1BHLA

Cacodylated catalytic domain of hiv-1 integrase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
133
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 43
structure length 133
sequence length 151
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bhlA00
1HMVA 2HHVA 4FJXA 3PV8A 4Y1CA 4FJKA 3AVIA 4E7JA 3SUNA 3SQ0A 3CFRA 2P1JA 2O4IA 1SV5A 1TVRA 4KKOA 5SWMA 3L3UA 4AHVA 4CEAA 3OY9A 1XHXA 4CJEA 3NH1A 3RR8A 1BIUA 4CFCA 3KLFA 3ZT0A 3QIPA 4C8MA 4AHRA 4CEFA 4FJ7A 4FZZA 4M3YA 4BDYA 2XY6A 3SQ2A 4E7KA 4LH5A 3KJVA 1WAFA 4CIFA 1KSPA 4FLUA 3OYEA 3ZSOA 1WSEA 4FZYA 4OLAA 4BWJA 4O5BA 4CJPA 3S9HA 2DY4A 4AILC 3OYJA 4B8CA 4HCCA 4IG0A 1S1WA 1TK5A 3HVTA 3M8PA 1VSIA 1C6VA 3RR7A 4DQSA 3B6PA 4CEEA 4M45A 1FKOA 4E7IA 2YKNA 2YNFA 1L3TA 1U4BA 3DOKA 4LY7A 5J2PA 1C1BA 4CHZA 4CJSA 3OJSA 4DU3A 4DTXA 1QS4A 3NFAA 4CHYA 4DTRA 1JLCA 4AHUA 2IDOA 1ASWA 1IO2A 1VSKA 2O4GA 1S1VA 4FJHA 4CJ3A 1BI4A 3VQQA 4CEDA 3C95A 5J2QA 1EKEA 4CK1A 3OYLA 1T8EA 1C0UA 4Q5VA 4NYFA 4FK2A 4BDPA 1ZBLA 4RG8A 3VQ7A 3C6TA 4CGIA 2HNYA 3NH2A 4FJMA 4KREA 1NK4A 3L2VA 4FJJA 2W42A 3P1GA 3NE6A 2XRIA 1XHZA 1RDBA 1RILA 1X1PA 4FM1A 4CHNA 1KVBA 3ZSRA 2Y1JA 4CJQA 4EZ9A 3V1RA 3AVJA 4FLYA 2G8KA 1C0TA 2HW3A 2FBYA 1T7PA 4DWIA 2HVHA 3V9SA 3AO2A 4W5OA 2OPQA 4Z4FA 1NK9A 1VRUA 5FRMA 4CESA 4FW1A 3V9WA 3TAMA 5DMRA 3KK2A 3L2RA 4B9LA 2DFEA 4DTPA 3KLHA 3NGYA 3AA3A 2HHWA 4DMNA 1RDDA 1A5VA 3O4NA 3V1OA 2EHGA 2X6SA 4CF0A 3K5NA 1I39A 4KHYA 3AVAA 3NF6A 5CYQA 4CGDA 4E7HA 3UIQA 4CJUA 1A5WA 4F3OA 1ZBHA 3WNFA 3PUFA 4DSFA 3RWUA 3HJFA 3K2PA 2ITGA 3NF7A 1NJYA 2D0CA 1Y97A 3DYAA 4DF4A 4Q0BA 1R0AA 3SYZA 3LP1A 5J2MA 4AH9A 1NJZA 1TKXA 3HL8A 4B9MA 1T03A 3PX4A 5DK5A 4J2DA 1DTTA 1WSIA 3SCXA 2HMIA 2G8WA 2YV0X 2OPSA 2KFNA 1QQCA 2BE2A 1Q9XA 5FDLA 3F9KA 3QNNA 2KZMA 4DS4A 2XY5A 1KFSA 1FK9A 4HUGA 1WN7A 3MXMA 2WOMA 4O44A 1ZBIA 2ZD1A 3CFPA 4FJ9A 3AVNA 3CQ8A 3T19A 4M3TA 4DFMA 3QEVA 4CK2A 3EYZA 1RBRA 3CFOA 3G0ZA 2HVIA 4E89A 3LP2A 2JLEA 3M8QA 5HBMA 2F96A 1VRTA 4DTJA 4DFKA 3RMBA 3KKSA 1JLEA 4W5NA 1JLGA 1YVUA 4N41A 3O3GA 1REVA 4N76A 1C1AA 1WSHA 4CF8A 1UA1A 3V6DA 5HRNA 4M3UA 4M3ZA 4LSNA 4C8NA 4E1NA 4QOZB 2YNGA 3A2FA 4WE1A 1B9FA 4H4OA 1TK0A 5D3GA 3PO4A 1NK8A 2Z1JA 4FXDA 4LH4A 3AO4A 4O4GA 3PX0A 2YNHA 4GW6A 1NKCA 1RTDA 3MECA 2DFHA 1L3VA 5I3UA 4CJVA 3L2QA 2IGIA 3M8RA 4CJFA 4C8LA 1BHLA 3M8SA 1RBTA 3DMJA 4CJTA 4M42A 1JLAA 5T7BA 5FROA 4W5TA 4GVMA 3ZSWA 3OYMA 1WAJA 3SPYA 1UAXA 3AO5A 3IAYA 4EZ6A 1LAWA 3TI0A 4QAGA 2Z1HA 3OYKA 4GMJB 3QNOA 4JS5A 2XHBA 4C8KA 3VQDA 1LWCA 4E19A 4CF2A 1IKVA 3ZSYA 5KGXA 4CEQA 1HJRA 5CZ1A 1KLNA 4BE2A 1QTMA 4RW9A 1LAVA 4OGCA 1D9DA 1F21A 2RF2A 3S3MA 3TABA 3HPHA 4Z0UA 4DFPA 3C6UA 3TAGA 3P83D 4F4KA 4K8XA 3AO1A 1U45A 1TV6A 3TAFA 1BIZA 1VSDA 3ZSXA 3IG1A 3IS9A 2VWKA 4NYNA 3HPGA 5E41A 1LV5A 4J2EA 3KK3A 3OYIA 3T3FA 4KAZA 1VSJA 4CEOA 3VN5A 3CM6A 4HVJA 2WONA 1WSJA 3I8DA 1U48A 5KGWA 3HVRA 3SNNA 4CFAA 4CHPA 4KHUA 3AVBA 3KLGA 1HYZA 3ITHA 4I7FA 4RW8A 4KB1A 2X78A 4B3OA 2YKMA 3OYFA 2OA8A 1W9HA 3LWLA 2PZSA 2HNZA 4HCBA 2IOCA 1NK7A 2KFZA 1HQEA 4E0DA 3DM2A 3FFIA 1C0MA 4ICLA 1NK5A 3VQEA 3U3GA 4CF1A 3THVA 4F8RA 4ZHRA 4DSIA 2P51A 1Q8IA 4B9VA 4CF9A 4KO0A 2D0BA 5SZTA 3MXJA 4FJGA 3LDSA 4NCBA 4KHQA 2XO7A 4OLBA 1S1XA 2HHQA 1SL2A 3VQPA 5C25A 1CZ9A 2OPPA 4CEBA 4JRQA 1KVAA 2YHAA 3JSMA 4KRFA 4C8OA 3HT3A 4AHCA 3KD5E 2D5RA 1BI4B 1RT7A 2Z1GA 4Y1DA 4KPYA 3AV9A 1DTQA 3MEDA 3V9ZA 3HO1A 1IH7A 1KLMA 1D8YA 3CYMA 2RN2A 3NBPA 4Z4IA 3KD1E 4KV8A 5HRPA 4DTSA 5I42A 1HQUA 3LAKA 5HRRA 2OZMA 4FJIA 3CG7A 3TAQA 1HYSA 1JL1A 1TL3A 1NKBA 1T05A 4KHNA 4M41A 4RW6A 5CY4A 4AHTA 1CXUA 1EP4A 1KTQA 1U04A 1RT3A 3VQ9A 3K59A 1ZYQA 1SL1A 2BGGA 4ZTFA 3B6OA 2KW4A 2E6MA 3QINA 4ZTJA 1Q9YA 1B9DA 1SUQA 4NCGA 1RT6A 1G15A 3JYTA 3ZSZA 4I9LA 3PY8A 3SPZA 3NF9A 3KLIA 2Q3SA 3P5JA 4JRPA 3QLHA 2FC0A 1X9MA 3LP3A 1RBUA 4EP4A 3TANA 2PY5A 4BE1A 3DLEA 3L2UA 3SV4A 2DTUA 3OS2A 1XWLA 2LSNA 1SKSA 4FLWA 4IFYA 1C1CA 4XIUA 1ITGA 5J1EA 3RMAA 4FZXC 1UA0A 5KTQA 2R7YA 4H8KA 4FLVA 4TSXA 4YFUA 2G8VA 1HPZA 3AVFA 5C42A 4DF8A 3PX6A 3KKRA 4O0IA 1DLOA 3TARA 1L3UA 2P5GA 4ID1A 3NDKA 3TAEA 4PWDA 1TAUA 2YHBA 4KTWA 4DSKA 4EP5A 5CYMA 3O3HA 1IKYA 1L5UA 3HYFA 3OJUA 4DTOA 2F8TA 1RBVA 2ZQBA 3ISNC 1QE1A 3U6FA 1IKXA 1YTUA 5KI6A 1NJWA 1BQNA 5KRTA 2ATQA 4F2RA 2QK9A 1LWEA 1UWBA 4CJKA 2FBVA 4DQIA 4IFVA 3ULDA 4ELTA 2AJQA 4CJLA 4LSLA 4OKEA 4BACA 3QESA 3RTVA 3DRSA 1MU2A 4RW7A 4W5QA 1GOBA 1RTIA 4DQQA 1JLFA 4FLZA 1XI1A 3LPUA 1NOZA 1YT3A 3MAQA 2A1SA 4I2QA 4E1MA 2QXFA 4F3TA 1SL0A 2XY7A 4PY5A 4J2AA 1CLQA 1J54A 1XC9A 4G1QA 3MEGA 3T1AA 4M3XA 1I3AA 4OPJA 4I9QA 3K5MA 4DSLA 1FXXA 4DLGA 4IDKA 1TKTA 1K6YA 2OZSA 3AVKA 1TK8A 4FYDA 5CZ2A 3WNHA 2DFFA 3RMDA 3AA4A 3OYGA 3SV3A 4HTUA 4CIEA 1VSHA 1WSGA 3VQ4A 4J2BA 4OVLA 3NH0A 4R5PA 4KTQA 4OKKA 4B8AB 3SZ2A 5J2NA 3VQAA 1NOYA 4DQPA 1EXQA 4DS5A 3LWMA 3S3NA 3AA2A 2GBZA 1JL2A 3G10A 4DG1A 3QIOA 1ASUA 4FK4A 2IAJA 4CJ5A 3OYCA 1BCOA 3I0SA 4L8RB 1QHTA 2G8FA 4DTUA 2HHUA 4CGGA 3K5LA 4CEZA 3SUQA 4FCYA 4FJ8A 4NCAA 3VA0A 3F73A 3RRHA 3AA5X 4I2PA 3LALA 1JLQA 1S6PA 4B9TA 3LP0A 4YNQA 4Z4HA 3K57A 4CJ4A 2E4LA 1VSEA 1VSFA 4JLHA 3DLRA 1QSYA 5FRNA 1NK6A 2Z1IA 4DQRA 1X9WA 1BISA 1S9GA 4M3WA 3I0RA 1BL3A 2BDPA 1TKZA 3OS1A 1SKWA 4BDZA 1L3SA 4E7LA 5HROA 1CZBA 4AHSA 4OKJA 4CJWA 3EY1A 2GV9A 2VG7A 2VG5A 3SUOA 2KTQA 2B5JA 3O4QA 3QO9A 4IG3A 4N5SA 3AVCA 1CXQA 4OJRA 4Z4CA 4W5RA 3QERA 1RDCA 4CHOA 3NF8A 5HLFA 1B92A 1RCHA 4HUFA 3WNGA 3WNEA 3V4IA 1EX4A 1GOAA 3DLGA 4M3RA 3ZSQA 1UOCA 3V1QA 4OPKA 3OS0A 3OYBA 2HHSA 1N5YA 2D0AA 3EZ5A 4DSJA 4F2SA 4CECA 3AVHA 4CHQA 3CM5A 4FM0A 4DSEA 3IRXA 5K14A 3BGRA 1WSFA 2VWJA 3HP6A 3KK1A 4JS4A 4BWMA 2P5OA 4FJLA 4N56A 3DRRA 4CJRA 1JLBA 3VQ5A 1S5JA 3ZCMA 3DI6A 4DFJA 4ELUA 3ZT2A 1LW0A 4CFDA 4FVMA 1IG9A 1VSMA 1RT4A 2ZE2A 1RT2A 4CFBA 3QETA 4B08A 2PYJA 4IBNA 1RDAA 1RTJA 3D0PA 1LWFA 1KCFA 2Y1IA 3VQCA 4FW2A 1EETA 5HP1A 4B9UA 3S3OA 5EU7A 1ASVA 2EX3A 2G8HA 2OYQA 2G8IA 1HNVA 1KFDA 1S1UA 1Z26A 3OYNA 3DRPA 3HPOA 1FKPA 3HK2A 3SJJA 1TKDA 4OGEA 4UQGA 1U47A 4CK3A 1ZBFA 3V9UA 4HHTA 3SI6A 4CE9A 3SQ1A 3HXMA 2KQ2A 4CGJA 4LD0A 2OPRA 1JKHA 3ASMA 4H4MA 4DTNA 3HM9A 1RTHA 4CERA 4BE0A 1VSLA 3ALYA 1RT5A 1WNSA 1S9EA 3ZT3A 3LZJA 3HP9A 3QEIA 4Z4GA 5C24A 1D5AA 3VA3A 4CIGA 3L2WA 3NCIA 5JS1A 1JXEA 1LW2A 3RRGA 3AVLA 4FJNA 3BDPA 4KI6A 3ZT4A 1HYVA 3HSTB 2IC3A 1U49A 4FM2A 3H08A 3QEWA 3OYHA 2YNIA 4CGHA 2A1RA 2BANA 3TR8A 3V81A 3TWHA 3DOLA 2RPIA 2QKBA 1A5XA 1BCMA 3AO3A 1Z25A 2E6LA 3LZIA 3NGZA 4KHWA 3MXIA 1HRHA 3LAMA 1HNIA 4KFBA 4HUEA 4FK0A 3K58A 4DLEA 4IKFA 4PUOA 4MFBA 3SUPA 3OVNA 1TGOA 3C94A 4E3SA 1NKEA 2QKKA 2VG6A 4CGFA 3LANA 3OYAA 1D9FA 1TL1A 2G8UA 1S6QA 4QCLA 3DLKA 3K5OA 3SQ4A 3PO5A 3TAPA 1S1TA 2HNDA 3RMCA 1X9SA 2ETJA 3VQBA 1BQMA 2X74A 2GUIA 2HB5A 3L3VA 4DTMA 4Z4EA 2HHTA 4O55A 4FLTA 3KIOA 3E01A 3ZT1A 3NHGA 4KB0A 2NUBA 5HRSA 4FLXA 1J5OA 2XY8A 1KVCA 3NGIA 4DU1A 1KRPA 4O0JA 1RNHA 3AVGA 3L8BA 2F8SA 1VK0A 3ZSVA 1SKRA 1ZBUA 4ELVA 2B4JA 2B6AA 3O3FA 1W0HA 1O1WA 2FBXA 3QEXA 1QSLA 1WLJA 1RBSA 3U3YA 4PA1A 3V9XA 2RKIA 4RW4A 2JGUA 1BGXT 3OYDA 1N6QA 2X6NA 3DLBA 2PYLA 1NK0A 1TAQA 5JS2A 1JXBA 4ID5A 2FBTA 3D45A 4B9NA 4KTZA 4KHSA 2I5JA 4KI4A 1YTAA 4FJ5A 4CCHA 4PQUA 3VQ6A 3MEEA 1J53A 3KLEA 1IKWA 2IS3A 3LPTA 2HHXA 1NJXA 3NAEA 2KZZA 4DU4A 3KTQA 4B9SA 3DLHA 4K8ZA 3QEPA 1QSSA 3AVMA 4MQ3A 1GOCA 5KRSA 4N47A 1J9AA 1RT1A 3VQ8A
chains in the Genus database with same CATH superfamily
3WXIA 5M1KA 4FJXA 3CD6N 3PLAA 3FZHA 4FJKA 4E7JA 3SUNA 3SQ0A 2Q0RA 1SV5A 1J5EK 4AHRA 2ZGYA 3QIPA 4M3YA 4FWPA 1GLDG 1U2VB 1XNRK 3QDKA 4LFAK 3O80A 3TTCA 3S9HA 3AARA 4B8CA 1GLLO 1YJNN 3B6PA 3P31A 4E7IA 2HBKA 4GNIA 4AHUA 1ASWA 1IO2A 4WQ5A 1IG8A 5J2QA 1BI4A 4CEDA 4H03B 2BUPA 1NGIA 3IUCA 3WXJA 4RG8A 2NNWA 4GVEA 2NRTA 4FJJA 4DR3K 2XRIA 4H0VB 4FOIA 1XHZA 2I7PA 1X1PA 3V1RA 2ZM6K 3AVJA 2G8KA 2FBYA 3AO2A 4W5OA 5AZIB 3PIOL 3ENBA 1VRUA 1Z6RA 4FW1A 2P9LA 5TKWA 5DMRA 3V9WA 3KK2A 2O8CA 1XMQK 2DFEA 4A2AA 3VPZA 3NGYA 2HHWA 1RDDA 1A5VA 3VEYA 2UXBK 3NF6A 4CGDA 4E7HA 3QBXA 4JV5K 2FF3B 3PUFA 4BR9A 4DSFA 3RWUA 3NF7A 2D0CA 1R0AA 1NGDA 1TKXA 3KWIA 2PBDA 3TTFA 4BR7A 1WSIA 3FLCO 3R8EA 5FPMA 1WN7A 1V4SA 4O44A 1ZBIA 3C65A 3VENA 4M7XA 3QEVA 2O8DA 4F9OA 3LP2A 5HBMA 2QXLA 3M8QA 4DTJA 1JLGA 3ID6A 4BRAA 3VF6A 3O3GA 5JLFA 4N76A 5HRNA 4C8NA 3QFUA 5TKYA 1TK0A 2A5XA 1NMDA 3PX0A 2YNHA 3MECA 2E20A 3EKUA 1OH5A 4CJVA 3M8RA 4JI3K 4CJFA 1YITN 1BHLA 3DMJA 5T7BA 4GVMA 3OYMA 3IAYA 1WAJA 4EZ6A 1UAXA 1LAWA 4QAGA 4NB4A 3OYKA 3CXCM 3VQDA 4E19A 4JK9A 5KGXA 5CZ1A 2E5LK 3RVCA 4BE2A 3KHYA 1N32K 2RF2A 3TABA 4F4KA 3NVKA 4YOYA 3TAFA 2HBMA 3IG1A 1LV5A 4UY8O 1ATSA 4KAZA 4CEOA 1NGEA 1JCEA 2WONA 5HL7L 3I8DA 1VQ6N 3SNNA 4DV5K 4JAXA 2OTJN 1HYZA 3ITHA 4I7FA 2YKMA 4ISGA 1W9HA 4B1WB 3CCRN 4E0DA 1NK5A 4F8RA 2A6AA 3THVA 4ZHRA 4JI2K 4KO0A 2D0BA 3FFKB 1Q81O 5JVGL 4KHQA 4JYAK 1TYQA 3VQPA 3O6WA 4CBXA 3MCAB 5C25A 3JSMA 2V7ZA 5C12A 4FL9A 4B1XB 1BI4B 1RT7A 4BRMA 3CYMA 4X65K 1NWKA 4GV3A 5I42A 3D2FA 3LAKA 4OX9K 3Q7CA 1HYSA 4WQ4A 1JL1A 1TL3A 3VETA 3FZMA 2RE2A 5LJVA 3J7ZO 5CY4A 1VHXA 1K8KA 1RT3A 2BGGA 1YVNA 3OHRA 2CGKA 2CGLA 2P9LB 2O8CB 3GG4A 3DLEA 2DTUA 3WXKA 4XIUA 4GV6A 5J1EA 3D7EO 4H8KA 4FLVA 1HPZA 4ID1A 3JXUA 2HOEA 4MLHA 3BF3A 4KTWA 1P8ZA 4EP5A 5JVHL 1WOQA 1IKXA 4IZ9A 1QZ5A 4F2RA 5C2FA 5I9EB 2QK9A 4IWVA 2O8DB 3CQYA 4CJLA 4OKEA 3VEZA 5KPTA 3RTVA 1ESVA 1RTIA 1SAZA 3VTIA 2CH5A 3MAQA 4PY5A 1CLQA 1XC9A 4G9ZA 4DR6K 4G1QA 5BN9A 3DJCA 1MWKA 3CERA 4DLGA 1EWQA 4A2BA 2OZSA 3WNHA 4ILHA 5EXWA 4HTUA 4BR2A 4OVLA 4R5PA 4KTQA 5J2NA 4LF7K 2P9UA 3S3NA 2UU9K 4FK4A 1JL2A 2IAJA 3OYCA 2Q97A 4BQZA 3KVGA 3K5LA 3SUQA 4FCYA 5AQTA 1T6DA 3F73A 4A62A 3AA5X 3RRHA 1LCUA 1GLAG 2BH1A 3LALA 3K57A 4CJ4A 4B3RK 2GEMA 1VSEA 1VSFA 1QSYA 5FRNA 4DQRA 1X9WA 1J6ZA 1VQKN 3CETA 2BDPA 1TKZA 2FXUA 5HROA 2J4RA 4K41A 3K9KA 2VG7A 5DM7L 1RFQA 2B5JA 3AVCA 1CXQA 3CHWA 2W6LA 3A5MC 4FWKA 4K43A 2E1ZA 1N34K 1GLCG 4OO1J 4BC5A 3ZSQA 3D2EA 3OYBA 2HHSA 4C23A 4CECA 4FM0A 5K14A 3HP6A 2P5OA 4DUYK 1TYQB 3ZCMA 4DFJA 4JD2A 4CFDA 5M1NA 4FVMA 2PYJA 1RDAA 3D0PA 1LWFA 3D2FB 4B9UA 1I94K 2OYQA 5EU7A 3VGKA 1KFDA 1NM1A 3R9PA 2HF4A 1K8KB 4DR2K 4QS7A 4OGEA 3CIPA 1ATNA 3OW2M 1P90A 3B8AX 1VQ4N 4RWTA 4LD0A 5AZJA 3EL2A 4H4MA 2VCPA 1WNSA 1S9EA 5C24A 1D5AA 3VA3A 4O5FA 3L2WA 5JS1A 1LW2A 3RRGA 1U49A 3R1XA 3CC7N 3FZKA 2VWBA 1BWFO 1TUUA 2ASMA 2A1RA 3TWHA 1NLVA 2RPIA 2GX9A 2IVPA 4C1NK 3MXIA 1HNIA 3TPQA 3SUPA 1NGJA 3K9JA 3DLKA 5AFUH 3VGLA 3CF5L 4Y0WA 1X9SA 2ETJA 4FWSA 2AA4A 3L3VA 3SBGA 5B8HA 4FLTA 5LJWA 3E01A 3NHGA 4KB0A 3IFRA 5A2QO 1KVCA 5KPRA 2HBLA 2UYTA 1BU6O 2F8SA 1VK0A 2FSKA 2EWSA 2B6AA 1W0HA 3QEXA 1QSLA 1WLJA 5C0YA 2QWQA 2RKIA 3OYDA 2E88A 1TAQA 4ID5A 4DUZK 3D45A 2I5JA 1YTAA 3AGRA 4FJ5A 3VQ6A 1J53A 4JI0K 2P9UB 2IS3A 4JI1K 1NJXA 2Q0UA 3QEPA 5BR9A 3A0IX 3AVMA 2HSTA 4FWNA 3O8MA 3AVIA 5LMNK 4EFHA 4KKOA 5SWMA 3L3UA 3OY9A 1SQKA 5FRMA 3ZT0A 4C8MA 2F7TA 4FJ7A 4LFCK 1QHAA 3SQ2A 4CIFA 1YAGA 2V7YA 1KSPA 2GWKA 4YOUA 3HRGA 1GLFO 4CJPA 5F0XA 3OYJA 4HCCA 3U9ZA 4X64K 3SBTA 3BEXA 4CVNE 4XH1A 3HVTA 1EO1A 1NU0A 3RR7A 1FKOA 1L3TA 2YKNA 5J2PA 3UB5A 3OJSA 4DTXA 4CHYA 4B3SK 4BRIA 1VQON 2IDOA 2O4GA 4JD2B 4JI5K 1TAUA 4CK1A 4KH6A 4FK2A 3ENOA 3VQ7A 2CGJA 3C6TA 4LC9B 4CGIA 3QFPA 1DGKN 4BRDA 2WC9A 3L2VA 1NK4A 4WQ5C 4LFBK 4H0OA 4FM1A 3ZSRA 1SS6A 4EZ9A 2D4WA 4FLYA 1T7PA 4DWIA 1OH7A 1NK9A 5AZJB 3HOSA 4B9LA 3KLHA 4MO5A 3JAMO 2EHGA 3AVAA 2ZJRL 4CJUA 1A5WA 3E9PA 3VERA 4YOXA 3HJFA 2ITGA 2KKZA 4BR4A 3D6RA 3SYZA 5J2MA 1NJZA 4B9MA 3CJ9A 5DK5A 4R79A 1VQ7N 3SCXA 2G8WA 2V52B 2KFNA 1QQCA 2QWMA 4A5BA 1Q9XA 2NRRA 4DS4A 4HUGA 2WOMA 3T19A 3EYZA 2HVIA 1ILYA 4E89A 4DFKA 4BROA 4K25A 3FGUA 4W5NA 4B9QA 1YVUA 2GELA 2OTLN 2P9PA 1C1AA 1WSHA 4M3ZA 4BR5A 4A5AA 4K0KK 4LSNA 3KZBA 4E1NA 1T3VA 1B9FA 5D3GA 3PO4A 4LH4A 5FPDA 4GW6A 1NKCA 1RTDA 4BRGA 4H0TB 5IT9O 3L2QA 1QZ6A 3E9OA 3M8SA 4CJTA 4M42A 2UXDK 1JLAA 1W2BM 4H0XB 4PHTX 3F9MA 3QNOA 3VEWA 1Q82O 4CW7B 1IKVA 3CCUN 2QM1A 4J8FA 4RW9A 4OGCA 2W40A 1F21A 4M3TA 3TAGA 1GLJO 1TV6A 4NYNA 5AQLA 3HPGA 1IJJA 4J2EA 4B1VA 2JWKA 2W6KA 1WSJA 3HVRA 4KHUA 3OBYA 4CHPA 5ADXH 2ASPA 4FPBA 4IFEA 2OA8A 1N36K 5BRDA 3LWLA 2A40A 2HNZA 1WUAA 1OH8A 3DM2A 1NGAA 3ZETA 3FFIA 3G4SN 3VQEA 4CF1A 4B9VA 4CF9A 1VQMN 5SZTA 3MXJA 3T7ZA 4PL8A 2XO7A 1K9MO 4OLBA 4FWQA 4KRFA 1BDGA 3TU5A 1DTQA 1NMNA 3V9ZA 1D4XA 1KLMA 1KD1O 4Z4IA 5AQYA 3KD1E 1S72N 5HRRA 2OZMA 4M7YA 1NKBA 2VQEK 2YHXA 5AQXA 1KAZA 3J81O 1KTQA 1U04A 4ZTFA 3N4QA 3B6OA 2E6MA 3O08A 1B9DA 3JYTA 1RT6A 3ZSZA 3NF9A 4BR0A 5IWAK 1YXQA 2Q3SA 4WQ4C 4BRFA 4OPHA 3DLLL 4JRPA 1X9MA 2FSJA 1RBUA 3TANA 2PY5A 2GTDA 3SV4A 4IFYA 3UKRA 1UA0A 5C42A 3J7YP 3L4IA 4K42A 3I55N 3KKRA 4ILJA 1DLOA 3TAEA 4QS9A 1YUWA 3KWGA 3ZX2A 1IKYA 1L5UA 1T44A 3OJUA 2F8TA 1RBVA 2F9TA 3L6QA 3ISNC 3T69A 3U6FA 3UKUA 5KI6A 2E2OA 1NJWA 3OTOK 4CJKA 3ULDA 2QTDA 3A5NC 3QESA 2Q1NA 4BY9C 1BA0A 3LPUA 1EQYA 3GE1A 2A1SA 4E1MA 5BRFA 4H5TA 2P9PB 1J54A 2NZTA 4M3XA 4FWOA 2YJEA 1I3AA 4OPJA 3K5MA 1FXXA 4BGAA 3AVKA 4DKWA 2DFFA 1VAZA 3RMDA 3OYGA 1HPMA 2O8FA 3SV3A 4CIEA 4GKKK 1HJOA 5AQUA 3NH0A 1O13A 5BN8A 4JKCA 4DQPA 3VESA 3BY5A 1NGFA 3AA2A 2GBZA 3G10A 1ASUA 4CJ5A 4L8RB 2YJFA 1BCOA 4CD1A 2G8FA 3EEQA 5BREA 4JHDA 4CGGA 4CEZA 3VA0A 4I2PA 1S6PA 5EX5A 5BRHA 4Z4HA 3DLRA 1ATRA 1BISA 4DB3A 2D0PA 2QI2A 4DR4K 4JNEA 3U4LA 1Z05A 4E7LA 1CZBA 4AHSA 3F5TA 3UE5A 5AQOA 4N5SA 1NGGA 4GKJK 4W5RA 3R6MA 1RDCA 4CHOA 3O9SA 5HLFA 3V4IA 4CZLA 3V1QA 4OPKA 3ZETB 3EO3A 3GBTA 3EZ5A 3BP8A 3CM5A 4DSEA 2VWJA 4JS4A 3DRRA 1S5JA 3DI6A 3ZT2A 1LW0A 1G99A 1IG9A 5GADP 2KLAA 3MDQA 4B08A 4IBNA 1YHQN 5AQJA 5GIPA 3S3OA 4LF4K 1XNQK 3CCLN 1S1UA 4IJAA 3HPOA 1FKPA 1VQ8N 3P38A 1U47A 3HI0A 3TTDA 1ZBFA 3ID8A 5CR4A 4CE9A 2QWOA 1RTHA 4BE0A 1VSLA 2P9IA 1HNXK 1RT5A 4Z4GA 3HP9A 4BRLA 4CIGA 3NCIA 3UKRB 1HNZK 4FJNA 3BDPA 1HYVA 3H08A 3QEWA 3OYHA 2OANA 4CGHA 3V81A 3TR8A 3DOLA 2QKBA 2E6LA 3LZIA 3O1WA 3H46O 2JWLA 3HM8A 1T6CA 1W97L 4PUOA 4E3SA 4H0YB 1NKEA 2VG6A 3UKUB 3LANA 4IEIA 1H1VA 4CBUA 3VQBA 1BQMA 3TSPA 3CCVN 2HHTA 3C7NA 3KIOA 5KQ8A 1JCGA 3A5LC 1ZXOA 1BO5O 4JKHA 4O8KA 4BRNA 1J5OA 4DU1A 1KRPA 1IBKK 3ZSVA 4CZKA 4MO4A 1SKRA 2B4JA 2VQFK 5AQGA 2JGUA 1BGXT 1N6QA 3DLBA 4NXMK 4A59A 5JS2A 2O8FB 3MX2A 4WFAL 3AY9A 3MEEA 5E26A 3O9UA 2ZGZA 3KLEA 2YCHA 5FPNA 3BF1A 3G71N 3ATUA 2HHXA 4V19S 4OPAA 4B9SA 4JHDB 1HX1A 3C0BA 4BRCA 1QSSA 1GOCA 4U7BA 2QWRA 1ZBHA 1MWMA 1HMVA 3CQXA 2VYPA 3PV8A 4Y1CA 3EKSA 4IO8A 3CFRA 2P1JA 2O4IA 1TVRA 1HNWK 1XHXA 4CJEA 3RR8A 3FZFA 3HZ6A 4BDYA 4E7KA 4LH5A 3KJVA 4IO9L 4FLUA 2GUPA 3OYEA 3ZSOA 1WSEA 3SAGA 4B3MK 1Q86O 4OLAA 4BWJA 4O5BA 4AM6A 4AILC 1S1WA 1TK5A 3M8PA 1VSIA 4DQSA 4CEEA 4M45A 2A3ZA 2YNFA 5AQVA 4CZGA 4EIAA 4LY7A 1C1BA 4CHZA 4DTRA 3NFAA 5C10A 3EN9A 3HBTA 1VSKA 3QMLA 1S1VA 4L3QA 4CJ3A 3VQQA 1EKEA 4MDAA 3OYLA 1T8EA 1OVYA 4NYFA 1ZBLA 1N33K 4FJMA 4KREA 3HTVA 4BRQA 1KQSM 2W42A 3P1GA 3NE6A 1OH6A 1RDBA 3MMVA 4CHNA 1KVBA 5M1OA 4CJQA 3CCQN 3I56N 2HVHA 1WBDA 4Z4FA 2E2NA 5LMUK 3TAMA 2P9IB 2WUSA 3L2RA 3EZWA 3R3LA 3THYA 3AA3A 4DMNA 4CJ7A 3V1OA 4CF0A 2X6SA 1I39A 1U6ZA 1HR0K 3UIQA 1Y97A 3DYAA 2ASOA 2YX6A 4AH9A 3O4WA 3HL8A 2I7NA 4J2DA 2ZWHA 1M90O 5AQIA 5JLHA 5FDLA 3F9KA 3QNNA 2KZMA 3LDNA 1KFSA 5CE3A 1Q7YO 4FJ9A 3AVNA 1VQ9N 4DFMA 4CK2A 1RBRA 3ENHA 2F96A 2P9KA 3C7NB 3H6EA 3GDQA 4JK7A 5M1PA 3KKSA 2QW9A 4N41A 1REVA 3FZLA 4CBWA 3THWA 4CF8A 2BTFA 3CC2N 2YNGA 4WE1A 2Z1JA 4FXDA 2PAVA 1X3NA 1QQMA 1VQLN 2DFHA 4DV1K 3VGMA 2IGIA 4C8LA 2A42A 1RBTA 4YDUA 5EVZA 5FROA 4DV6K 3CCEN 3LDLA 4W5TA 5C2DA 3ZSWA 3AO5A 3TI0A 2Z1HA 3ZYYX 3DWLA 1VQ5N 5GAGP 2XHBA 3ATVA 4CF2A 3ZSYA 3MX5A 4CEQA 1HJRA 1QTMA 2UUAK 1D9DA 4H5WA 2D1KA 3HPHA 3G6EN 4DFPA 3P83D 3ZX3A 1U45A 1BIZA 3O9RA 4IDHA 5E41A 3T1YK 4IXCA 1VSJA 3VN5A 3CM6A 4JKEA 3CPEA 1U48A 5KGWA 4BC2A 4CFAA 1XQSC 4KB1A 2X78A 3I8BA 3OYFA 5AQSA 4AM7A 4LF5K 1NK7A 2KFZA 1HQEA 5AQZA 4IOXA 2HBJA 3JS6A 2NRWA 4FJGA 3LDSA 1KC8O 1SL2A 3ZEUA 2OPPA 1MA9B 4CEBA 4X66K 2A41A 2YHAA 5AQPA 4C8OA 3HT3A 2D5RA 4Y1DA 3AV9A 3P4IA 1IH7A 1QVFM 2RN2A 3NBPA 5KQDA 1HQUA 4CZEA 1NNEA 1T05A 1DKGD 4M41A 4AHTA 4KHNA 3IMXA 1CXUA 1EP4A 2NRXA 1SL1A 5FLXO 3EE8A 3S41A 4BRHA 3F2KA 4ZTJA 1Q9YA 4NCGA 1G15A 4CZHA 3SPZA 3P5JA 4LF6K 3QLHA 4BE1A 3L2UA 3THYB 3OS2A 1XWLA 2LSNA 3A5OC 1SKSA 4FZXC 4JI8K 3MWPA 1OKJA 3AVFA 4DR1K 4WYBA 3PX6A 4O0IA 3THXA 2P5GA 3TARA 5AQNA 4PWDA 5E84A 1IBLK 3O3HA 2IIRA 3L4QA 3QB0A 2WBNA 1X3MA 2CH6A 2ZQBA 1QE1A 5JICA 1HKGA 3TSUA 2ATQA 3SJHA 3CJCA 4DV3K 4DQIA 4IFVA 4ELTA 2AJQA 4BACA 3MWTA 4BVOA 4PKGA 3DRSA 2P9KB 4RW7A 4W5QA 1XI1A 4FLZA 5ELZA 4I2QA 3VOVA 4F3TA 4J2AA 3THWB 3WT0A 1MDUB 3MEGA 5DM6L 4DSLA 4EHUA 5AQFA 1TKTA 4DR5K 4LF9K 5AQWA 4FYDA 5CZ2A 3AA4A 3J8AA 4XEIA 1FJGK 3H1QA 3Q7BA 1VSHA 4FWLA 4JEPA 4OKKA 1NOYA 1EXQA 3LWMA 4DG1A 1YI2N 3I0SA 3WUHA 3ZLJA 3PSIA 4FO0A 2HHUA 5AQKA 4DTUA 2QWLA 3CJ7A 1JLQA 3LP0A 4CZMA 5GINA 3A8YA 1NK6A 2VGMA 3TSQA 2Z1IA 1S9GA 4M3WA 3VEXA 1E4FT 1BL3A 3M1FA 3OS1A 4JI7K 3QBWA 4H5NA 1C0FA 4B1ZA 3SMPA 3EY1A 4MLEA 4OKJA 4CJWA 2WFBA 4CI6A 2HMPA 2KTQA 3QO9A 3O4QA 4IG3A 4Z4CA 1XUPO 1B92A 1RCHA 4HUFA 1EX4A 1GOAA 4M3RA 3MN7A 3VMFB 1UOCA 1N5YA 2D0AA 4DSJA 3E66A 3AVHA 4NLCA 3IRXA 1WSFA 1S22A 3DXKA 1LOTB 3WQTA 4FJLA 4JN4A 3ZEUB 1JLBA 3U8XA 3VQ5A 2HHHK 2W41A 1NGCA 3L0QA 1VSMA 4YOVA 3AAQA 1HKCA 4BC3A 5KPZA 2FSNA 2PFUA 3VTHA 4NXNK 5AFUA 1FW6A 1KCFA 3CPWM 4DV0K 2G8IA 2G8HA 1ASVA 1R59O 4KBOA 3SAHA 3HK2A 1TKDA 2QWNA 4DHYA 5GIOA 3CCJN 3CMEN 4CK3A 4HHTA 3H1VX 4BVPA 1S3XA 3SQ1A 2KQ2A 4CGJA 4DTNA 1KAYA 2ZF5O 5AR0A 4CERA 1SZ2A 3ALYA 3LZJA 1JXEA 5F2RA 4JI6K 4KI6A 2IC3A 3THXB 4X62K 4H5VA 3EE9A 1ZC6A 1A5XA 1BCMA 4KHWA 3NGZA 1HRHA 3LAMA 4HUEA 3K58A 4IKFA 1C0GA 1TGOA 3C94A 1V4TA 2QKKA 3OYAA 1RDWX 1TL1A 2G8UA 4QCLA 2GWJA 3K5OA 3TAPA 1S1TA 2HNDA 3RMCA 1VQNN 4CZJA 1IBMK 2X74A 2GUIA 2HB5A 2O8BA 4Z4EA 3ZT1A 4PKHA 4FLXA 5HRSA 1K73O 2YI1A 1RNHA 3AVGA 4GY2B 3L8BA 4B3TK 3BZCA 3O3FA 1O1WA 2FBXA 2UXCK 1WB9A 1RBSA 3U3YA 4PA1A 4RW4A 1K8AO 2X6NA 2FBTA 4KTZA 4CCHA 3M5RA 5GAHP 3GL1A 4AF1A 3IDHA 1IKWA 2QWPA 3PSFA 5AQMA 4B1UB 5BPMA 3K0SA 4BRPA 3NAEA 2KZZA 3MCPA 3IKMA 4DU4A 1W7AA 3KTQA 3QICA 3DLHA 1E4GT 4K8ZA 3FR0A 4DR7K 5KRSA 4KH4A 4N47A 1RT1A 3VQ8A 2HHVA 4DV4K 4AHVA 4CEAA 4B1YB 3NH1A 1BIUA 4CFCA 3KLFA 4PQUA 4CEFA 4FZZA 4JKDA 2XY6A 1WAFA 4YORA 3LM2A 2DPNA 2RHKA 4ISFA 4BQLA 4C1NI 4FZYA 3ULEA 1HKBA 2DY4A 4JKAA 3SMSA 3CJBA 4IG0A 4QS8A 2YHYA 1C6VA 3N4PA 4NLBA 1M1KO 1U4BA 3DOKA 1BG3A 3DXKB 5BPLA 3SAFA 4CJSA 4DU3A 1QS4A 3T1HK 1Y64A 1JLCA 2NRVA 5H1SQ 2P9NA 3KK7A 4JKBA 4FJHA 5M1FA 5HOOA 3C95A 3SLCA 1C0UA 4Q5VA 2QA4N 2ZJPL 4BDPA 3M3ZA 4HWIA 1NJIO 2HNYA 4CD3A 3NH2A 3DXMA 3MK6A 4CZFA 3LM9A 1RILA 2Y1JA 2NRZA 5FPEA 4EHTA 2HW3A 1C0TA 3FE1A 4WFNL 1QQOA 3V9SA 3NVMA 2P9SA 2OPQA 4CESA 4DTPA 3H45C 3O4NA 3K5NA 4KHYA 5CYQA 4F3OA 2Q2RA 3WNFA 3K2PA 1NJYA 4DF4A 1NGBA 4Q0BA 3LP1A 4BC4A 1HUXA 1T03A 3PX4A 5EOYA 1DTTA 4BGBA 2WTUA 2HMIA 4XH4A 2YV0X 2OPSA 2BE2A 1TUYA 3O9QA 2XY5A 4DV7K 1FK9A 4YOWA 3MXMA 1EWRA 2ZD1A 3CFPA 3CQ8A 2O8EA 3CFOA 3G0ZA 2JLEA 2O8BB 1VRTA 2IVNA 3RMBA 1JLEA 1XC3A 2UUBK 5BR8K 1UA1A 4M3UA 3V6DA 3CMAN 5ADXA 4QOZB 3A2FA 4H4OA 1NK8A 4YHHK 3AO4A 2D0OA 4O4GA 4I6MA 1L3VA 5I3UA 2QEXN 3W3DA 4WF9L 3LDQA 3E1YA 4LF8K 3SPYA 3CC4N 1NGHA 2VGNA 4GMJB 3BUZB 4JS5A 2E8AA 3U9DA 4C8KA 1LWCA 3MN9A 4IEEA 4YDUC 1KLNA 1LAVA 5AQHA 3S3MA 4Z0UA 3ZX0A 4K8XA 3C6UA 3AO1A 1BUPA 3G25A 1VSDA 3ZSXA 3IS9A 2VWKA 4GV9A 4FWMA 3KK3A 3OYIA 3T3FA 1KXPA 4BREA 4FPAA 4HVJA 4PKIA 3AVBA 3KLGA 4RW8A 4H5RA 3O9TA 3WEEA 3ULEB 4B3OA 2PZSA 4HCBA 2IOCA 5CHIA 1N8RO 1C0MA 4ICLA 3U3GA 4AQYK 2P51A 4DSIA 1Q8IA 3VEVA 4NCBA 2HHQA 1HLUA 1S1XA 1CZ9A 4JRQA 1KVAA 2P9NB 4AHCA 3KD5E 3LL3A 2Z1GA 2UUCK 4KPYA 3MEDA 3HO1A 1D8YA 1WBBA 4A61A 1JCFA 4KV8A 3DXMB 5HRPA 4DTSA 4FJIA 3CG7A 3TAQA 4RW6A 4HTLA 3RSEA 1X9JA 1KAXA 3VQ9A 1ZYQA 3K59A 4U67L 2KW4A 3QINA 1SUQA 5F1XA 2P9SB 4I9LA 3PY8A 3WQUA 3KLIA 2FC0A 3O5BA 3LP3A 4A57A 4BG8A 4EP4A 1E3MA 2V51B 2H3GX 1C1CA 3OA9A 4RCHA 4FLWA 1ITGA 3RMAA 4FSVA 1DEJA 5JMVA 5KTQA 2R7YA 4TSXA 4YFUA 3VF4A 2G8VA 4DF8A 2IVOA 1L3UA 3NDKA 1VQPN 2YHBA 3J80O 4DSKA 5CYMA 3MN5A 3HYFA 4DTOA 4IJNA 3VF2A 2F9WA 5BPNA 3DAWA 2FLOA 1YTUA 3VEOA 1BQNA 5KRTA 1LWEA 2O8EB 1UWBA 2FBVA 4BG9A 4LSLA 4DQQA 1MU2A 1GOBA 1JLFA 1NOZA 1YT3A 3CCMN 2QXFA 5M1QA 1SL0A 2XY7A 4O8UA 3E9LA 3P39A 1IV0A 3T1AA 4I9QA 4IDKA 1K6YA 3NMUA 2E2QA 1TK8A 4I6MB 2NRHA 4FVUA 3M6GA 1WSGA 3W0LA 3VQ4A 1QVGM 4J2BA 3WXLA 4B8AB 3SZ2A 3VQAA 2YHWA 4DS5A 2Q36A 3CJ1A 4JKFA 3QIOA 1OVQA 1QHTA 4CZIA 4FJ8A 2F4VK 4JKGA 4NCAA 3AGKA 4B9TA 4YNQA 2E4LA 4JLHA 4E1JA 3HSCA 1YF5L 1Q18A 3I0RA 1ZBSA 1SKWA 2E2PA 4JI4K 4BDZA 1L3SA 4JK8A 5GAEP 2GV9A 2VG5A 3SUOA 1U2VA 5EY4A 5AQRA 3SK3A 4EAHD 4OJRA 2E1YA 4WFBL 2NLXA 3WEEB 3QERA 3OBWA 1YJWN 3GOIA 2AP1A 3NF8A 3WNGA 3WNEA 3DLGA 4M63C 3OS0A 4FWRA 5LY3A 4F2SA 4CHQA 3BGRA 3KK1A 3D2EB 4BWMA 4N56A 1DT9A 4CJRA 4ELUA 1RDUA 3LDOA 3MN6A 1RT4A 2ZE2A 1RT2A 4CFBA 3QETA 4IOAL 2OCEA 1RTJA 3H3NO 4DQ8A 3LDPA 2Y1IA 3VQCA 4FW2A 1EETA 5HP1A 2EX3A 2FF6A 3J7AP 1HNVA 1Z26A 1JJ2M 2ZJQL 2KHOA 3OYNA 3RSEB 3DRPA 2HF3A 3CJAA 3SJJA 4UQGA 4FOEA 3V9UA 4DV2K 3SI6A 5AZIA 4WCEL 3HXMA 3BZKA 2OPRA 1JKHA 3ASMA 3HM9A 3QEIA 3ZT3A 1CZAN 4ILGB 4IOCL 4BRKA 1QQNA 3AVLA 4YOTA 3ZT4A 3HSTB 4FM2A 2YNIA 4PL7A 2BANA 3I33A 1XMOK 3C6HA 3AO3A 1Z25A 3WXMB 3PIPL 4KFBA 4FK0A 4DLEA 4KH5A 4MFBA 3OVNA 1BOTO 4CGFA 1D9FA 2ITMA 1S6QA 5MLCQ 1NBWA 1RGIA 4ISEA 4DCHA 4XH5A 3SQ4A 4H0PA 3PO5A 4MDBA 5AJ3K 4DTMA 4O55A 1GLBG 4YY3K 2NUBA 4RTFD 2XY8A 3NGIA 3O1BA 4O0JA 3H3OB 4KHPK 3AAPA 1ZBUA 4ELVA 4NO7A 1BA1A 3CCSN 4Z94A 5LL6Z 3V9XA 2Q31A 5C15A 2PYLA 1NK0A 1GLEG 1JXBA 4B9NA 4KHSA 4KI4A 1YIJN 5AQQA 3LPTA 3C6AA 3CI5A 1NG9A 1YJ9N 4JKGB 4MQ3A 1J9AA 3HOTA
chains in the Genus database with same CATH topology
1HMVA 2HHVA 4FJXA 3PV8A 4Y1CA 4FJKA 3AVIA 4E7JA 3SUNA 3SQ0A 3CFRA 2P1JA 2O4IA 1SV5A 1TVRA 4KKOA 5SWMA 3L3UA 4AHVA 4CEAA 3OY9A 1XHXA 4CJEA 3NH1A 3RR8A 1BIUA 4CFCA 3KLFA 3ZT0A 3QIPA 4C8MA 4AHRA 4CEFA 4FJ7A 4FZZA 4M3YA 4BDYA 2XY6A 3SQ2A 4E7KA 4LH5A 3KJVA 1WAFA 4CIFA 1KSPA 4FLUA 3OYEA 3ZSOA 1WSEA 4FZYA 4OLAA 4BWJA 4O5BA 4CJPA 3S9HA 2DY4A 4AILC 3OYJA 4B8CA 4HCCA 4IG0A 1S1WA 1TK5A 3HVTA 3M8PA 1VSIA 1C6VA 3RR7A 4DQSA 3B6PA 4CEEA 4M45A 1FKOA 4E7IA 2YKNA 2YNFA 1L3TA 1U4BA 3DOKA 4LY7A 5J2PA 1C1BA 4CHZA 4CJSA 3OJSA 4DU3A 4DTXA 1QS4A 3NFAA 4CHYA 4DTRA 1JLCA 4AHUA 2IDOA 1ASWA 1IO2A 1VSKA 2O4GA 1S1VA 4FJHA 4CJ3A 1BI4A 3VQQA 4CEDA 3C95A 5J2QA 1EKEA 4CK1A 3OYLA 1T8EA 1C0UA 4Q5VA 4NYFA 4FK2A 4BDPA 1ZBLA 4RG8A 3VQ7A 3C6TA 4CGIA 2HNYA 3NH2A 4FJMA 4KREA 1NK4A 3L2VA 4FJJA 2W42A 3P1GA 3NE6A 2XRIA 1XHZA 1RDBA 1RILA 1X1PA 4FM1A 4CHNA 1KVBA 3ZSRA 2Y1JA 4CJQA 4EZ9A 3V1RA 3AVJA 4FLYA 2G8KA 1C0TA 2HW3A 2FBYA 1T7PA 4DWIA 2HVHA 3V9SA 3AO2A 4W5OA 2OPQA 4Z4FA 1NK9A 1VRUA 5FRMA 4CESA 4FW1A 3V9WA 3TAMA 5DMRA 3KK2A 3L2RA 4B9LA 2DFEA 4DTPA 3KLHA 3NGYA 3AA3A 2HHWA 4DMNA 1RDDA 1A5VA 3O4NA 3V1OA 2EHGA 2X6SA 4CF0A 3K5NA 1I39A 4KHYA 3AVAA 3NF6A 5CYQA 4CGDA 4E7HA 3UIQA 4CJUA 1A5WA 4F3OA 1ZBHA 3WNFA 3PUFA 4DSFA 3RWUA 3HJFA 3K2PA 2ITGA 3NF7A 1NJYA 2D0CA 1Y97A 3DYAA 4DF4A 4Q0BA 1R0AA 3SYZA 3LP1A 5J2MA 4AH9A 1NJZA 1TKXA 3HL8A 4B9MA 1T03A 3PX4A 5DK5A 4J2DA 1DTTA 1WSIA 3SCXA 2HMIA 2G8WA 2YV0X 2OPSA 2KFNA 1QQCA 2BE2A 1Q9XA 5FDLA 3F9KA 3QNNA 2KZMA 4DS4A 2XY5A 1KFSA 1FK9A 4HUGA 1WN7A 3MXMA 2WOMA 4O44A 1ZBIA 2ZD1A 3CFPA 4FJ9A 3AVNA 3CQ8A 3T19A 4M3TA 4DFMA 3QEVA 4CK2A 3EYZA 1RBRA 3CFOA 3G0ZA 2HVIA 4E89A 3LP2A 2JLEA 3M8QA 5HBMA 2F96A 1VRTA 4DTJA 4DFKA 3RMBA 3KKSA 1JLEA 4W5NA 1JLGA 1YVUA 4N41A 3O3GA 1REVA 4N76A 1C1AA 1WSHA 4CF8A 1UA1A 3V6DA 5HRNA 4M3UA 4M3ZA 4LSNA 4C8NA 4E1NA 4QOZB 2YNGA 3A2FA 4WE1A 1B9FA 4H4OA 1TK0A 5D3GA 3PO4A 1NK8A 2Z1JA 4FXDA 4LH4A 3AO4A 4O4GA 3PX0A 2YNHA 4GW6A 1NKCA 1RTDA 3MECA 2DFHA 1L3VA 5I3UA 4CJVA 3L2QA 2IGIA 3M8RA 4CJFA 4C8LA 1BHLA 3M8SA 1RBTA 3DMJA 4CJTA 4M42A 1JLAA 5T7BA 5FROA 4W5TA 4GVMA 3ZSWA 3OYMA 1WAJA 3SPYA 1UAXA 3AO5A 3IAYA 4EZ6A 1LAWA 3TI0A 4QAGA 2Z1HA 3OYKA 4GMJB 3QNOA 4JS5A 2XHBA 4C8KA 3VQDA 1LWCA 4E19A 4CF2A 1IKVA 3ZSYA 5KGXA 4CEQA 1HJRA 5CZ1A 1KLNA 4BE2A 1QTMA 4RW9A 1LAVA 4OGCA 1D9DA 1F21A 2RF2A 3S3MA 3TABA 3HPHA 4Z0UA 4DFPA 3C6UA 3TAGA 3P83D 4F4KA 4K8XA 3AO1A 1U45A 1TV6A 3TAFA 1BIZA 1VSDA 3ZSXA 3IG1A 3IS9A 2VWKA 4NYNA 3HPGA 5E41A 1LV5A 4J2EA 3KK3A 3OYIA 3T3FA 4KAZA 1VSJA 4CEOA 3VN5A 3CM6A 4HVJA 2WONA 1WSJA 3I8DA 1U48A 5KGWA 3HVRA 3SNNA 4CFAA 4CHPA 4KHUA 3AVBA 3KLGA 1HYZA 3ITHA 4I7FA 4RW8A 4KB1A 2X78A 4B3OA 2YKMA 3OYFA 2OA8A 1W9HA 3LWLA 2PZSA 2HNZA 4HCBA 2IOCA 1NK7A 2KFZA 1HQEA 4E0DA 3DM2A 3FFIA 1C0MA 4ICLA 1NK5A 3VQEA 3U3GA 4CF1A 3THVA 4F8RA 4ZHRA 4DSIA 2P51A 1Q8IA 4B9VA 4CF9A 4KO0A 2D0BA 5SZTA 3MXJA 4FJGA 3LDSA 4NCBA 4KHQA 2XO7A 4OLBA 1S1XA 2HHQA 1SL2A 3VQPA 5C25A 1CZ9A 2OPPA 4CEBA 4JRQA 1KVAA 2YHAA 3JSMA 4KRFA 4C8OA 3HT3A 4AHCA 3KD5E 2D5RA 1BI4B 1RT7A 2Z1GA 4Y1DA 4KPYA 3AV9A 1DTQA 3MEDA 3V9ZA 3HO1A 1IH7A 1KLMA 1D8YA 3CYMA 2RN2A 3NBPA 4Z4IA 3KD1E 4KV8A 5HRPA 4DTSA 5I42A 1HQUA 3LAKA 5HRRA 2OZMA 4FJIA 3CG7A 3TAQA 1HYSA 1JL1A 1TL3A 1NKBA 1T05A 4KHNA 4M41A 4RW6A 5CY4A 4AHTA 1CXUA 1EP4A 1KTQA 1U04A 1RT3A 3VQ9A 3K59A 1ZYQA 1SL1A 2BGGA 4ZTFA 3B6OA 2KW4A 2E6MA 3QINA 4ZTJA 1Q9YA 1B9DA 1SUQA 4NCGA 1RT6A 1G15A 3JYTA 3ZSZA 4I9LA 3PY8A 3SPZA 3NF9A 3KLIA 2Q3SA 3P5JA 4JRPA 3QLHA 2FC0A 1X9MA 3LP3A 1RBUA 4EP4A 3TANA 2PY5A 4BE1A 3DLEA 3L2UA 3SV4A 2DTUA 3OS2A 1XWLA 2LSNA 1SKSA 4FLWA 4IFYA 1C1CA 4XIUA 1ITGA 5J1EA 3RMAA 4FZXC 1UA0A 5KTQA 2R7YA 4H8KA 4FLVA 4TSXA 4YFUA 2G8VA 1HPZA 3AVFA 5C42A 4DF8A 3PX6A 3KKRA 4O0IA 1DLOA 3TARA 1L3UA 2P5GA 4ID1A 3NDKA 3TAEA 4PWDA 1TAUA 2YHBA 4KTWA 4DSKA 4EP5A 5CYMA 3O3HA 1IKYA 1L5UA 3HYFA 3OJUA 4DTOA 2F8TA 1RBVA 2ZQBA 3ISNC 1QE1A 3U6FA 1IKXA 1YTUA 5KI6A 1NJWA 1BQNA 5KRTA 2ATQA 4F2RA 2QK9A 1LWEA 1UWBA 4CJKA 2FBVA 4DQIA 4IFVA 3ULDA 4ELTA 2AJQA 4CJLA 4LSLA 4OKEA 4BACA 3QESA 3RTVA 3DRSA 1MU2A 4RW7A 4W5QA 1GOBA 1RTIA 4DQQA 1JLFA 4FLZA 1XI1A 3LPUA 1NOZA 1YT3A 3MAQA 2A1SA 4I2QA 4E1MA 2QXFA 4F3TA 1SL0A 2XY7A 4PY5A 4J2AA 1CLQA 1J54A 1XC9A 4G1QA 3MEGA 3T1AA 4M3XA 1I3AA 4OPJA 4I9QA 3K5MA 4DSLA 1FXXA 4DLGA 4IDKA 1TKTA 1K6YA 2OZSA 3AVKA 1TK8A 4FYDA 5CZ2A 3WNHA 2DFFA 3RMDA 3AA4A 3OYGA 3SV3A 4HTUA 4CIEA 1VSHA 1WSGA 3VQ4A 4J2BA 4OVLA 3NH0A 4R5PA 4KTQA 4OKKA 4B8AB 3SZ2A 5J2NA 3VQAA 1NOYA 4DQPA 1EXQA 4DS5A 3LWMA 3S3NA 3AA2A 2GBZA 1JL2A 3G10A 4DG1A 3QIOA 1ASUA 4FK4A 2IAJA 4CJ5A 3OYCA 1BCOA 3I0SA 4L8RB 1QHTA 2G8FA 4DTUA 2HHUA 4CGGA 3K5LA 4CEZA 3SUQA 4FCYA 4FJ8A 4NCAA 3VA0A 3F73A 3RRHA 3AA5X 4I2PA 3LALA 1JLQA 1S6PA 4B9TA 3LP0A 4YNQA 4Z4HA 3K57A 4CJ4A 2E4LA 1VSEA 1VSFA 4JLHA 3DLRA 1QSYA 5FRNA 1NK6A 2Z1IA 4DQRA 1X9WA 1BISA 1S9GA 4M3WA 3I0RA 1BL3A 2BDPA 1TKZA 3OS1A 1SKWA 4BDZA 1L3SA 4E7LA 5HROA 1CZBA 4AHSA 4OKJA 4CJWA 3EY1A 2GV9A 2VG7A 2VG5A 3SUOA 2KTQA 2B5JA 3O4QA 3QO9A 4IG3A 4N5SA 3AVCA 1CXQA 4OJRA 4Z4CA 4W5RA 3QERA 1RDCA 4CHOA 3NF8A 5HLFA 1B92A 1RCHA 4HUFA 3WNGA 3WNEA 3V4IA 1EX4A 1GOAA 3DLGA 4M3RA 3ZSQA 1UOCA 3V1QA 4OPKA 3OS0A 3OYBA 2HHSA 1N5YA 2D0AA 3EZ5A 4DSJA 4F2SA 4CECA 3AVHA 4CHQA 3CM5A 4FM0A 4DSEA 3IRXA 5K14A 3BGRA 1WSFA 2VWJA 3HP6A 3KK1A 4JS4A 4BWMA 2P5OA 4FJLA 4N56A 3DRRA 4CJRA 1JLBA 3VQ5A 1S5JA 3ZCMA 3DI6A 4DFJA 4ELUA 3ZT2A 1LW0A 4CFDA 4FVMA 1IG9A 1VSMA 1RT4A 2ZE2A 1RT2A 4CFBA 3QETA 4B08A 2PYJA 4IBNA 1RDAA 1RTJA 3D0PA 1LWFA 1KCFA 2Y1IA 3VQCA 4FW2A 1EETA 5HP1A 4B9UA 3S3OA 5EU7A 1ASVA 2EX3A 2G8HA 2OYQA 2G8IA 1HNVA 1KFDA 1S1UA 1Z26A 3OYNA 3DRPA 3HPOA 1FKPA 3HK2A 3SJJA 1TKDA 4OGEA 4UQGA 1U47A 4CK3A 1ZBFA 3V9UA 4HHTA 3SI6A 4CE9A 3SQ1A 3HXMA 2KQ2A 4CGJA 4LD0A 2OPRA 1JKHA 3ASMA 4H4MA 4DTNA 3HM9A 1RTHA 4CERA 4BE0A 1VSLA 3ALYA 1RT5A 1WNSA 1S9EA 3ZT3A 3LZJA 3HP9A 3QEIA 4Z4GA 5C24A 1D5AA 3VA3A 4CIGA 3L2WA 3NCIA 5JS1A 1JXEA 1LW2A 3RRGA 3AVLA 4FJNA 3BDPA 4KI6A 3ZT4A 1HYVA 3HSTB 2IC3A 1U49A 4FM2A 3H08A 3QEWA 3OYHA 2YNIA 4CGHA 2A1RA 2BANA 3TR8A 3V81A 3TWHA 3DOLA 2RPIA 2QKBA 1A5XA 1BCMA 3AO3A 1Z25A 2E6LA 3LZIA 3NGZA 4KHWA 3MXIA 1HRHA 3LAMA 1HNIA 4KFBA 4HUEA 4FK0A 3K58A 4DLEA 4IKFA 4PUOA 4MFBA 3SUPA 3OVNA 1TGOA 3C94A 4E3SA 1NKEA 2QKKA 2VG6A 4CGFA 3LANA 3OYAA 1D9FA 1TL1A 2G8UA 1S6QA 4QCLA 3DLKA 3K5OA 3SQ4A 3PO5A 3TAPA 1S1TA 2HNDA 3RMCA 1X9SA 2ETJA 3VQBA 1BQMA 2X74A 2GUIA 2HB5A 3L3VA 4DTMA 4Z4EA 2HHTA 4O55A 4FLTA 3KIOA 3E01A 3ZT1A 3NHGA 4KB0A 2NUBA 5HRSA 4FLXA 1J5OA 2XY8A 1KVCA 3NGIA 4DU1A 1KRPA 4O0JA 1RNHA 3AVGA 3L8BA 2F8SA 1VK0A 3ZSVA 1SKRA 1ZBUA 4ELVA 2B4JA 2B6AA 3O3FA 1W0HA 1O1WA 2FBXA 3QEXA 1QSLA 1WLJA 1RBSA 3U3YA 4PA1A 3V9XA 2RKIA 4RW4A 2JGUA 1BGXT 3OYDA 1N6QA 2X6NA 3DLBA 2PYLA 1NK0A 1TAQA 5JS2A 1JXBA 4ID5A 2FBTA 3D45A 4B9NA 4KTZA 4KHSA 2I5JA 4KI4A 1YTAA 4FJ5A 4CCHA 4PQUA 3VQ6A 3MEEA 1J53A 3KLEA 1IKWA 2IS3A 3LPTA 2HHXA 1NJXA 3NAEA 2KZZA 4DU4A 3KTQA 4B9SA 3DLHA 4K8ZA 3QEPA 1QSSA 3AVMA 4MQ3A 1GOCA 5KRSA 4N47A 1J9AA 1RT1A 3VQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMV A;  2HHV A;  4FJX A;  3PV8 A;  4Y1C A;  4FJK A;  3AVI A;  4E7J A;  3SUN A;  3SQ0 A;  3CFR A;  2P1J A;  2O4I A;  1SV5 A;  1TVR A;  4KKO A;  5SWM A;  3L3U A;  4AHV A;  4CEA A;  3OY9 A;  1XHX A;  4CJE A;  3NH1 A;  3RR8 A;  1BIU A;  4CFC A;  3KLF A;  3ZT0 A;  3QIP A;  4C8M A;  4AHR A;  4CEF A;  4FJ7 A;  4FZZ A;  4M3Y A;  4BDY A;  2XY6 A;  3SQ2 A;  4E7K A;  4LH5 A;  3KJV A;  1WAF A;  4CIF A;  1KSP A;  4FLU A;  3OYE A;  3ZSO A;  1WSE A;  4FZY A;  4OLA A;  4BWJ A;  4O5B A;  4CJP A;  3S9H A;  2DY4 A;  4AIL C;  3OYJ A;  4B8C A;  4HCC A;  4IG0 A;  1S1W A;  1TK5 A;  3HVT A;  3M8P A;  1VSI A;  1C6V A;  3RR7 A;  4DQS A;  3B6P A;  4CEE A;  4M45 A;  1FKO A;  4E7I A;  2YKN A;  2YNF A;  1L3T A;  1U4B A;  3DOK A;  4LY7 A;  5J2P A;  1C1B A;  4CHZ A;  4CJS A;  3OJS A;  4DU3 A;  4DTX A;  1QS4 A;  3NFA A;  4CHY A;  4DTR A;  1JLC A;  4AHU A;  2IDO A;  1ASW A;  1IO2 A;  1VSK A;  2O4G A;  1S1V A;  4FJH A;  4CJ3 A;  1BI4 A;  3VQQ A;  4CED A;  3C95 A;  5J2Q A;  1EKE A;  4CK1 A;  3OYL A;  1T8E A;  1C0U A;  4Q5V A;  4NYF A;  4FK2 A;  4BDP A;  1ZBL A;  4RG8 A;  3VQ7 A;  3C6T A;  4CGI A;  2HNY A;  3NH2 A;  4FJM A;  4KRE A;  1NK4 A;  3L2V A;  4FJJ A;  2W42 A;  3P1G A;  3NE6 A;  2XRI A;  1XHZ A;  1RDB A;  1RIL A;  1X1P A;  4FM1 A;  4CHN A;  1KVB A;  3ZSR A;  2Y1J A;  4CJQ A;  4EZ9 A;  3V1R A;  3AVJ A;  4FLY A;  2G8K A;  1C0T A;  2HW3 A;  2FBY A;  1T7P A;  4DWI A;  2HVH A;  3V9S A;  3AO2 A;  4W5O A;  2OPQ A;  4Z4F A;  1NK9 A;  1VRU A;  5FRM A;  4CES A;  4FW1 A;  3V9W A;  3TAM A;  5DMR A;  3KK2 A;  3L2R A;  4B9L A;  2DFE A;  4DTP A;  3KLH A;  3NGY A;  3AA3 A;  2HHW A;  4DMN A;  1RDD A;  1A5V A;  3O4N A;  3V1O A;  2EHG A;  2X6S A;  4CF0 A;  3K5N A;  1I39 A;  4KHY A;  3AVA A;  3NF6 A;  5CYQ A;  4CGD A;  4E7H A;  3UIQ A;  4CJU A;  1A5W A;  4F3O A;  1ZBH A;  3WNF A;  3PUF A;  4DSF A;  3RWU A;  3HJF A;  3K2P A;  2ITG A;  3NF7 A;  1NJY A;  2D0C A;  1Y97 A;  3DYA A;  4DF4 A;  4Q0B A;  1R0A A;  3SYZ A;  3LP1 A;  5J2M A;  4AH9 A;  1NJZ A;  1TKX A;  3HL8 A;  4B9M A;  1T03 A;  3PX4 A;  5DK5 A;  4J2D A;  1DTT A;  1WSI A;  3SCX A;  2HMI A;  2G8W A;  2YV0 X;  2OPS A;  2KFN A;  1QQC A;  2BE2 A;  1Q9X A;  5FDL A;  3F9K A;  3QNN A;  2KZM A;  4DS4 A;  2XY5 A;  1KFS A;  1FK9 A;  4HUG A;  1WN7 A;  3MXM A;  2WOM A;  4O44 A;  1ZBI A;  2ZD1 A;  3CFP A;  4FJ9 A;  3AVN A;  3CQ8 A;  3T19 A;  4M3T A;  4DFM A;  3QEV A;  4CK2 A;  3EYZ A;  1RBR A;  3CFO A;  3G0Z A;  2HVI A;  4E89 A;  3LP2 A;  2JLE A;  3M8Q A;  5HBM A;  2F96 A;  1VRT A;  4DTJ A;  4DFK A;  3RMB A;  3KKS A;  1JLE A;  4W5N A;  1JLG A;  1YVU A;  4N41 A;  3O3G A;  1REV A;  4N76 A;  1C1A A;  1WSH A;  4CF8 A;  1UA1 A;  3V6D A;  5HRN A;  4M3U A;  4M3Z A;  4LSN A;  4C8N A;  4E1N A;  4QOZ B;  2YNG A;  3A2F A;  4WE1 A;  1B9F A;  4H4O A;  1TK0 A;  5D3G A;  3PO4 A;  1NK8 A;  2Z1J A;  4FXD A;  4LH4 A;  3AO4 A;  4O4G A;  3PX0 A;  2YNH A;  4GW6 A;  1NKC A;  1RTD A;  3MEC A;  2DFH A;  1L3V A;  5I3U A;  4CJV A;  3L2Q A;  2IGI A;  3M8R A;  4CJF A;  4C8L A;  1BHL A;  3M8S A;  1RBT A;  3DMJ A;  4CJT A;  4M42 A;  1JLA A;  5T7B A;  5FRO A;  4W5T A;  4GVM A;  3ZSW A;  3OYM A;  1WAJ A;  3SPY A;  1UAX A;  3AO5 A;  3IAY A;  4EZ6 A;  1LAW A;  3TI0 A;  4QAG A;  2Z1H A;  3OYK A;  4GMJ B;  3QNO A;  4JS5 A;  2XHB A;  4C8K A;  3VQD A;  1LWC A;  4E19 A;  4CF2 A;  1IKV A;  3ZSY A;  5KGX A;  4CEQ A;  1HJR A;  5CZ1 A;  1KLN A;  4BE2 A;  1QTM A;  4RW9 A;  1LAV A;  4OGC A;  1D9D A;  1F21 A;  2RF2 A;  3S3M A;  3TAB A;  3HPH A;  4Z0U A;  4DFP A;  3C6U A;  3TAG A;  3P83 D;  4F4K A;  4K8X A;  3AO1 A;  1U45 A;  1TV6 A;  3TAF A;  1BIZ A;  1VSD A;  3ZSX A;  3IG1 A;  3IS9 A;  2VWK A;  4NYN A;  3HPG A;  5E41 A;  1LV5 A;  4J2E A;  3KK3 A;  3OYI A;  3T3F A;  4KAZ A;  1VSJ A;  4CEO A;  3VN5 A;  3CM6 A;  4HVJ A;  2WON A;  1WSJ A;  3I8D A;  1U48 A;  5KGW A;  3HVR A;  3SNN A;  4CFA A;  4CHP A;  4KHU A;  3AVB A;  3KLG A;  1HYZ A;  3ITH A;  4I7F A;  4RW8 A;  4KB1 A;  2X78 A;  4B3O A;  2YKM A;  3OYF A;  2OA8 A;  1W9H A;  3LWL A;  2PZS A;  2HNZ A;  4HCB A;  2IOC A;  1NK7 A;  2KFZ A;  1HQE A;  4E0D A;  3DM2 A;  3FFI A;  1C0M A;  4ICL A;  1NK5 A;  3VQE A;  3U3G A;  4CF1 A;  3THV A;  4F8R A;  4ZHR A;  4DSI A;  2P51 A;  1Q8I A;  4B9V A;  4CF9 A;  4KO0 A;  2D0B A;  5SZT A;  3MXJ A;  4FJG A;  3LDS A;  4NCB A;  4KHQ A;  2XO7 A;  4OLB A;  1S1X A;  2HHQ A;  1SL2 A;  3VQP A;  5C25 A;  1CZ9 A;  2OPP A;  4CEB A;  4JRQ A;  1KVA A;  2YHA A;  3JSM A;  4KRF A;  4C8O A;  3HT3 A;  4AHC A;  3KD5 E;  2D5R A;  1BI4 B;  1RT7 A;  2Z1G A;  4Y1D A;  4KPY A;  3AV9 A;  1DTQ A;  3MED A;  3V9Z A;  3HO1 A;  1IH7 A;  1KLM A;  1D8Y A;  3CYM A;  2RN2 A;  3NBP A;  4Z4I A;  3KD1 E;  4KV8 A;  5HRP A;  4DTS A;  5I42 A;  1HQU A;  3LAK A;  5HRR A;  2OZM A;  4FJI A;  3CG7 A;  3TAQ A;  1HYS A;  1JL1 A;  1TL3 A;  1NKB A;  1T05 A;  4KHN A;  4M41 A;  4RW6 A;  5CY4 A;  4AHT A;  1CXU A;  1EP4 A;  1KTQ A;  1U04 A;  1RT3 A;  3VQ9 A;  3K59 A;  1ZYQ A;  1SL1 A;  2BGG A;  4ZTF A;  3B6O A;  2KW4 A;  2E6M A;  3QIN A;  4ZTJ A;  1Q9Y A;  1B9D A;  1SUQ A;  4NCG A;  1RT6 A;  1G15 A;  3JYT A;  3ZSZ A;  4I9L A;  3PY8 A;  3SPZ A;  3NF9 A;  3KLI A;  2Q3S A;  3P5J A;  4JRP A;  3QLH A;  2FC0 A;  1X9M A;  3LP3 A;  1RBU A;  4EP4 A;  3TAN A;  2PY5 A;  4BE1 A;  3DLE A;  3L2U A;  3SV4 A;  2DTU A;  3OS2 A;  1XWL A;  2LSN A;  1SKS A;  4FLW A;  4IFY A;  1C1C A;  4XIU A;  1ITG A;  5J1E A;  3RMA A;  4FZX C;  1UA0 A;  5KTQ A;  2R7Y A;  4H8K A;  4FLV A;  4TSX A;  4YFU A;  2G8V A;  1HPZ A;  3AVF A;  5C42 A;  4DF8 A;  3PX6 A;  3KKR A;  4O0I A;  1DLO A;  3TAR A;  1L3U A;  2P5G A;  4ID1 A;  3NDK A;  3TAE A;  4PWD A;  1TAU A;  2YHB A;  4KTW A;  4DSK A;  4EP5 A;  5CYM A;  3O3H A;  1IKY A;  1L5U A;  3HYF A;  3OJU A;  4DTO A;  2F8T A;  1RBV A;  2ZQB A;  3ISN C;  1QE1 A;  3U6F A;  1IKX A;  1YTU A;  5KI6 A;  1NJW A;  1BQN A;  5KRT A;  2ATQ A;  4F2R A;  2QK9 A;  1LWE A;  1UWB A;  4CJK A;  2FBV A;  4DQI A;  4IFV A;  3ULD A;  4ELT A;  2AJQ A;  4CJL A;  4LSL A;  4OKE A;  4BAC A;  3QES A;  3RTV A;  3DRS A;  1MU2 A;  4RW7 A;  4W5Q A;  1GOB A;  1RTI A;  4DQQ A;  1JLF A;  4FLZ A;  1XI1 A;  3LPU A;  1NOZ A;  1YT3 A;  3MAQ A;  2A1S A;  4I2Q A;  4E1M A;  2QXF A;  4F3T A;  1SL0 A;  2XY7 A;  4PY5 A;  4J2A A;  1CLQ A;  1J54 A;  1XC9 A;  4G1Q A;  3MEG A;  3T1A A;  4M3X A;  1I3A A;  4OPJ A;  4I9Q A;  3K5M A;  4DSL A;  1FXX A;  4DLG A;  4IDK A;  1TKT A;  1K6Y A;  2OZS A;  3AVK A;  1TK8 A;  4FYD A;  5CZ2 A;  3WNH A;  2DFF A;  3RMD A;  3AA4 A;  3OYG A;  3SV3 A;  4HTU A;  4CIE A;  1VSH A;  1WSG A;  3VQ4 A;  4J2B A;  4OVL A;  3NH0 A;  4R5P A;  4KTQ A;  4OKK A;  4B8A B;  3SZ2 A;  5J2N A;  3VQA A;  1NOY A;  4DQP A;  1EXQ A;  4DS5 A;  3LWM A;  3S3N A;  3AA2 A;  2GBZ A;  1JL2 A;  3G10 A;  4DG1 A;  3QIO A;  1ASU A;  4FK4 A;  2IAJ A;  4CJ5 A;  3OYC A;  1BCO A;  3I0S A;  4L8R B;  1QHT A;  2G8F A;  4DTU A;  2HHU A;  4CGG A;  3K5L A;  4CEZ A;  3SUQ A;  4FCY A;  4FJ8 A;  4NCA A;  3VA0 A;  3F73 A;  3RRH A;  3AA5 X;  4I2P A;  3LAL A;  1JLQ A;  1S6P A;  4B9T A;  3LP0 A;  4YNQ A;  4Z4H A;  3K57 A;  4CJ4 A;  2E4L A;  1VSE A;  1VSF A;  4JLH A;  3DLR A;  1QSY A;  5FRN A;  1NK6 A;  2Z1I A;  4DQR A;  1X9W A;  1BIS A;  1S9G A;  4M3W A;  3I0R A;  1BL3 A;  2BDP A;  1TKZ A;  3OS1 A;  1SKW A;  4BDZ A;  1L3S A;  4E7L A;  5HRO A;  1CZB A;  4AHS A;  4OKJ A;  4CJW A;  3EY1 A;  2GV9 A;  2VG7 A;  2VG5 A;  3SUO A;  2KTQ A;  2B5J A;  3O4Q A;  3QO9 A;  4IG3 A;  4N5S A;  3AVC A;  1CXQ A;  4OJR A;  4Z4C A;  4W5R A;  3QER A;  1RDC A;  4CHO A;  3NF8 A;  5HLF A;  1B92 A;  1RCH A;  4HUF A;  3WNG A;  3WNE A;  3V4I A;  1EX4 A;  1GOA A;  3DLG A;  4M3R A;  3ZSQ A;  1UOC A;  3V1Q A;  4OPK A;  3OS0 A;  3OYB A;  2HHS A;  1N5Y A;  2D0A A;  3EZ5 A;  4DSJ A;  4F2S A;  4CEC A;  3AVH A;  4CHQ A;  3CM5 A;  4FM0 A;  4DSE A;  3IRX A;  5K14 A;  3BGR A;  1WSF A;  2VWJ A;  3HP6 A;  3KK1 A;  4JS4 A;  4BWM A;  2P5O A;  4FJL A;  4N56 A;  3DRR A;  4CJR A;  1JLB A;  3VQ5 A;  1S5J A;  3ZCM A;  3DI6 A;  4DFJ A;  4ELU A;  3ZT2 A;  1LW0 A;  4CFD A;  4FVM A;  1IG9 A;  1VSM A;  1RT4 A;  2ZE2 A;  1RT2 A;  4CFB A;  3QET A;  4B08 A;  2PYJ A;  4IBN A;  1RDA A;  1RTJ A;  3D0P A;  1LWF A;  1KCF A;  2Y1I A;  3VQC A;  4FW2 A;  1EET A;  5HP1 A;  4B9U A;  3S3O A;  5EU7 A;  1ASV A;  2EX3 A;  2G8H A;  2OYQ A;  2G8I A;  1HNV A;  1KFD A;  1S1U A;  1Z26 A;  3OYN A;  3DRP A;  3HPO A;  1FKP A;  3HK2 A;  3SJJ A;  1TKD A;  4OGE A;  4UQG A;  1U47 A;  4CK3 A;  1ZBF A;  3V9U A;  4HHT A;  3SI6 A;  4CE9 A;  3SQ1 A;  3HXM A;  2KQ2 A;  4CGJ A;  4LD0 A;  2OPR A;  1JKH A;  3ASM A;  4H4M A;  4DTN A;  3HM9 A;  1RTH A;  4CER A;  4BE0 A;  1VSL A;  3ALY A;  1RT5 A;  1WNS A;  1S9E A;  3ZT3 A;  3LZJ A;  3HP9 A;  3QEI A;  4Z4G A;  5C24 A;  1D5A A;  3VA3 A;  4CIG A;  3L2W A;  3NCI A;  5JS1 A;  1JXE A;  1LW2 A;  3RRG A;  3AVL A;  4FJN A;  3BDP A;  4KI6 A;  3ZT4 A;  1HYV A;  3HST B;  2IC3 A;  1U49 A;  4FM2 A;  3H08 A;  3QEW A;  3OYH A;  2YNI A;  4CGH A;  2A1R A;  2BAN A;  3TR8 A;  3V81 A;  3TWH A;  3DOL A;  2RPI A;  2QKB A;  1A5X A;  1BCM A;  3AO3 A;  1Z25 A;  2E6L A;  3LZI A;  3NGZ A;  4KHW A;  3MXI A;  1HRH A;  3LAM A;  1HNI A;  4KFB A;  4HUE A;  4FK0 A;  3K58 A;  4DLE A;  4IKF A;  4PUO A;  4MFB A;  3SUP A;  3OVN A;  1TGO A;  3C94 A;  4E3S A;  1NKE A;  2QKK A;  2VG6 A;  4CGF A;  3LAN A;  3OYA A;  1D9F A;  1TL1 A;  2G8U A;  1S6Q A;  4QCL A;  3DLK A;  3K5O A;  3SQ4 A;  3PO5 A;  3TAP A;  1S1T A;  2HND A;  3RMC A;  1X9S A;  2ETJ A;  3VQB A;  1BQM A;  2X74 A;  2GUI A;  2HB5 A;  3L3V A;  4DTM A;  4Z4E A;  2HHT A;  4O55 A;  4FLT A;  3KIO A;  3E01 A;  3ZT1 A;  3NHG A;  4KB0 A;  2NUB A;  5HRS A;  4FLX A;  1J5O A;  2XY8 A;  1KVC A;  3NGI A;  4DU1 A;  1KRP A;  4O0J A;  1RNH A;  3AVG A;  3L8B A;  2F8S A;  1VK0 A;  3ZSV A;  1SKR A;  1ZBU A;  4ELV A;  2B4J A;  2B6A A;  3O3F A;  1W0H A;  1O1W A;  2FBX A;  3QEX A;  1QSL A;  1WLJ A;  1RBS A;  3U3Y A;  4PA1 A;  3V9X A;  2RKI A;  4RW4 A;  2JGU A;  1BGX T;  3OYD A;  1N6Q A;  2X6N A;  3DLB A;  2PYL A;  1NK0 A;  1TAQ A;  5JS2 A;  1JXB A;  4ID5 A;  2FBT A;  3D45 A;  4B9N A;  4KTZ A;  4KHS A;  2I5J A;  4KI4 A;  1YTA A;  4FJ5 A;  4CCH A;  4PQU A;  3VQ6 A;  3MEE A;  1J53 A;  3KLE A;  1IKW A;  2IS3 A;  3LPT A;  2HHX A;  1NJX A;  3NAE A;  2KZZ A;  4DU4 A;  3KTQ A;  4B9S A;  3DLH A;  4K8Z A;  3QEP A;  1QSS A;  3AVM A;  4MQ3 A;  1GOC A;  5KRS A;  4N47 A;  1J9A A;  1RT1 A;  3VQ8 A; 
#chains in the Genus database with same CATH topology
 3WXI A;  5M1K A;  4FJX A;  3CD6 N;  3PLA A;  3FZH A;  4FJK A;  4E7J A;  3SUN A;  3SQ0 A;  2Q0R A;  1SV5 A;  1J5E K;  4AHR A;  2ZGY A;  3QIP A;  4M3Y A;  4FWP A;  1GLD G;  1U2V B;  1XNR K;  3QDK A;  4LFA K;  3O80 A;  3TTC A;  3S9H A;  3AAR A;  4B8C A;  1GLL O;  1YJN N;  3B6P A;  3P31 A;  4E7I A;  2HBK A;  4GNI A;  4AHU A;  1ASW A;  1IO2 A;  4WQ5 A;  1IG8 A;  5J2Q A;  1BI4 A;  4CED A;  4H03 B;  2BUP A;  1NGI A;  3IUC A;  3WXJ A;  4RG8 A;  2NNW A;  4GVE A;  2NRT A;  4FJJ A;  4DR3 K;  2XRI A;  4H0V B;  4FOI A;  1XHZ A;  2I7P A;  1X1P A;  3V1R A;  2ZM6 K;  3AVJ A;  2G8K A;  2FBY A;  3AO2 A;  4W5O A;  5AZI B;  3PIO L;  3ENB A;  1VRU A;  1Z6R A;  4FW1 A;  2P9L A;  5TKW A;  5DMR A;  3V9W A;  3KK2 A;  2O8C A;  1XMQ K;  2DFE A;  4A2A A;  3VPZ A;  3NGY A;  2HHW A;  1RDD A;  1A5V A;  3VEY A;  2UXB K;  3NF6 A;  4CGD A;  4E7H A;  3QBX A;  4JV5 K;  2FF3 B;  3PUF A;  4BR9 A;  4DSF A;  3RWU A;  3NF7 A;  2D0C A;  1R0A A;  1NGD A;  1TKX A;  3KWI A;  2PBD A;  3TTF A;  4BR7 A;  1WSI A;  3FLC O;  3R8E A;  5FPM A;  1WN7 A;  1V4S A;  4O44 A;  1ZBI A;  3C65 A;  3VEN A;  4M7X A;  3QEV A;  2O8D A;  4F9O A;  3LP2 A;  5HBM A;  2QXL A;  3M8Q A;  4DTJ A;  1JLG A;  3ID6 A;  4BRA A;  3VF6 A;  3O3G A;  5JLF A;  4N76 A;  5HRN A;  4C8N A;  3QFU A;  5TKY A;  1TK0 A;  2A5X A;  1NMD A;  3PX0 A;  2YNH A;  3MEC A;  2E20 A;  3EKU A;  1OH5 A;  4CJV A;  3M8R A;  4JI3 K;  4CJF A;  1YIT N;  1BHL A;  3DMJ A;  5T7B A;  4GVM A;  3OYM A;  3IAY A;  1WAJ A;  4EZ6 A;  1UAX A;  1LAW A;  4QAG A;  4NB4 A;  3OYK A;  3CXC M;  3VQD A;  4E19 A;  4JK9 A;  5KGX A;  5CZ1 A;  2E5L K;  3RVC A;  4BE2 A;  3KHY A;  1N32 K;  2RF2 A;  3TAB A;  4F4K A;  3NVK A;  4YOY A;  3TAF A;  2HBM A;  3IG1 A;  1LV5 A;  4UY8 O;  1ATS A;  4KAZ A;  4CEO A;  1NGE A;  1JCE A;  2WON A;  5HL7 L;  3I8D A;  1VQ6 N;  3SNN A;  4DV5 K;  4JAX A;  2OTJ N;  1HYZ A;  3ITH A;  4I7F A;  2YKM A;  4ISG A;  1W9H A;  4B1W B;  3CCR N;  4E0D A;  1NK5 A;  4F8R A;  2A6A A;  3THV A;  4ZHR A;  4JI2 K;  4KO0 A;  2D0B A;  3FFK B;  1Q81 O;  5JVG L;  4KHQ A;  4JYA K;  1TYQ A;  3VQP A;  3O6W A;  4CBX A;  3MCA B;  5C25 A;  3JSM A;  2V7Z A;  5C12 A;  4FL9 A;  4B1X B;  1BI4 B;  1RT7 A;  4BRM A;  3CYM A;  4X65 K;  1NWK A;  4GV3 A;  5I42 A;  3D2F A;  3LAK A;  4OX9 K;  3Q7C A;  1HYS A;  4WQ4 A;  1JL1 A;  1TL3 A;  3VET A;  3FZM A;  2RE2 A;  5LJV A;  3J7Z O;  5CY4 A;  1VHX A;  1K8K A;  1RT3 A;  2BGG A;  1YVN A;  3OHR A;  2CGK A;  2CGL A;  2P9L B;  2O8C B;  3GG4 A;  3DLE A;  2DTU A;  3WXK A;  4XIU A;  4GV6 A;  5J1E A;  3D7E O;  4H8K A;  4FLV A;  1HPZ A;  4ID1 A;  3JXU A;  2HOE A;  4MLH A;  3BF3 A;  4KTW A;  1P8Z A;  4EP5 A;  5JVH L;  1WOQ A;  1IKX A;  4IZ9 A;  1QZ5 A;  4F2R A;  5C2F A;  5I9E B;  2QK9 A;  4IWV A;  2O8D B;  3CQY A;  4CJL A;  4OKE A;  3VEZ A;  5KPT A;  3RTV A;  1ESV A;  1RTI A;  1SAZ A;  3VTI A;  2CH5 A;  3MAQ A;  4PY5 A;  1CLQ A;  1XC9 A;  4G9Z A;  4DR6 K;  4G1Q A;  5BN9 A;  3DJC A;  1MWK A;  3CER A;  4DLG A;  1EWQ A;  4A2B A;  2OZS A;  3WNH A;  4ILH A;  5EXW A;  4HTU A;  4BR2 A;  4OVL A;  4R5P A;  4KTQ A;  5J2N A;  4LF7 K;  2P9U A;  3S3N A;  2UU9 K;  4FK4 A;  1JL2 A;  2IAJ A;  3OYC A;  2Q97 A;  4BQZ A;  3KVG A;  3K5L A;  3SUQ A;  4FCY A;  5AQT A;  1T6D A;  3F73 A;  4A62 A;  3AA5 X;  3RRH A;  1LCU A;  1GLA G;  2BH1 A;  3LAL A;  3K57 A;  4CJ4 A;  4B3R K;  2GEM A;  1VSE A;  1VSF A;  1QSY A;  5FRN A;  4DQR A;  1X9W A;  1J6Z A;  1VQK N;  3CET A;  2BDP A;  1TKZ A;  2FXU A;  5HRO A;  2J4R A;  4K41 A;  3K9K A;  2VG7 A;  5DM7 L;  1RFQ A;  2B5J A;  3AVC A;  1CXQ A;  3CHW A;  2W6L A;  3A5M C;  4FWK A;  4K43 A;  2E1Z A;  1N34 K;  1GLC G;  4OO1 J;  4BC5 A;  3ZSQ A;  3D2E A;  3OYB A;  2HHS A;  4C23 A;  4CEC A;  4FM0 A;  5K14 A;  3HP6 A;  2P5O A;  4DUY K;  1TYQ B;  3ZCM A;  4DFJ A;  4JD2 A;  4CFD A;  5M1N A;  4FVM A;  2PYJ A;  1RDA A;  3D0P A;  1LWF A;  3D2F B;  4B9U A;  1I94 K;  2OYQ A;  5EU7 A;  3VGK A;  1KFD A;  1NM1 A;  3R9P A;  2HF4 A;  1K8K B;  4DR2 K;  4QS7 A;  4OGE A;  3CIP A;  1ATN A;  3OW2 M;  1P90 A;  3B8A X;  1VQ4 N;  4RWT A;  4LD0 A;  5AZJ A;  3EL2 A;  4H4M A;  2VCP A;  1WNS A;  1S9E A;  5C24 A;  1D5A A;  3VA3 A;  4O5F A;  3L2W A;  5JS1 A;  1LW2 A;  3RRG A;  1U49 A;  3R1X A;  3CC7 N;  3FZK A;  2VWB A;  1BWF O;  1TUU A;  2ASM A;  2A1R A;  3TWH A;  1NLV A;  2RPI A;  2GX9 A;  2IVP A;  4C1N K;  3MXI A;  1HNI A;  3TPQ A;  3SUP A;  1NGJ A;  3K9J A;  3DLK A;  5AFU H;  3VGL A;  3CF5 L;  4Y0W A;  1X9S A;  2ETJ A;  4FWS A;  2AA4 A;  3L3V A;  3SBG A;  5B8H A;  4FLT A;  5LJW A;  3E01 A;  3NHG A;  4KB0 A;  3IFR A;  5A2Q O;  1KVC A;  5KPR A;  2HBL A;  2UYT A;  1BU6 O;  2F8S A;  1VK0 A;  2FSK A;  2EWS A;  2B6A A;  1W0H A;  3QEX A;  1QSL A;  1WLJ A;  5C0Y A;  2QWQ A;  2RKI A;  3OYD A;  2E88 A;  1TAQ A;  4ID5 A;  4DUZ K;  3D45 A;  2I5J A;  1YTA A;  3AGR A;  4FJ5 A;  3VQ6 A;  1J53 A;  4JI0 K;  2P9U B;  2IS3 A;  4JI1 K;  1NJX A;  2Q0U A;  3QEP A;  5BR9 A;  3A0I X;  3AVM A;  2HST A;  4FWN A;  3O8M A;  3AVI A;  5LMN K;  4EFH A;  4KKO A;  5SWM A;  3L3U A;  3OY9 A;  1SQK A;  5FRM A;  3ZT0 A;  4C8M A;  2F7T A;  4FJ7 A;  4LFC K;  1QHA A;  3SQ2 A;  4CIF A;  1YAG A;  2V7Y A;  1KSP A;  2GWK A;  4YOU A;  3HRG A;  1GLF O;  4CJP A;  5F0X A;  3OYJ A;  4HCC A;  3U9Z A;  4X64 K;  3SBT A;  3BEX A;  4CVN E;  4XH1 A;  3HVT A;  1EO1 A;  1NU0 A;  3RR7 A;  1FKO A;  1L3T A;  2YKN A;  5J2P A;  3UB5 A;  3OJS A;  4DTX A;  4CHY A;  4B3S K;  4BRI A;  1VQO N;  2IDO A;  2O4G A;  4JD2 B;  4JI5 K;  1TAU A;  4CK1 A;  4KH6 A;  4FK2 A;  3ENO A;  3VQ7 A;  2CGJ A;  3C6T A;  4LC9 B;  4CGI A;  3QFP A;  1DGK N;  4BRD A;  2WC9 A;  3L2V A;  1NK4 A;  4WQ5 C;  4LFB K;  4H0O A;  4FM1 A;  3ZSR A;  1SS6 A;  4EZ9 A;  2D4W A;  4FLY A;  1T7P A;  4DWI A;  1OH7 A;  1NK9 A;  5AZJ B;  3HOS A;  4B9L A;  3KLH A;  4MO5 A;  3JAM O;  2EHG A;  3AVA A;  2ZJR L;  4CJU A;  1A5W A;  3E9P A;  3VER A;  4YOX A;  3HJF A;  2ITG A;  2KKZ A;  4BR4 A;  3D6R A;  3SYZ A;  5J2M A;  1NJZ A;  4B9M A;  3CJ9 A;  5DK5 A;  4R79 A;  1VQ7 N;  3SCX A;  2G8W A;  2V52 B;  2KFN A;  1QQC A;  2QWM A;  4A5B A;  1Q9X A;  2NRR A;  4DS4 A;  4HUG A;  2WOM A;  3T19 A;  3EYZ A;  2HVI A;  1ILY A;  4E89 A;  4DFK A;  4BRO A;  4K25 A;  3FGU A;  4W5N A;  4B9Q A;  1YVU A;  2GEL A;  2OTL N;  2P9P A;  1C1A A;  1WSH A;  4M3Z A;  4BR5 A;  4A5A A;  4K0K K;  4LSN A;  3KZB A;  4E1N A;  1T3V A;  1B9F A;  5D3G A;  3PO4 A;  4LH4 A;  5FPD A;  4GW6 A;  1NKC A;  1RTD A;  4BRG A;  4H0T B;  5IT9 O;  3L2Q A;  1QZ6 A;  3E9O A;  3M8S A;  4CJT A;  4M42 A;  2UXD K;  1JLA A;  1W2B M;  4H0X B;  4PHT X;  3F9M A;  3QNO A;  3VEW A;  1Q82 O;  4CW7 B;  1IKV A;  3CCU N;  2QM1 A;  4J8F A;  4RW9 A;  4OGC A;  2W40 A;  1F21 A;  4M3T A;  3TAG A;  1GLJ O;  1TV6 A;  4NYN A;  5AQL A;  3HPG A;  1IJJ A;  4J2E A;  4B1V A;  2JWK A;  2W6K A;  1WSJ A;  3HVR A;  4KHU A;  3OBY A;  4CHP A;  5ADX H;  2ASP A;  4FPB A;  4IFE A;  2OA8 A;  1N36 K;  5BRD A;  3LWL A;  2A40 A;  2HNZ A;  1WUA A;  1OH8 A;  3DM2 A;  1NGA A;  3ZET A;  3FFI A;  3G4S N;  3VQE A;  4CF1 A;  4B9V A;  4CF9 A;  1VQM N;  5SZT A;  3MXJ A;  3T7Z A;  4PL8 A;  2XO7 A;  1K9M O;  4OLB A;  4FWQ A;  4KRF A;  1BDG A;  3TU5 A;  1DTQ A;  1NMN A;  3V9Z A;  1D4X A;  1KLM A;  1KD1 O;  4Z4I A;  5AQY A;  3KD1 E;  1S72 N;  5HRR A;  2OZM A;  4M7Y A;  1NKB A;  2VQE K;  2YHX A;  5AQX A;  1KAZ A;  3J81 O;  1KTQ A;  1U04 A;  4ZTF A;  3N4Q A;  3B6O A;  2E6M A;  3O08 A;  1B9D A;  3JYT A;  1RT6 A;  3ZSZ A;  3NF9 A;  4BR0 A;  5IWA K;  1YXQ A;  2Q3S A;  4WQ4 C;  4BRF A;  4OPH A;  3DLL L;  4JRP A;  1X9M A;  2FSJ A;  1RBU A;  3TAN A;  2PY5 A;  2GTD A;  3SV4 A;  4IFY A;  3UKR A;  1UA0 A;  5C42 A;  3J7Y P;  3L4I A;  4K42 A;  3I55 N;  3KKR A;  4ILJ A;  1DLO A;  3TAE A;  4QS9 A;  1YUW A;  3KWG A;  3ZX2 A;  1IKY A;  1L5U A;  1T44 A;  3OJU A;  2F8T A;  1RBV A;  2F9T A;  3L6Q A;  3ISN C;  3T69 A;  3U6F A;  3UKU A;  5KI6 A;  2E2O A;  1NJW A;  3OTO K;  4CJK A;  3ULD A;  2QTD A;  3A5N C;  3QES A;  2Q1N A;  4BY9 C;  1BA0 A;  3LPU A;  1EQY A;  3GE1 A;  2A1S A;  4E1M A;  5BRF A;  4H5T A;  2P9P B;  1J54 A;  2NZT A;  4M3X A;  4FWO A;  2YJE A;  1I3A A;  4OPJ A;  3K5M A;  1FXX A;  4BGA A;  3AVK A;  4DKW A;  2DFF A;  1VAZ A;  3RMD A;  3OYG A;  1HPM A;  2O8F A;  3SV3 A;  4CIE A;  4GKK K;  1HJO A;  5AQU A;  3NH0 A;  1O13 A;  5BN8 A;  4JKC A;  4DQP A;  3VES A;  3BY5 A;  1NGF A;  3AA2 A;  2GBZ A;  3G10 A;  1ASU A;  4CJ5 A;  4L8R B;  2YJF A;  1BCO A;  4CD1 A;  2G8F A;  3EEQ A;  5BRE A;  4JHD A;  4CGG A;  4CEZ A;  3VA0 A;  4I2P A;  1S6P A;  5EX5 A;  5BRH A;  4Z4H A;  3DLR A;  1ATR A;  1BIS A;  4DB3 A;  2D0P A;  2QI2 A;  4DR4 K;  4JNE A;  3U4L A;  1Z05 A;  4E7L A;  1CZB A;  4AHS A;  3F5T A;  3UE5 A;  5AQO A;  4N5S A;  1NGG A;  4GKJ K;  4W5R A;  3R6M A;  1RDC A;  4CHO A;  3O9S A;  5HLF A;  3V4I A;  4CZL A;  3V1Q A;  4OPK A;  3ZET B;  3EO3 A;  3GBT A;  3EZ5 A;  3BP8 A;  3CM5 A;  4DSE A;  2VWJ A;  4JS4 A;  3DRR A;  1S5J A;  3DI6 A;  3ZT2 A;  1LW0 A;  1G99 A;  1IG9 A;  5GAD P;  2KLA A;  3MDQ A;  4B08 A;  4IBN A;  1YHQ N;  5AQJ A;  5GIP A;  3S3O A;  4LF4 K;  1XNQ K;  3CCL N;  1S1U A;  4IJA A;  3HPO A;  1FKP A;  1VQ8 N;  3P38 A;  1U47 A;  3HI0 A;  3TTD A;  1ZBF A;  3ID8 A;  5CR4 A;  4CE9 A;  2QWO A;  1RTH A;  4BE0 A;  1VSL A;  2P9I A;  1HNX K;  1RT5 A;  4Z4G A;  3HP9 A;  4BRL A;  4CIG A;  3NCI A;  3UKR B;  1HNZ K;  4FJN A;  3BDP A;  1HYV A;  3H08 A;  3QEW A;  3OYH A;  2OAN A;  4CGH A;  3V81 A;  3TR8 A;  3DOL A;  2QKB A;  2E6L A;  3LZI A;  3O1W A;  3H46 O;  2JWL A;  3HM8 A;  1T6C A;  1W97 L;  4PUO A;  4E3S A;  4H0Y B;  1NKE A;  2VG6 A;  3UKU B;  3LAN A;  4IEI A;  1H1V A;  4CBU A;  3VQB A;  1BQM A;  3TSP A;  3CCV N;  2HHT A;  3C7N A;  3KIO A;  5KQ8 A;  1JCG A;  3A5L C;  1ZXO A;  1BO5 O;  4JKH A;  4O8K A;  4BRN A;  1J5O A;  4DU1 A;  1KRP A;  1IBK K;  3ZSV A;  4CZK A;  4MO4 A;  1SKR A;  2B4J A;  2VQF K;  5AQG A;  2JGU A;  1BGX T;  1N6Q A;  3DLB A;  4NXM K;  4A59 A;  5JS2 A;  2O8F B;  3MX2 A;  4WFA L;  3AY9 A;  3MEE A;  5E26 A;  3O9U A;  2ZGZ A;  3KLE A;  2YCH A;  5FPN A;  3BF1 A;  3G71 N;  3ATU A;  2HHX A;  4V19 S;  4OPA A;  4B9S A;  4JHD B;  1HX1 A;  3C0B A;  4BRC A;  1QSS A;  1GOC A;  4U7B A;  2QWR A;  1ZBH A;  1MWM A;  1HMV A;  3CQX A;  2VYP A;  3PV8 A;  4Y1C A;  3EKS A;  4IO8 A;  3CFR A;  2P1J A;  2O4I A;  1TVR A;  1HNW K;  1XHX A;  4CJE A;  3RR8 A;  3FZF A;  3HZ6 A;  4BDY A;  4E7K A;  4LH5 A;  3KJV A;  4IO9 L;  4FLU A;  2GUP A;  3OYE A;  3ZSO A;  1WSE A;  3SAG A;  4B3M K;  1Q86 O;  4OLA A;  4BWJ A;  4O5B A;  4AM6 A;  4AIL C;  1S1W A;  1TK5 A;  3M8P A;  1VSI A;  4DQS A;  4CEE A;  4M45 A;  2A3Z A;  2YNF A;  5AQV A;  4CZG A;  4EIA A;  4LY7 A;  1C1B A;  4CHZ A;  4DTR A;  3NFA A;  5C10 A;  3EN9 A;  3HBT A;  1VSK A;  3QML A;  1S1V A;  4L3Q A;  4CJ3 A;  3VQQ A;  1EKE A;  4MDA A;  3OYL A;  1T8E A;  1OVY A;  4NYF A;  1ZBL A;  1N33 K;  4FJM A;  4KRE A;  3HTV A;  4BRQ A;  1KQS M;  2W42 A;  3P1G A;  3NE6 A;  1OH6 A;  1RDB A;  3MMV A;  4CHN A;  1KVB A;  5M1O A;  4CJQ A;  3CCQ N;  3I56 N;  2HVH A;  1WBD A;  4Z4F A;  2E2N A;  5LMU K;  3TAM A;  2P9I B;  2WUS A;  3L2R A;  3EZW A;  3R3L A;  3THY A;  3AA3 A;  4DMN A;  4CJ7 A;  3V1O A;  4CF0 A;  2X6S A;  1I39 A;  1U6Z A;  1HR0 K;  3UIQ A;  1Y97 A;  3DYA A;  2ASO A;  2YX6 A;  4AH9 A;  3O4W A;  3HL8 A;  2I7N A;  4J2D A;  2ZWH A;  1M90 O;  5AQI A;  5JLH A;  5FDL A;  3F9K A;  3QNN A;  2KZM A;  3LDN A;  1KFS A;  5CE3 A;  1Q7Y O;  4FJ9 A;  3AVN A;  1VQ9 N;  4DFM A;  4CK2 A;  1RBR A;  3ENH A;  2F96 A;  2P9K A;  3C7N B;  3H6E A;  3GDQ A;  4JK7 A;  5M1P A;  3KKS A;  2QW9 A;  4N41 A;  1REV A;  3FZL A;  4CBW A;  3THW A;  4CF8 A;  2BTF A;  3CC2 N;  2YNG A;  4WE1 A;  2Z1J A;  4FXD A;  2PAV A;  1X3N A;  1QQM A;  1VQL N;  2DFH A;  4DV1 K;  3VGM A;  2IGI A;  4C8L A;  2A42 A;  1RBT A;  4YDU A;  5EVZ A;  5FRO A;  4DV6 K;  3CCE N;  3LDL A;  4W5T A;  5C2D A;  3ZSW A;  3AO5 A;  3TI0 A;  2Z1H A;  3ZYY X;  3DWL A;  1VQ5 N;  5GAG P;  2XHB A;  3ATV A;  4CF2 A;  3ZSY A;  3MX5 A;  4CEQ A;  1HJR A;  1QTM A;  2UUA K;  1D9D A;  4H5W A;  2D1K A;  3HPH A;  3G6E N;  4DFP A;  3P83 D;  3ZX3 A;  1U45 A;  1BIZ A;  3O9R A;  4IDH A;  5E41 A;  3T1Y K;  4IXC A;  1VSJ A;  3VN5 A;  3CM6 A;  4JKE A;  3CPE A;  1U48 A;  5KGW A;  4BC2 A;  4CFA A;  1XQS C;  4KB1 A;  2X78 A;  3I8B A;  3OYF A;  5AQS A;  4AM7 A;  4LF5 K;  1NK7 A;  2KFZ A;  1HQE A;  5AQZ A;  4IOX A;  2HBJ A;  3JS6 A;  2NRW A;  4FJG A;  3LDS A;  1KC8 O;  1SL2 A;  3ZEU A;  2OPP A;  1MA9 B;  4CEB A;  4X66 K;  2A41 A;  2YHA A;  5AQP A;  4C8O A;  3HT3 A;  2D5R A;  4Y1D A;  3AV9 A;  3P4I A;  1IH7 A;  1QVF M;  2RN2 A;  3NBP A;  5KQD A;  1HQU A;  4CZE A;  1NNE A;  1T05 A;  1DKG D;  4M41 A;  4AHT A;  4KHN A;  3IMX A;  1CXU A;  1EP4 A;  2NRX A;  1SL1 A;  5FLX O;  3EE8 A;  3S41 A;  4BRH A;  3F2K A;  4ZTJ A;  1Q9Y A;  4NCG A;  1G15 A;  4CZH A;  3SPZ A;  3P5J A;  4LF6 K;  3QLH A;  4BE1 A;  3L2U A;  3THY B;  3OS2 A;  1XWL A;  2LSN A;  3A5O C;  1SKS A;  4FZX C;  4JI8 K;  3MWP A;  1OKJ A;  3AVF A;  4DR1 K;  4WYB A;  3PX6 A;  4O0I A;  3THX A;  2P5G A;  3TAR A;  5AQN A;  4PWD A;  5E84 A;  1IBL K;  3O3H A;  2IIR A;  3L4Q A;  3QB0 A;  2WBN A;  1X3M A;  2CH6 A;  2ZQB A;  1QE1 A;  5JIC A;  1HKG A;  3TSU A;  2ATQ A;  3SJH A;  3CJC A;  4DV3 K;  4DQI A;  4IFV A;  4ELT A;  2AJQ A;  4BAC A;  3MWT A;  4BVO A;  4PKG A;  3DRS A;  2P9K B;  4RW7 A;  4W5Q A;  1XI1 A;  4FLZ A;  5ELZ A;  4I2Q A;  3VOV A;  4F3T A;  4J2A A;  3THW B;  3WT0 A;  1MDU B;  3MEG A;  5DM6 L;  4DSL A;  4EHU A;  5AQF A;  1TKT A;  4DR5 K;  4LF9 K;  5AQW A;  4FYD A;  5CZ2 A;  3AA4 A;  3J8A A;  4XEI A;  1FJG K;  3H1Q A;  3Q7B A;  1VSH A;  4FWL A;  4JEP A;  4OKK A;  1NOY A;  1EXQ A;  3LWM A;  4DG1 A;  1YI2 N;  3I0S A;  3WUH A;  3ZLJ A;  3PSI A;  4FO0 A;  2HHU A;  5AQK A;  4DTU A;  2QWL A;  3CJ7 A;  1JLQ A;  3LP0 A;  4CZM A;  5GIN A;  3A8Y A;  1NK6 A;  2VGM A;  3TSQ A;  2Z1I A;  1S9G A;  4M3W A;  3VEX A;  1E4F T;  1BL3 A;  3M1F A;  3OS1 A;  4JI7 K;  3QBW A;  4H5N A;  1C0F A;  4B1Z A;  3SMP A;  3EY1 A;  4MLE A;  4OKJ A;  4CJW A;  2WFB A;  4CI6 A;  2HMP A;  2KTQ A;  3QO9 A;  3O4Q A;  4IG3 A;  4Z4C A;  1XUP O;  1B92 A;  1RCH A;  4HUF A;  1EX4 A;  1GOA A;  4M3R A;  3MN7 A;  3VMF B;  1UOC A;  1N5Y A;  2D0A A;  4DSJ A;  3E66 A;  3AVH A;  4NLC A;  3IRX A;  1WSF A;  1S22 A;  3DXK A;  1LOT B;  3WQT A;  4FJL A;  4JN4 A;  3ZEU B;  1JLB A;  3U8X A;  3VQ5 A;  2HHH K;  2W41 A;  1NGC A;  3L0Q A;  1VSM A;  4YOV A;  3AAQ A;  1HKC A;  4BC3 A;  5KPZ A;  2FSN A;  2PFU A;  3VTH A;  4NXN K;  5AFU A;  1FW6 A;  1KCF A;  3CPW M;  4DV0 K;  2G8I A;  2G8H A;  1ASV A;  1R59 O;  4KBO A;  3SAH A;  3HK2 A;  1TKD A;  2QWN A;  4DHY A;  5GIO A;  3CCJ N;  3CME N;  4CK3 A;  4HHT A;  3H1V X;  4BVP A;  1S3X A;  3SQ1 A;  2KQ2 A;  4CGJ A;  4DTN A;  1KAY A;  2ZF5 O;  5AR0 A;  4CER A;  1SZ2 A;  3ALY A;  3LZJ A;  1JXE A;  5F2R A;  4JI6 K;  4KI6 A;  2IC3 A;  3THX B;  4X62 K;  4H5V A;  3EE9 A;  1ZC6 A;  1A5X A;  1BCM A;  4KHW A;  3NGZ A;  1HRH A;  3LAM A;  4HUE A;  3K58 A;  4IKF A;  1C0G A;  1TGO A;  3C94 A;  1V4T A;  2QKK A;  3OYA A;  1RDW X;  1TL1 A;  2G8U A;  4QCL A;  2GWJ A;  3K5O A;  3TAP A;  1S1T A;  2HND A;  3RMC A;  1VQN N;  4CZJ A;  1IBM K;  2X74 A;  2GUI A;  2HB5 A;  2O8B A;  4Z4E A;  3ZT1 A;  4PKH A;  4FLX A;  5HRS A;  1K73 O;  2YI1 A;  1RNH A;  3AVG A;  4GY2 B;  3L8B A;  4B3T K;  3BZC A;  3O3F A;  1O1W A;  2FBX A;  2UXC K;  1WB9 A;  1RBS A;  3U3Y A;  4PA1 A;  4RW4 A;  1K8A O;  2X6N A;  2FBT A;  4KTZ A;  4CCH A;  3M5R A;  5GAH P;  3GL1 A;  4AF1 A;  3IDH A;  1IKW A;  2QWP A;  3PSF A;  5AQM A;  4B1U B;  5BPM A;  3K0S A;  4BRP A;  3NAE A;  2KZZ A;  3MCP A;  3IKM A;  4DU4 A;  1W7A A;  3KTQ A;  3QIC A;  3DLH A;  1E4G T;  4K8Z A;  3FR0 A;  4DR7 K;  5KRS A;  4KH4 A;  4N47 A;  1RT1 A;  3VQ8 A;  2HHV A;  4DV4 K;  4AHV A;  4CEA A;  4B1Y B;  3NH1 A;  1BIU A;  4CFC A;  3KLF A;  4PQU A;  4CEF A;  4FZZ A;  4JKD A;  2XY6 A;  1WAF A;  4YOR A;  3LM2 A;  2DPN A;  2RHK A;  4ISF A;  4BQL A;  4C1N I;  4FZY A;  3ULE A;  1HKB A;  2DY4 A;  4JKA A;  3SMS A;  3CJB A;  4IG0 A;  4QS8 A;  2YHY A;  1C6V A;  3N4P A;  4NLB A;  1M1K O;  1U4B A;  3DOK A;  1BG3 A;  3DXK B;  5BPL A;  3SAF A;  4CJS A;  4DU3 A;  1QS4 A;  3T1H K;  1Y64 A;  1JLC A;  2NRV A;  5H1S Q;  2P9N A;  3KK7 A;  4JKB A;  4FJH A;  5M1F A;  5HOO A;  3C95 A;  3SLC A;  1C0U A;  4Q5V A;  2QA4 N;  2ZJP L;  4BDP A;  3M3Z A;  4HWI A;  1NJI O;  2HNY A;  4CD3 A;  3NH2 A;  3DXM A;  3MK6 A;  4CZF A;  3LM9 A;  1RIL A;  2Y1J A;  2NRZ A;  5FPE A;  4EHT A;  2HW3 A;  1C0T A;  3FE1 A;  4WFN L;  1QQO A;  3V9S A;  3NVM A;  2P9S A;  2OPQ A;  4CES A;  4DTP A;  3H45 C;  3O4N A;  3K5N A;  4KHY A;  5CYQ A;  4F3O A;  2Q2R A;  3WNF A;  3K2P A;  1NJY A;  4DF4 A;  1NGB A;  4Q0B A;  3LP1 A;  4BC4 A;  1HUX A;  1T03 A;  3PX4 A;  5EOY A;  1DTT A;  4BGB A;  2WTU A;  2HMI A;  4XH4 A;  2YV0 X;  2OPS A;  2BE2 A;  1TUY A;  3O9Q A;  2XY5 A;  4DV7 K;  1FK9 A;  4YOW A;  3MXM A;  1EWR A;  2ZD1 A;  3CFP A;  3CQ8 A;  2O8E A;  3CFO A;  3G0Z A;  2JLE A;  2O8B B;  1VRT A;  2IVN A;  3RMB A;  1JLE A;  1XC3 A;  2UUB K;  5BR8 K;  1UA1 A;  4M3U A;  3V6D A;  3CMA N;  5ADX A;  4QOZ B;  3A2F A;  4H4O A;  1NK8 A;  4YHH K;  3AO4 A;  2D0O A;  4O4G A;  4I6M A;  1L3V A;  5I3U A;  2QEX N;  3W3D A;  4WF9 L;  3LDQ A;  3E1Y A;  4LF8 K;  3SPY A;  3CC4 N;  1NGH A;  2VGN A;  4GMJ B;  3BUZ B;  4JS5 A;  2E8A A;  3U9D A;  4C8K A;  1LWC A;  3MN9 A;  4IEE A;  4YDU C;  1KLN A;  1LAV A;  5AQH A;  3S3M A;  4Z0U A;  3ZX0 A;  4K8X A;  3C6U A;  3AO1 A;  1BUP A;  3G25 A;  1VSD A;  3ZSX A;  3IS9 A;  2VWK A;  4GV9 A;  4FWM A;  3KK3 A;  3OYI A;  3T3F A;  1KXP A;  4BRE A;  4FPA A;  4HVJ A;  4PKI A;  3AVB A;  3KLG A;  4RW8 A;  4H5R A;  3O9T A;  3WEE A;  3ULE B;  4B3O A;  2PZS A;  4HCB A;  2IOC A;  5CHI A;  1N8R O;  1C0M A;  4ICL A;  3U3G A;  4AQY K;  2P51 A;  4DSI A;  1Q8I A;  3VEV A;  4NCB A;  2HHQ A;  1HLU A;  1S1X A;  1CZ9 A;  4JRQ A;  1KVA A;  2P9N B;  4AHC A;  3KD5 E;  3LL3 A;  2Z1G A;  2UUC K;  4KPY A;  3MED A;  3HO1 A;  1D8Y A;  1WBB A;  4A61 A;  1JCF A;  4KV8 A;  3DXM B;  5HRP A;  4DTS A;  4FJI A;  3CG7 A;  3TAQ A;  4RW6 A;  4HTL A;  3RSE A;  1X9J A;  1KAX A;  3VQ9 A;  1ZYQ A;  3K59 A;  4U67 L;  2KW4 A;  3QIN A;  1SUQ A;  5F1X A;  2P9S B;  4I9L A;  3PY8 A;  3WQU A;  3KLI A;  2FC0 A;  3O5B A;  3LP3 A;  4A57 A;  4BG8 A;  4EP4 A;  1E3M A;  2V51 B;  2H3G X;  1C1C A;  3OA9 A;  4RCH A;  4FLW A;  1ITG A;  3RMA A;  4FSV A;  1DEJ A;  5JMV A;  5KTQ A;  2R7Y A;  4TSX A;  4YFU A;  3VF4 A;  2G8V A;  4DF8 A;  2IVO A;  1L3U A;  3NDK A;  1VQP N;  2YHB A;  3J80 O;  4DSK A;  5CYM A;  3MN5 A;  3HYF A;  4DTO A;  4IJN A;  3VF2 A;  2F9W A;  5BPN A;  3DAW A;  2FLO A;  1YTU A;  3VEO A;  1BQN A;  5KRT A;  1LWE A;  2O8E B;  1UWB A;  2FBV A;  4BG9 A;  4LSL A;  4DQQ A;  1MU2 A;  1GOB A;  1JLF A;  1NOZ A;  1YT3 A;  3CCM N;  2QXF A;  5M1Q A;  1SL0 A;  2XY7 A;  4O8U A;  3E9L A;  3P39 A;  1IV0 A;  3T1A A;  4I9Q A;  4IDK A;  1K6Y A;  3NMU A;  2E2Q A;  1TK8 A;  4I6M B;  2NRH A;  4FVU A;  3M6G A;  1WSG A;  3W0L A;  3VQ4 A;  1QVG M;  4J2B A;  3WXL A;  4B8A B;  3SZ2 A;  3VQA A;  2YHW A;  4DS5 A;  2Q36 A;  3CJ1 A;  4JKF A;  3QIO A;  1OVQ A;  1QHT A;  4CZI A;  4FJ8 A;  2F4V K;  4JKG A;  4NCA A;  3AGK A;  4B9T A;  4YNQ A;  2E4L A;  4JLH A;  4E1J A;  3HSC A;  1YF5 L;  1Q18 A;  3I0R A;  1ZBS A;  1SKW A;  2E2P A;  4JI4 K;  4BDZ A;  1L3S A;  4JK8 A;  5GAE P;  2GV9 A;  2VG5 A;  3SUO A;  1U2V A;  5EY4 A;  5AQR A;  3SK3 A;  4EAH D;  4OJR A;  2E1Y A;  4WFB L;  2NLX A;  3WEE B;  3QER A;  3OBW A;  1YJW N;  3GOI A;  2AP1 A;  3NF8 A;  3WNG A;  3WNE A;  3DLG A;  4M63 C;  3OS0 A;  4FWR A;  5LY3 A;  4F2S A;  4CHQ A;  3BGR A;  3KK1 A;  3D2E B;  4BWM A;  4N56 A;  1DT9 A;  4CJR A;  4ELU A;  1RDU A;  3LDO A;  3MN6 A;  1RT4 A;  2ZE2 A;  1RT2 A;  4CFB A;  3QET A;  4IOA L;  2OCE A;  1RTJ A;  3H3N O;  4DQ8 A;  3LDP A;  2Y1I A;  3VQC A;  4FW2 A;  1EET A;  5HP1 A;  2EX3 A;  2FF6 A;  3J7A P;  1HNV A;  1Z26 A;  1JJ2 M;  2ZJQ L;  2KHO A;  3OYN A;  3RSE B;  3DRP A;  2HF3 A;  3CJA A;  3SJJ A;  4UQG A;  4FOE A;  3V9U A;  4DV2 K;  3SI6 A;  5AZI A;  4WCE L;  3HXM A;  3BZK A;  2OPR A;  1JKH A;  3ASM A;  3HM9 A;  3QEI A;  3ZT3 A;  1CZA N;  4ILG B;  4IOC L;  4BRK A;  1QQN A;  3AVL A;  4YOT A;  3ZT4 A;  3HST B;  4FM2 A;  2YNI A;  4PL7 A;  2BAN A;  3I33 A;  1XMO K;  3C6H A;  3AO3 A;  1Z25 A;  3WXM B;  3PIP L;  4KFB A;  4FK0 A;  4DLE A;  4KH5 A;  4MFB A;  3OVN A;  1BOT O;  4CGF A;  1D9F A;  2ITM A;  1S6Q A;  5MLC Q;  1NBW A;  1RGI A;  4ISE A;  4DCH A;  4XH5 A;  3SQ4 A;  4H0P A;  3PO5 A;  4MDB A;  5AJ3 K;  4DTM A;  4O55 A;  1GLB G;  4YY3 K;  2NUB A;  4RTF D;  2XY8 A;  3NGI A;  3O1B A;  4O0J A;  3H3O B;  4KHP K;  3AAP A;  1ZBU A;  4ELV A;  4NO7 A;  1BA1 A;  3CCS N;  4Z94 A;  5LL6 Z;  3V9X A;  2Q31 A;  5C15 A;  2PYL A;  1NK0 A;  1GLE G;  1JXB A;  4B9N A;  4KHS A;  4KI4 A;  1YIJ N;  5AQQ A;  3LPT A;  3C6A A;  3CI5 A;  1NG9 A;  1YJ9 N;  4JKG B;  4MQ3 A;  1J9A A;  3HOT A; 
#chains in the Genus database with same CATH homology
 1HMV A;  2HHV A;  4FJX A;  3PV8 A;  4Y1C A;  4FJK A;  3AVI A;  4E7J A;  3SUN A;  3SQ0 A;  3CFR A;  2P1J A;  2O4I A;  1SV5 A;  1TVR A;  4KKO A;  5SWM A;  3L3U A;  4AHV A;  4CEA A;  3OY9 A;  1XHX A;  4CJE A;  3NH1 A;  3RR8 A;  1BIU A;  4CFC A;  3KLF A;  3ZT0 A;  3QIP A;  4C8M A;  4AHR A;  4CEF A;  4FJ7 A;  4FZZ A;  4M3Y A;  4BDY A;  2XY6 A;  3SQ2 A;  4E7K A;  4LH5 A;  3KJV A;  1WAF A;  4CIF A;  1KSP A;  4FLU A;  3OYE A;  3ZSO A;  1WSE A;  4FZY A;  4OLA A;  4BWJ A;  4O5B A;  4CJP A;  3S9H A;  2DY4 A;  4AIL C;  3OYJ A;  4B8C A;  4HCC A;  4IG0 A;  1S1W A;  1TK5 A;  3HVT A;  3M8P A;  1VSI A;  1C6V A;  3RR7 A;  4DQS A;  3B6P A;  4CEE A;  4M45 A;  1FKO A;  4E7I A;  2YKN A;  2YNF A;  1L3T A;  1U4B A;  3DOK A;  4LY7 A;  5J2P A;  1C1B A;  4CHZ A;  4CJS A;  3OJS A;  4DU3 A;  4DTX A;  1QS4 A;  3NFA A;  4CHY A;  4DTR A;  1JLC A;  4AHU A;  2IDO A;  1ASW A;  1IO2 A;  1VSK A;  2O4G A;  1S1V A;  4FJH A;  4CJ3 A;  1BI4 A;  3VQQ A;  4CED A;  3C95 A;  5J2Q A;  1EKE A;  4CK1 A;  3OYL A;  1T8E A;  1C0U A;  4Q5V A;  4NYF A;  4FK2 A;  4BDP A;  1ZBL A;  4RG8 A;  3VQ7 A;  3C6T A;  4CGI A;  2HNY A;  3NH2 A;  4FJM A;  4KRE A;  1NK4 A;  3L2V A;  4FJJ A;  2W42 A;  3P1G A;  3NE6 A;  2XRI A;  1XHZ A;  1RDB A;  1RIL A;  1X1P A;  4FM1 A;  4CHN A;  1KVB A;  3ZSR A;  2Y1J A;  4CJQ A;  4EZ9 A;  3V1R A;  3AVJ A;  4FLY A;  2G8K A;  1C0T A;  2HW3 A;  2FBY A;  1T7P A;  4DWI A;  2HVH A;  3V9S A;  3AO2 A;  4W5O A;  2OPQ A;  4Z4F A;  1NK9 A;  1VRU A;  5FRM A;  4CES A;  4FW1 A;  3V9W A;  3TAM A;  5DMR A;  3KK2 A;  3L2R A;  4B9L A;  2DFE A;  4DTP A;  3KLH A;  3NGY A;  3AA3 A;  2HHW A;  4DMN A;  1RDD A;  1A5V A;  3O4N A;  3V1O A;  2EHG A;  2X6S A;  4CF0 A;  3K5N A;  1I39 A;  4KHY A;  3AVA A;  3NF6 A;  5CYQ A;  4CGD A;  4E7H A;  3UIQ A;  4CJU A;  1A5W A;  4F3O A;  1ZBH A;  3WNF A;  3PUF A;  4DSF A;  3RWU A;  3HJF A;  3K2P A;  2ITG A;  3NF7 A;  1NJY A;  2D0C A;  1Y97 A;  3DYA A;  4DF4 A;  4Q0B A;  1R0A A;  3SYZ A;  3LP1 A;  5J2M A;  4AH9 A;  1NJZ A;  1TKX A;  3HL8 A;  4B9M A;  1T03 A;  3PX4 A;  5DK5 A;  4J2D A;  1DTT A;  1WSI A;  3SCX A;  2HMI A;  2G8W A;  2YV0 X;  2OPS A;  2KFN A;  1QQC A;  2BE2 A;  1Q9X A;  5FDL A;  3F9K A;  3QNN A;  2KZM A;  4DS4 A;  2XY5 A;  1KFS A;  1FK9 A;  4HUG A;  1WN7 A;  3MXM A;  2WOM A;  4O44 A;  1ZBI A;  2ZD1 A;  3CFP A;  4FJ9 A;  3AVN A;  3CQ8 A;  3T19 A;  4M3T A;  4DFM A;  3QEV A;  4CK2 A;  3EYZ A;  1RBR A;  3CFO A;  3G0Z A;  2HVI A;  4E89 A;  3LP2 A;  2JLE A;  3M8Q A;  5HBM A;  2F96 A;  1VRT A;  4DTJ A;  4DFK A;  3RMB A;  3KKS A;  1JLE A;  4W5N A;  1JLG A;  1YVU A;  4N41 A;  3O3G A;  1REV A;  4N76 A;  1C1A A;  1WSH A;  4CF8 A;  1UA1 A;  3V6D A;  5HRN A;  4M3U A;  4M3Z A;  4LSN A;  4C8N A;  4E1N A;  4QOZ B;  2YNG A;  3A2F A;  4WE1 A;  1B9F A;  4H4O A;  1TK0 A;  5D3G A;  3PO4 A;  1NK8 A;  2Z1J A;  4FXD A;  4LH4 A;  3AO4 A;  4O4G A;  3PX0 A;  2YNH A;  4GW6 A;  1NKC A;  1RTD A;  3MEC A;  2DFH A;  1L3V A;  5I3U A;  4CJV A;  3L2Q A;  2IGI A;  3M8R A;  4CJF A;  4C8L A;  1BHL A;  3M8S A;  1RBT A;  3DMJ A;  4CJT A;  4M42 A;  1JLA A;  5T7B A;  5FRO A;  4W5T A;  4GVM A;  3ZSW A;  3OYM A;  1WAJ A;  3SPY A;  1UAX A;  3AO5 A;  3IAY A;  4EZ6 A;  1LAW A;  3TI0 A;  4QAG A;  2Z1H A;  3OYK A;  4GMJ B;  3QNO A;  4JS5 A;  2XHB A;  4C8K A;  3VQD A;  1LWC A;  4E19 A;  4CF2 A;  1IKV A;  3ZSY A;  5KGX A;  4CEQ A;  1HJR A;  5CZ1 A;  1KLN A;  4BE2 A;  1QTM A;  4RW9 A;  1LAV A;  4OGC A;  1D9D A;  1F21 A;  2RF2 A;  3S3M A;  3TAB A;  3HPH A;  4Z0U A;  4DFP A;  3C6U A;  3TAG A;  3P83 D;  4F4K A;  4K8X A;  3AO1 A;  1U45 A;  1TV6 A;  3TAF A;  1BIZ A;  1VSD A;  3ZSX A;  3IG1 A;  3IS9 A;  2VWK A;  4NYN A;  3HPG A;  5E41 A;  1LV5 A;  4J2E A;  3KK3 A;  3OYI A;  3T3F A;  4KAZ A;  1VSJ A;  4CEO A;  3VN5 A;  3CM6 A;  4HVJ A;  2WON A;  1WSJ A;  3I8D A;  1U48 A;  5KGW A;  3HVR A;  3SNN A;  4CFA A;  4CHP A;  4KHU A;  3AVB A;  3KLG A;  1HYZ A;  3ITH A;  4I7F A;  4RW8 A;  4KB1 A;  2X78 A;  4B3O A;  2YKM A;  3OYF A;  2OA8 A;  1W9H A;  3LWL A;  2PZS A;  2HNZ A;  4HCB A;  2IOC A;  1NK7 A;  2KFZ A;  1HQE A;  4E0D A;  3DM2 A;  3FFI A;  1C0M A;  4ICL A;  1NK5 A;  3VQE A;  3U3G A;  4CF1 A;  3THV A;  4F8R A;  4ZHR A;  4DSI A;  2P51 A;  1Q8I A;  4B9V A;  4CF9 A;  4KO0 A;  2D0B A;  5SZT A;  3MXJ A;  4FJG A;  3LDS A;  4NCB A;  4KHQ A;  2XO7 A;  4OLB A;  1S1X A;  2HHQ A;  1SL2 A;  3VQP A;  5C25 A;  1CZ9 A;  2OPP A;  4CEB A;  4JRQ A;  1KVA A;  2YHA A;  3JSM A;  4KRF A;  4C8O A;  3HT3 A;  4AHC A;  3KD5 E;  2D5R A;  1BI4 B;  1RT7 A;  2Z1G A;  4Y1D A;  4KPY A;  3AV9 A;  1DTQ A;  3MED A;  3V9Z A;  3HO1 A;  1IH7 A;  1KLM A;  1D8Y A;  3CYM A;  2RN2 A;  3NBP A;  4Z4I A;  3KD1 E;  4KV8 A;  5HRP A;  4DTS A;  5I42 A;  1HQU A;  3LAK A;  5HRR A;  2OZM A;  4FJI A;  3CG7 A;  3TAQ A;  1HYS A;  1JL1 A;  1TL3 A;  1NKB A;  1T05 A;  4KHN A;  4M41 A;  4RW6 A;  5CY4 A;  4AHT A;  1CXU A;  1EP4 A;  1KTQ A;  1U04 A;  1RT3 A;  3VQ9 A;  3K59 A;  1ZYQ A;  1SL1 A;  2BGG A;  4ZTF A;  3B6O A;  2KW4 A;  2E6M A;  3QIN A;  4ZTJ A;  1Q9Y A;  1B9D A;  1SUQ A;  4NCG A;  1RT6 A;  1G15 A;  3JYT A;  3ZSZ A;  4I9L A;  3PY8 A;  3SPZ A;  3NF9 A;  3KLI A;  2Q3S A;  3P5J A;  4JRP A;  3QLH A;  2FC0 A;  1X9M A;  3LP3 A;  1RBU A;  4EP4 A;  3TAN A;  2PY5 A;  4BE1 A;  3DLE A;  3L2U A;  3SV4 A;  2DTU A;  3OS2 A;  1XWL A;  2LSN A;  1SKS A;  4FLW A;  4IFY A;  1C1C A;  4XIU A;  1ITG A;  5J1E A;  3RMA A;  4FZX C;  1UA0 A;  5KTQ A;  2R7Y A;  4H8K A;  4FLV A;  4TSX A;  4YFU A;  2G8V A;  1HPZ A;  3AVF A;  5C42 A;  4DF8 A;  3PX6 A;  3KKR A;  4O0I A;  1DLO A;  3TAR A;  1L3U A;  2P5G A;  4ID1 A;  3NDK A;  3TAE A;  4PWD A;  1TAU A;  2YHB A;  4KTW A;  4DSK A;  4EP5 A;  5CYM A;  3O3H A;  1IKY A;  1L5U A;  3HYF A;  3OJU A;  4DTO A;  2F8T A;  1RBV A;  2ZQB A;  3ISN C;  1QE1 A;  3U6F A;  1IKX A;  1YTU A;  5KI6 A;  1NJW A;  1BQN A;  5KRT A;  2ATQ A;  4F2R A;  2QK9 A;  1LWE A;  1UWB A;  4CJK A;  2FBV A;  4DQI A;  4IFV A;  3ULD A;  4ELT A;  2AJQ A;  4CJL A;  4LSL A;  4OKE A;  4BAC A;  3QES A;  3RTV A;  3DRS A;  1MU2 A;  4RW7 A;  4W5Q A;  1GOB A;  1RTI A;  4DQQ A;  1JLF A;  4FLZ A;  1XI1 A;  3LPU A;  1NOZ A;  1YT3 A;  3MAQ A;  2A1S A;  4I2Q A;  4E1M A;  2QXF A;  4F3T A;  1SL0 A;  2XY7 A;  4PY5 A;  4J2A A;  1CLQ A;  1J54 A;  1XC9 A;  4G1Q A;  3MEG A;  3T1A A;  4M3X A;  1I3A A;  4OPJ A;  4I9Q A;  3K5M A;  4DSL A;  1FXX A;  4DLG A;  4IDK A;  1TKT A;  1K6Y A;  2OZS A;  3AVK A;  1TK8 A;  4FYD A;  5CZ2 A;  3WNH A;  2DFF A;  3RMD A;  3AA4 A;  3OYG A;  3SV3 A;  4HTU A;  4CIE A;  1VSH A;  1WSG A;  3VQ4 A;  4J2B A;  4OVL A;  3NH0 A;  4R5P A;  4KTQ A;  4OKK A;  4B8A B;  3SZ2 A;  5J2N A;  3VQA A;  1NOY A;  4DQP A;  1EXQ A;  4DS5 A;  3LWM A;  3S3N A;  3AA2 A;  2GBZ A;  1JL2 A;  3G10 A;  4DG1 A;  3QIO A;  1ASU A;  4FK4 A;  2IAJ A;  4CJ5 A;  3OYC A;  1BCO A;  3I0S A;  4L8R B;  1QHT A;  2G8F A;  4DTU A;  2HHU A;  4CGG A;  3K5L A;  4CEZ A;  3SUQ A;  4FCY A;  4FJ8 A;  4NCA A;  3VA0 A;  3F73 A;  3RRH A;  3AA5 X;  4I2P A;  3LAL A;  1JLQ A;  1S6P A;  4B9T A;  3LP0 A;  4YNQ A;  4Z4H A;  3K57 A;  4CJ4 A;  2E4L A;  1VSE A;  1VSF A;  4JLH A;  3DLR A;  1QSY A;  5FRN A;  1NK6 A;  2Z1I A;  4DQR A;  1X9W A;  1BIS A;  1S9G A;  4M3W A;  3I0R A;  1BL3 A;  2BDP A;  1TKZ A;  3OS1 A;  1SKW A;  4BDZ A;  1L3S A;  4E7L A;  5HRO A;  1CZB A;  4AHS A;  4OKJ A;  4CJW A;  3EY1 A;  2GV9 A;  2VG7 A;  2VG5 A;  3SUO A;  2KTQ A;  2B5J A;  3O4Q A;  3QO9 A;  4IG3 A;  4N5S A;  3AVC A;  1CXQ A;  4OJR A;  4Z4C A;  4W5R A;  3QER A;  1RDC A;  4CHO A;  3NF8 A;  5HLF A;  1B92 A;  1RCH A;  4HUF A;  3WNG A;  3WNE A;  3V4I A;  1EX4 A;  1GOA A;  3DLG A;  4M3R A;  3ZSQ A;  1UOC A;  3V1Q A;  4OPK A;  3OS0 A;  3OYB A;  2HHS A;  1N5Y A;  2D0A A;  3EZ5 A;  4DSJ A;  4F2S A;  4CEC A;  3AVH A;  4CHQ A;  3CM5 A;  4FM0 A;  4DSE A;  3IRX A;  5K14 A;  3BGR A;  1WSF A;  2VWJ A;  3HP6 A;  3KK1 A;  4JS4 A;  4BWM A;  2P5O A;  4FJL A;  4N56 A;  3DRR A;  4CJR A;  1JLB A;  3VQ5 A;  1S5J A;  3ZCM A;  3DI6 A;  4DFJ A;  4ELU A;  3ZT2 A;  1LW0 A;  4CFD A;  4FVM A;  1IG9 A;  1VSM A;  1RT4 A;  2ZE2 A;  1RT2 A;  4CFB A;  3QET A;  4B08 A;  2PYJ A;  4IBN A;  1RDA A;  1RTJ A;  3D0P A;  1LWF A;  1KCF A;  2Y1I A;  3VQC A;  4FW2 A;  1EET A;  5HP1 A;  4B9U A;  3S3O A;  5EU7 A;  1ASV A;  2EX3 A;  2G8H A;  2OYQ A;  2G8I A;  1HNV A;  1KFD A;  1S1U A;  1Z26 A;  3OYN A;  3DRP A;  3HPO A;  1FKP A;  3HK2 A;  3SJJ A;  1TKD A;  4OGE A;  4UQG A;  1U47 A;  4CK3 A;  1ZBF A;  3V9U A;  4HHT A;  3SI6 A;  4CE9 A;  3SQ1 A;  3HXM A;  2KQ2 A;  4CGJ A;  4LD0 A;  2OPR A;  1JKH A;  3ASM A;  4H4M A;  4DTN A;  3HM9 A;  1RTH A;  4CER A;  4BE0 A;  1VSL A;  3ALY A;  1RT5 A;  1WNS A;  1S9E A;  3ZT3 A;  3LZJ A;  3HP9 A;  3QEI A;  4Z4G A;  5C24 A;  1D5A A;  3VA3 A;  4CIG A;  3L2W A;  3NCI A;  5JS1 A;  1JXE A;  1LW2 A;  3RRG A;  3AVL A;  4FJN A;  3BDP A;  4KI6 A;  3ZT4 A;  1HYV A;  3HST B;  2IC3 A;  1U49 A;  4FM2 A;  3H08 A;  3QEW A;  3OYH A;  2YNI A;  4CGH A;  2A1R A;  2BAN A;  3TR8 A;  3V81 A;  3TWH A;  3DOL A;  2RPI A;  2QKB A;  1A5X A;  1BCM A;  3AO3 A;  1Z25 A;  2E6L A;  3LZI A;  3NGZ A;  4KHW A;  3MXI A;  1HRH A;  3LAM A;  1HNI A;  4KFB A;  4HUE A;  4FK0 A;  3K58 A;  4DLE A;  4IKF A;  4PUO A;  4MFB A;  3SUP A;  3OVN A;  1TGO A;  3C94 A;  4E3S A;  1NKE A;  2QKK A;  2VG6 A;  4CGF A;  3LAN A;  3OYA A;  1D9F A;  1TL1 A;  2G8U A;  1S6Q A;  4QCL A;  3DLK A;  3K5O A;  3SQ4 A;  3PO5 A;  3TAP A;  1S1T A;  2HND A;  3RMC A;  1X9S A;  2ETJ A;  3VQB A;  1BQM A;  2X74 A;  2GUI A;  2HB5 A;  3L3V A;  4DTM A;  4Z4E A;  2HHT A;  4O55 A;  4FLT A;  3KIO A;  3E01 A;  3ZT1 A;  3NHG A;  4KB0 A;  2NUB A;  5HRS A;  4FLX A;  1J5O A;  2XY8 A;  1KVC A;  3NGI A;  4DU1 A;  1KRP A;  4O0J A;  1RNH A;  3AVG A;  3L8B A;  2F8S A;  1VK0 A;  3ZSV A;  1SKR A;  1ZBU A;  4ELV A;  2B4J A;  2B6A A;  3O3F A;  1W0H A;  1O1W A;  2FBX A;  3QEX A;  1QSL A;  1WLJ A;  1RBS A;  3U3Y A;  4PA1 A;  3V9X A;  2RKI A;  4RW4 A;  2JGU A;  1BGX T;  3OYD A;  1N6Q A;  2X6N A;  3DLB A;  2PYL A;  1NK0 A;  1TAQ A;  5JS2 A;  1JXB A;  4ID5 A;  2FBT A;  3D45 A;  4B9N A;  4KTZ A;  4KHS A;  2I5J A;  4KI4 A;  1YTA A;  4FJ5 A;  4CCH A;  4PQU A;  3VQ6 A;  3MEE A;  1J53 A;  3KLE A;  1IKW A;  2IS3 A;  3LPT A;  2HHX A;  1NJX A;  3NAE A;  2KZZ A;  4DU4 A;  3KTQ A;  4B9S A;  3DLH A;  4K8Z A;  3QEP A;  1QSS A;  3AVM A;  4MQ3 A;  1GOC A;  5KRS A;  4N47 A;  1J9A A;  1RT1 A;  3VQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...