8T A;  3GBT A;  3BZK A;  4WFN L;  5GIO A;  1X1P A;  2NRW A;  2D1K A;  4DQS A;  3H45 C;  1X3N A;  2KW4 A;  4H8K A;  4FJN A;  3U3Y A;  1YHQ N;  4JKG A;  3HOT A;  4FJI A;  4AHV A;  3EZW A;  2YJF A;  4JS4 A;  1NKE A;  4BRK A;  5GAD P;  3TU5 A;  2YKM A;  4LSL A;  3G71 N;  3CQ8 A;  3EKU A;  3MEE A;  3VEZ A;  2HHV A;  3CPW M;  4B8C A;  3AVG A;  1NGG A;  2HF3 A;  3HT3 A;  3ZSX A;  4JI0 K;  5CHI A;  1QZ6 A;  3DAW A;  5IT9 O;  1MWM A;  1N8R O;  3T1Y K;  4FCY A;  1L3T A;  3BGR A;  4BRG A;  5LJV A;  1RBU A;  3O9S A;  4I2Q A;  4O8K A;  5FPM A;  1YVN A;  2VQF K;  4ILG B;  3D2E A;  1Q86 O;  1IKV A;  5AZI A;  5EOY A;  4CGG A;  3CCV N;  1VSJ A;  2PAV A;  1OH5 A;  3U6F A;  3VMF B;  1BU6 O;  5C25 A;  4JHD A;  2ZWH A;  2CGJ A;  2KFN A;  1UAX A;  3THV A;  1NGA A;  3FLC O;  1BA1 A;  3KLH A;  2VG7 A;  3TTF A;  2A42 A;  2V7Y A;  3RRG A;  3SBT A;  4DTU A;  4BR4 A;  4DU3 A;  4GV3 A;  4JKD A;  1WSJ A;  4FM1 A;  1D8Y A;  3QLH A;  2QEX N;  4DSJ A;  5JLH A;  3LDO A;  3SUO A;  4JS5 A;  3P4I A;  4CF9 A;  4B9T A;  1TUU A;  3V1Q A;  3O4N A;  3CYM A;  5FPE A;  1ZC6 A;  4FLT A;  3MMV A;  3S41 A;  5BPL A;  4HVJ A;  1TKX A;  4MLH A;  4ZHR A;  1LAV A;  3TSQ A;  3GDQ A;  2KFZ A;  3EO3 A;  3AAR A;  4CFC A;  3SAH A;  1KVC A;  1BI4 B;  3CM6 A;  3LAN A;  4CEQ A;  4BRQ A;  4FJH A;  2OPP A;  4LH4 A;  3M8P A;  4E19 A;  3I56 N;  1QHA A;  1A5V A;  3OYD A;  1NJY A;  4IFE A;  4CZL A;  4DR1 K;  3F2K A;  2X78 A;  3F73 A;  3TAN A;  5M1Q A;  5F0X A;  3QFP A;  3VQ7 A;  3SYZ A;  4LF6 K;  2OTJ N;  2QWP A;  4CBX A;  1WBD A;  5GAH P;  3UKU A;  2OPR A;  5AQJ A;  4DQ8 A;  3W3D A;  1VSI A;  2CH6 A;  4IXC A;  1BGX T;  3VQC A;  3H08 A;  3OW2 M;  2YCH A;  1TYQ B;  4R79 A;  5LL6 Z;  3S9H A;  2FLO A;  2D0O A;  5FPN A;  3OYM A;  1HYS A;  3CI5 A;  4CEF A;  3ZT4 A;  5AQY A;  1S1T A;  3EY1 A;  2A1R A;  5BRD A;  1ZYQ A;  2BE2 A;  4I9L A;  3V9W A;  1U45 A;  4KHS A;  1GLC G;  3AAQ A;  4DLG A;  4DR7 K;  2G8V A;  3HO1 A;  1OH6 A;  3HSC A;  1RTD A;  1O1W A;  1NK0 A;  1C0M A;  4WYB A;  1ITG A;  1RCH A;  4CED A;  3TTC A;  3M8R A;  3F9M A;  3NF8 A;  3CET A;  1HKB A;  4QOZ B;  3AO1 A;  1Q7Y O;  3ATU A;  3GOI A;  5JIC A;  3NH0 A;  2JWL A;  1N32 K;  3ENB A;  3MN9 A;  1IG9 A;  4A59 A;  4DTR A;  4BGB A;  1VQP N;  2G8H A;  5C15 A;  2HHS A;  2OCE A;  3IFR A;  5J2P A;  4FJL A;  1S6Q A;  4N41 A;  1VSD A;  2P9P B;  1KTQ A;  3M8S A;  2UXD K;  5C0Y A;  4JAX A;  3T3F A;  1ZBS A;  1U4B A;  4X65 K;  4KRE A;  3CCQ N;  1ZXO A;  4NLB A;  1J5E K;  2X6N A;  2VYP A;  4BC3 A;  2NRT A;  4FJG A;  2UXB K;  4HCB A;  3LM9 A;  4JKE A;  4H0X B;  3HM8 A;  2DFH A;  3M5R A;  4H4M A;  1ASU A;  4M3W A;  3OYE A;  3V9X A;  2E5L K;  5EX5 A;  3WEE B;  4X62 K;  1DEJ A;  4M3R A;  3LP0 A;  4A2A A;  3CCM N;  1VQ8 N;  2Q31 A;  4HCC A;  2IGI A;  3ZYY X;  4DTX A;  3E01 A;  4RW4 A;  4CCH A;  4Q5V A;  4JRP A;  1S5J A;  4CJL A;  4BVP A;  2E2O A;  3IS9 A;  3RVC A;  1S1X A;  2XY8 A;  2YJE A;  4I6M B;  1DGK N;  4A61 A;  4W5N A;  4NLC A;  4JKA A;  2ZF5 O;  3VES A;  4FM2 A;  1TVR A;  2HHU A;  4H0P A;  4V19 S;  5CY4 A;  4BQL A;  4MLE A;  3UB5 A;  4L8R B;  5E41 A;  1FKP A;  3TR8 A;  3PX6 A;  1MDU B;  3KIO A;  4DR4 K;  2A6A A;  4CZE A;  3J7A P;  3THY A;  3VET A;  1C0F A;  4B3R K;  1NM1 A;  2BAN A;  1JLG A;  1IV0 A;  3PO5 A;  1LWE A;  4FZZ A;  3V9S A;  2KZM A;  5CZ2 A;  2G8I A;  1SAZ A;  4CZF A;  3LM2 A;  1BI4 A;  1VQO N;  5E84 A;  4CEA A;  4ELV A;  4NCG A;  4WE1 A;  1CXQ A;  1M1K O;  2NRX A;  2Y1I A;  3J80 O;  3CD6 N;  4LD0 A;  3PIO L;  5KI6 A;  1LAW A;  3OS2 A;  2F8S A;  3C95 A;  5M1K A;  4CF1 A;  3LDQ A;  1RT5 A;  2QA4 N;  1YTU A;  1EWQ A;  4B9Q A;  1J6Z A;  2E2Q A;  1VRU A;  1HPM A;  1Z6R A;  2HMI A;  4N56 A;  3A5L C;  3CPE A;  4O5B A;  5GIP A;  1HJO A;  3FFI A;  3GL1 A;  4CF2 A;  1DLO A;  1XMQ K;  1KAY A;  4C8M A;  2OZM A;  3N4P A;  3E9P A;  2KLA A;  1BL3 A;  1CZB A;  3ZSR A;  2P5G A;  1CLQ A;  2IIR A;  3T1H K;  5HRO A;  2ASP A;  3MED A;  1TYQ A;  3HTV A;  3MEC A;  2GX9 A;  4CES A;  3AO5 A;  5JS2 A;  2A40 A;  1YIJ N;  1NMD A;  2P9I A;  5CZ1 A;  3MCP A;  3AA5 X;  4IDK A;  3MN6 A;  1P90 A;  4H0O A;  1Z05 A;  3DLH A;  1YF5 L;  4YHH K;  4DR5 K;  2QWM A;  1WNS A;  3L6Q A;  3KWI A;  3TAG A;  5AFU A;  3V1R A;  2GWJ A;  3K9J A;  3CFR A;  2O8B B;  1GOA A;  2VG5 A;  3HP9 A;  4W5R A;  3OYJ A;  4C23 A;  2W40 A;  4B3S K;  1KSP A;  3CJC A;  3VER A;  4AM6 A;  3VA0 A;  3RMB A;  1JLA A;  4A62 A;  4LF7 K;  4FWL A;  4BC5 A;  3OHR A;  3VF2 A;  2FSN A;  3PV8 A;  3O4W A;  4KH5 A;  3DLE A;  3VEY A;  5CYM A;  5FRN A;  1YIT N;  1Q8I A;  4BRP A;  3F9K A;  3TPQ A;  3U9D A;  2YHB A;  3SJJ A;  1WAJ A;  4KI6 A;  1SL1 A;  2GWK A;  4OGC A;  4JRQ A;  2QWQ A;  4CBW A;  1YXQ A;  3SUN A;  3D2F B;  2P9K A;  1NGI A;  1T6C A;  5J2N A;  1NKC A;  4DR6 K;  4J2A A;  1RFQ A;  3VTH A;  1U6Z A;  1V4S A;  2Z1H A;  3DWL A;  3O1B A;  3CC4 N;  3CCR N;  4KO0 A;  3AVL A;  1I3A A;  5AQL A;  4B08 A;  4YOX A;  4DV7 K;  1Y64 A;  4A5A A;  3BEX A;  1W97 L;  3WEE A;  3VEO A;  2DFE A;  4H5N A;  3EYZ A;  3HPO A;  1B9F A;  3TSU A;  4CJF A;  3LP1 A;  2AA4 A;  1TKZ A;  1Z25 A;  3V81 A;  3T1A A;  2E1Z A;  3EN9 A;  2NUB A;  4CZM A;  3ZT3 A;  4Y1D A;  1B9D A;  2JLE A;  3E1Y A;  1KVA A;  1QZ5 A;  1FXX A;  1I94 K;  2XRI A;  2WTU A;  1U2V A;  4JI8 K;  4IWV A;  4K0K K;  1LW2 A;  2D4W A;  3L2R A;  1ZBI A;  1YTA A;  1JCG A;  2OTL N;  2IVN A;  3J8A A;  1HX1 A;  4WQ4 C;  3VN5 A;  4H0Y B;  3QEX A;  4JKF A;  4DTP A;  4IG0 A;  1NOZ A;  4CZJ A;  1UOC A;  2WON A;  3O8M A;  2VCP A;  5AQF A;  4DUZ K;  5AQO A;  3ULE B;  2KZZ A;  4BQZ A;  4E7L A;  4WQ4 A;  4KRF A;  1IKX A;  4WQ5 C;  3VA3 A;  3DJC A;  5JLF A;  1XNQ K;  4HUG A;  3K5L A;  5C42 A;  1WSH A;  5AQN A;  3PUF A;  4KHQ A;  2Q3S A;  4FPB A;  1TUY A;  5I9E B;  1SL0 A;  4ZTJ A;  3H6E A;  1VSE A;  5LMN K;  1S1V A;  4KB1 A;  4DV1 K;  1S3X A;  3WT0 A;  2VWK A;  4CGH A;  1OVY A;  3NFA A;  5KGX A;  4WFB L;  1TAU A;  1FK9 A;  3TAE A;  1KCF A;  2XY6 A;  2P51 A;  2GTD A;  4X66 K;  2PYL A;  1OVQ A;  2HF4 A;  4FW1 A;  1UA0 A;  3CFO A;  1C1C A;  4BRA A;  4XH1 A;  3W0L A;  3U3G A;  4CEZ A;  2UXC K;  2IC3 A;  1NGB A;  3PIP L;  1XQS C;  3T69 A;  3DI6 A;  4UQG A;  2UYT A;  4PUO A;  4MQ3 A;  3VQE A;  4NYN A;  1HYZ A;  4E7K A;  2R7Y A;  2Y1J A;  4FJ9 A;  3L2U A;  3EZ5 A;  4HUE A;  3TTD A;  3E66 A;  4GW6 A;  5AQW A;  1HRH A;  4K8Z A;  4DS5 A;  3AGK A;  5JVG L;  2EWS A;  1WSG A;  4DFM A;  4IKF A;  1D9F A;  2O8B A;  2O8C B;  2QK9 A;  3L2Q A;  2UU9 K;  2YI1 A;  1HYV A;  4NXM K;  5BR8 K;  1ZBL A;  2DPN A;  5DK5 A;  3A5M C;  5B8H A;  4F9O A;  1VQ4 N;  1J53 A;  4H4O A;  4PL8 A;  4DV4 K;  1XHZ A;  3AO4 A;  3E9O A;  1IH7 A;  4FK4 A;  4NCB A;  2HNY A;  4ZTF A;  2W6K A;  4AM7 A;  1SUQ A;  1VHX A;  4IJN A;  2RN2 A;  4AF1 A;  4CJV A;  3DXK A;  3LPU A;  3CCL N;  4LF4 K;  3K59 A;  3OYG A;  4JD2 B;  4ISG A;  1T7P A;  4B3O A;  3OBW A;  4YOU A;  2VQE K;  3O80 A;  1K9M O;  3D2F A;  4CFD A;  2OAN A;  2P9N A;  1ATN A;  4YOV A;  2EHG A;  1YI2 N;  4KH6 A;  1R0A A;  4Z4G A;  1O13 A;  4HTU A;  2OA8 A;  1WSE A;  4PL7 A;  3RMA A;  5BN9 A;  4DFP A;  3WQU A;  3O6W A;  3C6A A;  4AIL C;  1QVF M;  4B1V A;  3G6E N;  4MDB A;  1Q82 O;  3BF1 A;  4H0T B;  1NJX A;  1NK5 A;  4JKH A;  4CJ3 A;  4GVE A;  4DUY K;  1LCU A;  1DT9 A;  3MN7 A;  1BDG A;  5AQH A;  1NOY A;  3C0B A;  4E7J A;  2DY4 A;  1SS6 A;  3T19 A;  1IBL K;  5KRT A;  3DOK A;  2G8U A;  1RDA A;  4FWR A;  3NDK A;  4IO9 L;  4QS8 A;  4DQI A;  4OPK A;  5FLX O;  4Q0B A;  1RBR A;  4DSK A;  3KLI A;  3R8E A;  3AVI A;  3CCS N;  2YX6 A;  2QKK A;  1VSL A;  4GVM A;  1LOT B;  3NAE A;  2E6M A;  5J2M A;  1BCM A;  3IKM A;  2PY5 A;  3WUH A;  3ITH A;  3D6R A;  3HK2 A;  4EP5 A;  4JI4 K;  4O5F A;  4CE9 A;  3QEI A;  4E7H A;  3SPZ A;  3QET A;  3PX0 A;  4CJ5 A;  1NJW A;  2QTD A;  2FBV A;  4R5P A;  5AQX A;  2ZE2 A;  3DOL A;  4BE2 A;  3LDS A;  5BR9 A;  3O4Q A;  3OS1 A;  3V9U A;  2HNZ A;  3M1F A;  4EZ6 A;  5BPN A;  2HHT A;  3VPZ A;  4OKE A;  1SQK A;  3SK3 A;  3AA2 A;  4BE1 A;  2IVP A;  3AY9 A;  1K73 O;  4EZ9 A;  3QEV A;  1TV6 A;  4JK9 A;  3SMP A;  3VF6 A;  1IG8 A;  1RT3 A;  2QW9 A;  4NCA A;  1WN7 A;  3ZT1 A;  3BUZ B;  5AZJ B;  4E3S A;  4KV8 A;  1GLB G;  3SQ4 A;  3KK7 A;  1NNE A;  4PKG A;  2Z1G A;  3JSM A;  2NZT A;  3QER A;  1K6Y A;  4CZI A;  4XH4 A;  2O8E B;  3MXM A;  5HL7 L;  1OKJ A;  3AO2 A;  4B3M K;  4FWS A;  4B9N A;  1JLE A;  4CGF A;  3CXC M;  4FJJ A;  3RSE B;  3K0S A;  2WFB A;  3MX2 A;  1BUP A;  4BRM A;  3C94 A;  1REV A;  1RDD A;  1Y97 A;  4Z4C A;  1VQ6 N;  1RT1 A;  4M3T A;  1HNZ K;  3TAR A;  4CJP A;  3LAM A;  2O8D A;  3ZET B;  4F2R A;  2WC9 A;  3L0Q A;  1LW0 A;  1QE1 A;  4CD3 A;  4CEB A;  4FJ7 A;  4FK0 A;  4FZY A;  1EET A;  1R59 O;  5KQD A;  4BRL A;  1QSS A;  4IDH A;  2O8C A;  1IJJ A;  3OYN A;  4OPA A;  3LZJ A;  2I7N A;  4YNQ A;  3P83 D;  3PSF A;  4J8F A;  4B9L A;  3I55 N;  4CZG A;  2J4R A;  3SV4 A;  1XNR K;  3WQT A;  4DLE A;  3CM5 A;  1L5U A;  2ZJP L;  3S3N A;  1A5W A;  4DTM A;  5DM6 L;  3MEG A;  1MWK A;  2CGK A;  3UE5 A;  4IEE A;  1GLE G;  3V9Z A;  1YUW A;  4M3Z A;  4FPA A;  3PSI A;  4C8O A;  1HLU A;  4KKO A;  1RBT A;  4N47 A;  4H5V A;  1VQ5 N;  1FW6 A;  4JD2 A;  3KD5 E;  2YNF A;  2IDO A;  2FBT A; 
#chains in the Genus database with same CATH homology
 4OLA A;  1U04 A;  4YFU A;  1DTT A;  3C6T A;  3TAG A;  3G0Z A;  1F21 A;  1RDB A;  4HUF A;  1BCO A;  3V1R A;  2Z1J A;  1NK8 A;  4FK2 A;  3G10 A;  3CFR A;  4FLZ A;  1LV5 A;  1GOA A;  2PZS A;  1XWL A;  3DRR A;  2VG5 A;  5HRP A;  1X9M A;  3SQ1 A;  3NCI A;  3NH1 A;  1WLJ A;  3HP9 A;  4W5R A;  3OYB A;  3OYJ A;  3WNF A;  3QEW A;  4PWD A;  2KQ2 A;  4CJQ A;  4PY5 A;  2G8F A;  1EP4 A;  4DU4 A;  4KPY A;  4G1Q A;  3WNG A;  1J9A A;  4M3X A;  5K14 A;  1KSP A;  3VA0 A;  3RMB A;  2E6L A;  3HYF A;  1JLA A;  4O4G A;  1SKS A;  1TL3 A;  2B5J A;  4CER A;  1T03 A;  4HHT A;  2X74 A;  3PV8 A;  1IO2 A;  3L8B A;  4LH5 A;  3DLE A;  3LAK A;  4CHN A;  3OS0 A;  4DQR A;  5CYM A;  3JYT A;  2OPS A;  4DFJ A;  5FRN A;  4Z4I A;  1Q8I A;  4B9S A;  1IKY A;  5SWM A;  4FLW A;  3F9K A;  1X9W A;  1UA1 A;  4C8N A;  3L2W A;  2YHB A;  3SJJ A;  1W9H A;  4OVL A;  3K5N A;  1SKW A;  1WAJ A;  4KI6 A;  3DRP A;  1SL1 A;  5CYQ A;  2YHA A;  3HL8 A;  3NGI A;  2IOC A;  1QQC A;  5C24 A;  4OGC A;  2GUI A;  5KRS A;  2D0A A;  3LWL A;  3HP6 A;  4JRQ A;  3RR7 A;  3ISN C;  3SUN A;  4J2D A;  1TAQ A;  3OY9 A;  1BHL A;  1TK0 A;  2G8W A;  2ATQ A;  2GV9 A;  3KKS A;  1Q9X A;  2RPI A;  4IBN A;  1RT6 A;  5J2N A;  1NKC A;  2KTQ A;  1HNI A;  4Y1C A;  5HRR A;  1RTJ A;  4N5S A;  3NGZ A;  2FBX A;  2RF2 A;  4DTN A;  4J2A A;  2Z1H A;  3HVT A;  3DRS A;  1S6P A;  4JLH A;  4Z0U A;  3DMJ A;  1VSM A;  4KO0 A;  2BDP A;  3AVL A;  2F8T A;  4B9U A;  4C8L A;  1I3A A;  1JL2 A;  1ZBF A;  4B08 A;  1MU2 A;  1RT4 A;  3KLE A;  4O0J A;  4PA1 A;  1VSF A;  1X1P A;  4BDZ A;  3DYA A;  4BDY A;  3PX4 A;  4BAC A;  4DQS A;  3PY8 A;  2DFE A;  3EYZ A;  2AJQ A;  4ELU A;  3P1G A;  1KFS A;  3HPO A;  3I0R A;  1B9F A;  2KW4 A;  4H8K A;  3VQ6 A;  4KB0 A;  4FJN A;  3U3Y A;  4CJF A;  3LP1 A;  3OVN A;  3WNE A;  1RDC A;  1TKZ A;  1Z25 A;  5FRM A;  4FJI A;  3V81 A;  4AHV A;  4RW6 A;  1VSH A;  3T1A A;  4EP4 A;  3SNN A;  3SZ2 A;  4E1M A;  4M3U A;  2A1S A;  2NUB A;  4JS4 A;  1C1B A;  1KFD A;  3ZT3 A;  1NKE A;  1VRT A;  4Y1D A;  2YKM A;  1B9D A;  2JLE A;  3DM2 A;  4LSL A;  1C1A A;  3CQ8 A;  1BIS A;  1KVA A;  3MEE A;  1FXX A;  2HHV A;  4B8C A;  3CFP A;  2OZS A;  3AVG A;  3D45 A;  4CHO A;  1RTH A;  2XRI A;  4DS4 A;  3AVB A;  4AHT A;  1D9D A;  4KHY A;  3HT3 A;  3ZSX A;  1LW2 A;  4CHZ A;  3D0P A;  1C6V A;  3L2R A;  4O44 A;  4CJU A;  1G15 A;  1ZBI A;  3RTV A;  2E4L A;  2IAJ A;  3OYF A;  4M45 A;  1YTA A;  3TAB A;  4PQU A;  4FCY A;  1JLF A;  3BGR A;  1NK6 A;  1L3T A;  3V6D A;  3DLK A;  4MFB A;  1RBU A;  3OYC A;  3ULD A;  2B4J A;  4I2Q A;  3VN5 A;  1RT7 A;  3QEX A;  1U49 A;  4DTP A;  4KHU A;  4IG0 A;  3IRX A;  2ZQB A;  4ELT A;  1NOZ A;  4FLY A;  1IKV A;  1UOC A;  1TL1 A;  2WON A;  4IG3 A;  1NK4 A;  4CGG A;  4CEO A;  2KZZ A;  5SZT A;  3QO9 A;  4E7L A;  2F96 A;  4DQQ A;  4CK2 A;  1IKX A;  4KRF A;  1VSJ A;  3VA3 A;  3LP3 A;  3AVJ A;  4HUG A;  3K5L A;  4GMJ B;  5C42 A;  3U6F A;  3HJF A;  1WSH A;  1YVU A;  3HPH A;  5C25 A;  3PUF A;  1C0T A;  1ZBU A;  2XHB A;  1RBV A;  2KFN A;  5HP1 A;  1UAX A;  4KHQ A;  3THV A;  3TAF A;  2Q3S A;  4QCL A;  1NKB A;  1RBS A;  3AVA A;  3K5O A;  1SL0 A;  4ZTJ A;  1HNV A;  1VSE A;  3KLH A;  1S1V A;  4CJR A;  2VG7 A;  4KB1 A;  5HRN A;  4XIU A;  4KFB A;  3IAY A;  1SL2 A;  3RRG A;  1NK7 A;  4W5O A;  2VWK A;  4DTU A;  4DU3 A;  1WSJ A;  2ITG A;  3NBP A;  4CGH A;  4FM1 A;  1EKE A;  1D8Y A;  2P5O A;  3NFA A;  3OYH A;  5KGX A;  4FJX A;  1TAU A;  1LWF A;  3QLH A;  2X6S A;  4I9Q A;  3MAQ A;  4DSJ A;  1FK9 A;  1KVB A;  4KTW A;  1KCF A;  3WNH A;  3TAE A;  4JS5 A;  4CGJ A;  3SUO A;  2XY6 A;  2P51 A;  2FBY A;  1QSL A;  4CF9 A;  3AVN A;  4B9T A;  1HQU A;  3RMC A;  2PYL A;  4NYF A;  4KAZ A;  2DFF A;  3A2F A;  4FW1 A;  3V1Q A;  3O4N A;  3CFO A;  4CFA A;  1UA0 A;  1C1C A;  2HB5 A;  3CYM A;  2VWJ A;  4FLT A;  4BWJ A;  3U3G A;  4CEZ A;  3AVK A;  1U48 A;  4DTJ A;  1B92 A;  4HVJ A;  3O3H A;  1TKX A;  4ZHR A;  1LAV A;  4LSN A;  2IC3 A;  3KK3 A;  2KFZ A;  4FW2 A;  4CFC A;  4FJ8 A;  1KVC A;  1BI4 B;  3DI6 A;  3CM6 A;  4I2P A;  4OKK A;  1TK8 A;  4OJR A;  4DSL A;  4UQG A;  1T05 A;  3LAN A;  4CEQ A;  4M41 A;  3SV3 A;  4DSE A;  3HVR A;  1SKR A;  4F2S A;  4PUO A;  3OYL A;  1HMV A;  4MQ3 A;  3VQE A;  3KD1 E;  4NYN A;  3UIQ A;  1HYZ A;  2OPP A;  4FJH A;  4LH4 A;  3M8P A;  3TAQ A;  4E19 A;  5T7B A;  3OYK A;  4E7K A;  1A5V A;  1JXB A;  2YV0 X;  3OYD A;  1NJY A;  1N5Y A;  2R7Y A;  1TKD A;  2X78 A;  3F73 A;  3I8D A;  3L3U A;  2Y1J A;  4FJ9 A;  3TAN A;  3L2U A;  5HBM A;  2RKI A;  3EZ5 A;  4HUE A;  3AVF A;  1YT3 A;  3AA3 A;  3VQ7 A;  3SYZ A;  1KRP A;  4GW6 A;  1JLQ A;  4CF8 A;  4CIG A;  1HRH A;  4K8Z A;  4DS5 A;  4ID1 A;  2OPR A;  3ZSW A;  1WSG A;  4CHP A;  4DFM A;  1D9F A;  4IKF A;  2HW3 A;  1WSF A;  3L3V A;  1QSY A;  2YNH A;  3NF9 A;  3L2Q A;  2QK9 A;  1S9E A;  3SQ2 A;  1DTQ A;  1TKT A;  1VSI A;  3I0S A;  1HYV A;  3QNN A;  4J2E A;  3QIP A;  1BGX T;  3KTQ A;  2PYJ A;  3C6U A;  3IG1 A;  3VQC A;  4DTO A;  1BQN A;  1JKH A;  2GBZ A;  4O0I A;  3RMD A;  1ZBL A;  3H08 A;  3P5J A;  3TAM A;  3HM9 A;  5DK5 A;  2YNG A;  1Z26 A;  3MXJ A;  4F4K A;  4FLV A;  2D5R A;  5EU7 A;  3S9H A;  4Z4H A;  5HLF A;  3LZI A;  1TK5 A;  1Q9Y A;  5J1E A;  4E0D A;  3OYM A;  4M3Y A;  1HYS A;  1ASW A;  2LSN A;  4CEF A;  3O3F A;  5JS1 A;  3ZT4 A;  1J53 A;  1S1T A;  4H4O A;  2ZD1 A;  3EY1 A;  2A1R A;  1XHZ A;  3ZT2 A;  1ZYQ A;  3ZSY A;  3AO4 A;  2QXF A;  4M42 A;  2BE2 A;  4I9L A;  1QTM A;  3V9W A;  3RRH A;  1IH7 A;  4FK4 A;  4NCB A;  2HNY A;  4ZTF A;  1U45 A;  4DF4 A;  1CZ9 A;  4DF8 A;  1SUQ A;  4CJV A;  3SQ0 A;  2RN2 A;  4KHS A;  4FM0 A;  3LPU A;  4DLG A;  2G8V A;  4CK3 A;  3NF6 A;  3K59 A;  3HO1 A;  2O4I A;  3OYG A;  1JXE A;  4CK1 A;  2D0C A;  1RTD A;  1S1U A;  3AO3 A;  1T7P A;  1O1W A;  1NK0 A;  1C0M A;  1JLB A;  1ITG A;  4B3O A;  1RCH A;  4CEE A;  4DFK A;  4CED A;  3M8R A;  4CFD A;  3NF8 A;  2HVH A;  3SPY A;  3S3M A;  2EHG A;  4CJT A;  5I3U A;  2O4G A;  4QOZ B;  3AO1 A;  1R0A A;  4Z4G A;  4CEC A;  4CF0 A;  4HTU A;  2OA8 A;  3QIN A;  1WSE A;  3VQ9 A;  3OYA A;  5J2Q A;  3RMA A;  1VSK A;  1CXU A;  4DFP A;  1NJZ A;  3MXI A;  4AIL C;  3NH0 A;  3K5M A;  2QKB A;  2DTU A;  3K2P A;  1NJX A;  1TGO A;  2YNI A;  1IG9 A;  4DTR A;  3S3O A;  1NK5 A;  4CJ3 A;  3VQ4 A;  4CGI A;  4DMN A;  5FDL A;  2G8H A;  1FKO A;  1RIL A;  4FLU A;  3VQQ A;  1T8E A;  2HHS A;  5J2P A;  3M8Q A;  3TI0 A;  4FJL A;  3SCX A;  4W5T A;  4Z4F A;  1NOY A;  4B8A B;  1S6Q A;  3KLF A;  4B9V A;  3ASM A;  1VSD A;  3B6P A;  2P1J A;  4E7J A;  4N41 A;  4Z4E A;  2DY4 A;  1D5A A;  3T19 A;  1KTQ A;  5DMR A;  2G8K A;  5KRT A;  3DOK A;  3M8S A;  1I39 A;  2G8U A;  1RDA A;  3NHG A;  3NDK A;  1GOB A;  2YKN A;  4CJE A;  3T3F A;  1U4B A;  4BWM A;  4DQI A;  2D0B A;  4CGD A;  4OPK A;  4OLB A;  4KRE A;  4Q0B A;  1RBR A;  4DSK A;  3KLI A;  1EX4 A;  3B6O A;  3NF7 A;  3AVI A;  5HRS A;  4FJK A;  3PO4 A;  1SV5 A;  2X6N A;  4CFB A;  3LP2 A;  2QKK A;  1VSL A;  4FJG A;  4GVM A;  1N6Q A;  4HCB A;  3NAE A;  2E6M A;  1XI1 A;  4KHW A;  3SUP A;  1S1W A;  5J2M A;  4OKJ A;  4N76 A;  1BCM A;  2DFH A;  2PY5 A;  3NGY A;  4H4M A;  3ITH A;  3NE6 A;  3NH2 A;  1ASU A;  2XY5 A;  4EP5 A;  4CE9 A;  4M3W A;  3HK2 A;  4J2B A;  3AA4 A;  3ZCM A;  3QEI A;  3OYE A;  3V9X A;  4E7H A;  4KTZ A;  2Z1I A;  3DLG A;  4BE0 A;  1KLN A;  1XHX A;  2WOM A;  4DU1 A;  3SPZ A;  2ETJ A;  4RG8 A;  3QET A;  4M3R A;  3KLG A;  4OGE A;  3PX0 A;  1IKW A;  4KHN A;  3LP0 A;  1S9G A;  4CJ5 A;  1NJW A;  1JL1 A;  2FBV A;  4HCC A;  4R5P A;  2IGI A;  2HHW A;  4OPJ A;  2ZE2 A;  4DTX A;  3DOL A;  3E01 A;  4RW4 A;  1X9S A;  4BE2 A;  4E1N A;  3LDS A;  4CCH A;  3VQP A;  4Q5V A;  2JGU A;  3O4Q A;  1S5J A;  3KKR A;  3OJS A;  4JRP A;  4F8R A;  4CJL A;  3DLR A;  2I5J A;  3OS1 A;  3V9U A;  2W42 A;  1WSI A;  1W0H A;  2HNZ A;  3LPT A;  3IS9 A;  1EXQ A;  1S1X A;  4FVM A;  2XY8 A;  3O3G A;  4EZ6 A;  2HHT A;  1L3U A;  4W5N A;  4LY7 A;  4OKE A;  3ZT0 A;  4FM2 A;  1TVR A;  2HHU A;  1HJR A;  1BIU A;  3AA2 A;  4BE1 A;  3HXM A;  4DQP A;  3SUQ A;  5CY4 A;  3K58 A;  3ZSV A;  1BIZ A;  4B9M A;  4EZ9 A;  4ID5 A;  1U47 A;  3QEV A;  1TV6 A;  4RW8 A;  1RT3 A;  4L8R B;  4NCA A;  5E41 A;  1WN7 A;  3AVH A;  1RNH A;  3ZT1 A;  4FJ5 A;  1FKP A;  3TR8 A;  4E3S A;  3PX6 A;  4KV8 A;  3SQ4 A;  4FYD A;  1KLM A;  2Z1G A;  3KIO A;  3JSM A;  4ICL A;  3VQ8 A;  4BDP A;  3HST B;  1RT2 A;  3LAL A;  2B6A A;  3QER A;  2HVI A;  4AHS A;  4K8X A;  1K6Y A;  3KK1 A;  4FZX C;  3TWH A;  1ZBH A;  2BAN A;  3MXM A;  1QS4 A;  1JLG A;  4FJM A;  4RW7 A;  3AO2 A;  3PO5 A;  5D3G A;  1HPZ A;  4AHU A;  1LWE A;  4B9N A;  1JLE A;  4CGF A;  4IFV A;  3V9S A;  3QEP A;  5I42 A;  4F3O A;  4FZZ A;  5CZ2 A;  2G8I A;  2XO7 A;  4FJJ A;  4ELV A;  1BI4 A;  2KZM A;  1WAF A;  4CEA A;  3DLB A;  4NCG A;  2XY7 A;  1BQM A;  2HND A;  1CXQ A;  4WE1 A;  3VQD A;  3OYI A;  3V1O A;  2Y1I A;  3C94 A;  1REV A;  3QIO A;  1RDD A;  1Y97 A;  3AV9 A;  1UWB A;  4LD0 A;  4DTS A;  5KI6 A;  4Z4C A;  5KTQ A;  1RT1 A;  4M3T A;  3RR8 A;  1LAW A;  4O55 A;  4AHR A;  3OS2 A;  2F8S A;  3AVC A;  3C95 A;  4CF1 A;  2HHQ A;  2OYQ A;  3TAR A;  1RT5 A;  4CJP A;  4F3T A;  1YTU A;  4AH9 A;  3LAM A;  4KI4 A;  3VQB A;  1J54 A;  4F2R A;  2BGG A;  1VRU A;  4DSI A;  1LW0 A;  1QE1 A;  3OJU A;  4CEB A;  4DG1 A;  3KK2 A;  4FJ7 A;  1VK0 A;  4CHQ A;  4AHC A;  3K57 A;  4FK0 A;  4CJK A;  2HMI A;  1EET A;  3AVM A;  4FZY A;  2HHX A;  3RWU A;  4N56 A;  2IS3 A;  3L2V A;  4KTQ A;  4O5B A;  4DWI A;  3FFI A;  3SI6 A;  4CJS A;  1QHT A;  1XC9 A;  4CF2 A;  1QSS A;  1DLO A;  4C8M A;  2OZM A;  3KJV A;  3OYN A;  5FRO A;  4E89 A;  4IFY A;  4CJW A;  1BL3 A;  1CZB A;  3ZSR A;  3LZJ A;  2P5G A;  1A5X A;  3CG7 A;  3VQ5 A;  3P83 D;  3VQA A;  4YNQ A;  4E7I A;  4FXD A;  4B9L A;  1CLQ A;  5HRO A;  5KGW A;  3SV4 A;  3MED A;  3ALY A;  4RW9 A;  3LWM A;  3BDP A;  4DLE A;  4FLX A;  3ZSO A;  3CM5 A;  1L3S A;  1L3V A;  4I7F A;  1L5U A;  4C8K A;  1GOC A;  3QNO A;  4CJ4 A;  3MEC A;  3V4I A;  3S3N A;  1A5W A;  4CES A;  4DTM A;  3AO5 A;  1J5O A;  5JS2 A;  2VG6 A;  1RTI A;  3MEG A;  1ASV A;  4DSF A;  5CZ1 A;  1HQE A;  2EX3 A;  3V9Z A;  3AA5 X;  1NK9 A;  1JLC A;  4W5Q A;  4IDK A;  4M3Z A;  4QAG A;  1C0U A;  2OPQ A;  3ZSQ A;  4C8O A;  4CHY A;  3TAP A;  4KKO A;  3QES A;  3DLH A;  1RBT A;  3ZSZ A;  4CIF A;  4N47 A;  3HPG A;  4TSX A;  3KD5 E;  1LWC A;  2YNF A;  4CIE A;  2IDO A;  2FBT A;  2FC0 A;  1WNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...