1BHLA

Cacodylated catalytic domain of hiv-1 integrase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
151
structure length
133
Chain Sequence
SPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
molecule keywords HIV-1 INTEGRASE
total genus 43
structure length 133
sequence length 151
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bhlA00
4CEAA 4FW1A 4CEEA 4B9SA 4Q0BA 4O44A 3G0ZA 4CF1A 2HNDA 2YNFA 3V9XA 3NFAA 1WLJA 4UQGA 2XRIA 3NE6A 1X9MA 4AH9A 4FLZA 4E0DA 4K8XA 5D3GA 4OLAA 3NF8A 1A5VA 2EX3A 3KD1E 1Z25A 3DOLA 1NKEA 3CM5A 4CEDA 4KV8A 4CECA 3OYBA 4RW9A 1NK5A 3KLIA 3QINA 4JLHA 3B6OA 1NKCA 3RRHA 4QCLA 4KHNA 4ELTA 2GV9A 1RDAA 1TKZA 4LY7A 2KFZA 1U45A 3C6TA 4HCCA 3OYMA 4O5BA 4DTJA 3PY8A 2X74A 4PWDA 4ZTFA 2RKIA 3FFIA 3LAKA 2XY5A 1QTMA 1ZBFA 4IFYA 4CGFA 1VRUA 3D45A 2XHBA 5EU7A 4NCBA 2HNZA 2FBYA 4B08A 3KLHA 3OYFA 1SL2A 3VQCA 1JXEA 1YVUA 5FROA 3SUOA 4F8RA 4Q5VA 3ZT2A 1CXQA 4BE2A 1X9SA 2I5JA 4OPKA 2BANA 2VWKA 3AO1A 3ASMA 4OJRA 4FM1A 3NGYA 4CHYA 3SV3A 2XY6A 3RMBA 1KVCA 2ZE2A 4IG3A 4LD0A 2A1RA 1ASVA 4FJ7A 4FVMA 4M3TA 4DQRA 1ZBIA 2AJQA 1B9FA 3DLGA 3SI6A 3QNNA 3TAMA 4HTUA 4CHQA 1ZBHA 3HL8A 3HSTB 1HRHA 1C1BA 1X1PA 1LV5A 1VSMA 3OS1A 1KVAA 4FM0A 3V6DA 5FRMA 2HHTA 5HP1A 3OYHA 2B4JA 3QERA 4PUOA 3L2UA 3PO5A 4B8CA 2GBZA 2HB5A 4G1QA 3WNHA 3K2PA 1SL0A 5J2MA 3O3FA 4J2DA 4CK2A 1ASWA 1QSLA 2F8TA 2VWJA 3VQ5A 3LPUA 1VSFA 4CE9A 4ID5A 1GOCA 3L3VA 1KTQA 3C95A 1RBUA 4ICLA 1S9GA 2RF2A 1TV6A 3NH2A 3OYIA 3OYCA 2VG7A 4DLEA 4I9QA 2RPIA 4DSEA 1IKVA 4N56A 3DI6A 4OVLA 4OGCA 2B5JA 1JKHA 3IRXA 3ZSQA 1VSDA 3CFRA 3DLBA 4M3RA 4W5RA 4KB0A 4KREA 4W5QA 1XHZA 2BGGA 3NDKA 1GOAA 5HLFA 2KZZA 4NCAA 1CXUA 4BWJA 3PUFA 4C8NA 4PA1A 4KPYA 4DWIA 4M3UA 4KTQA 4B9LA 1RBRA 4N47A 4KB1A 2VG6A 4EP4A 2D0AA 3C6UA 3LPTA 3ITHA 1UA0A 2F96A 4FJJA 4Z0UA 4FLTA 4FJLA 2ZQBA 3DRSA 4J2EA 1BISA 3T1AA 1N5YA 1YTUA 2D5RA 3LALA 4E7IA 4O4GA 4O0JA 1IH7A 4ZHRA 4FJMA 2YHAA 4FLXA 3UIQA 4FYDA 1QS4A 3M8PA 1BCMA 2G8WA 4F3TA 1UAXA 3ZCMA 1J53A 1WNSA 1U47A 1Q8IA 1X9WA 1SUQA 4AHTA 3OYNA 4F4KA 3HPHA 3LWLA 3U6FA 1DLOA 1S9EA 3VQAA 3OYEA 2E6LA 3P83D 3VQ7A 1BL3A 3QETA 5HRPA 1RBVA 1S1VA 2WOMA 2YHBA 3CQ8A 1LW0A 5HRSA 3MAQA 3DRRA 4CF0A 2HVHA 2IS3A 4W5OA 4B9TA 4W5NA 3LP1A 2LSNA 5CYQA 1S6QA 2QXFA 1HYSA 3PX0A 4FM2A 1D5AA 1WSEA 3QIPA 1N6QA 3IG1A 3TAGA 4B9NA 1L3VA 4CJ3A 3LAMA 3F73A 4B3OA 3I8DA 4CJVA 3LANA 4DTSA 3O4NA 3QEIA 4O55A 1VSEA 2Z1GA 4Z4EA 2G8IA 2P5OA 3KK3A 1ASUA 3V9ZA 4Z4HA 5J2QA 1BIZA 1VSJA 2E6MA 3L2QA 2Z1HA 1QSYA 3L2VA 4FW2A 4I2QA 3OS2A 3QESA 4CIFA 1NK4A 1U48A 2QK9A 3AO3A 1RT3A 2G8FA 1B9DA 4TSXA 4NCGA 2HW3A 4E1NA 1VSKA 4CIEA 4OLBA 1BI4B 1QQCA 1JL2A 4CJFA 3EY1A 4M3XA 3K5MA 3TAEA 1D9DA 4EP5A 1ZBUA 3P5JA 4DTMA 4B8AB 4E19A 4R5PA 4FLYA 3JSMA 3SUPA 1RTJA 3ZSYA 1S5JA 5KGXA 3MXJA 4CEQA 3QEXA 3RTVA 1W0HA 3O4QA 4E3SA 4FK2A 1HQEA 2PY5A 4N76A 3DRPA 3U3YA 3HO1A 2YKNA 1CZBA 1T05A 2HHUA 3ISNC 4CJWA 4DU4A 2G8KA 4KO0A 2XY7A 2XO7A 1FK9A 3TAQA 2OPRA 3F9KA 3NCIA 5I42A 1NK8A 1UOCA 4CCHA 2BDPA 5DK5A 2IOCA 2RN2A 1RTHA 3KKRA 2G8VA 1TAUA 4KHQA 5HRRA 4CFBA 4LSNA 4IFVA 1KFSA 5C25A 3AA5X 4CEBA 2P1JA 2OZSA 3NH1A 4DLGA 3TARA 1JLGA 4DSKA 3TR8A 4FLVA 3QO9A 5FDLA 3ALYA 3CM6A 1KLNA 1S1UA 3OJSA 1BQNA 3AVBA 4CF8A 4PY5A 2HHWA 4CF9A 3T19A 2G8HA 3RMDA 2HNYA 2DTUA 3DLKA 2FC0A 3AVNA 4N5SA 4JS4A 1LWCA 5HROA 4O0IA 1RT6A 4CESA 2P51A 4BE1A 3VQBA 4BE0A 1S1TA 1WAFA 3ZT1A 1T03A 3RWUA 4CHOA 3ZSXA 2OPSA 3S3NA 1G15A 2PYLA 5DMRA 4RW4A 2HHSA 1REVA 4CJ5A 4C8MA 1C0TA 3HYFA 1GOBA 1DTQA 3AVCA 1NOZA 4IBNA 3AVHA 4FZXC 4CGIA 1Z26A 3MXMA 1RDCA 1U49A 3AV9A 3OY9A 3KKSA 4DTNA 2YV0X 2ATQA 2X6NA 4HHTA 1NK0A 3AA2A 3OVNA 4AHCA 3DM2A 3ULDA 2HHXA 2KFNA 3VQDA 3KLGA 1EX4A 4KRFA 4OPJA 1HYZA 1WSFA 3LZIA 1SV5A 4OKKA 2ZD1A 3AVIA 1MU2A 4DG1A 2HMIA 2QKKA 4FJ8A 4DQSA 2O4GA 4JS5A 3LWMA 3KLFA 4J2BA 3K57A 4OKJA 2YKMA 5T7BA 3K58A 3HPOA 2X78A 1T8EA 4EZ6A 1RCHA 5KRSA 4QOZB 4H4MA 4BACA 3TAFA 1S1XA 3KTQA 4FJ5A 4KI6A 4KTWA 4KKOA 5FRNA 1NJYA 3EYZA 3OYGA 3AA3A 4F3OA 1ZYQA 1JLEA 1BIUA 4GVMA 3QLHA 3S3MA 3RR8A 2OPQA 1IKXA 1VK0A 4KHWA 5SZTA 1LWFA 3DLHA 4FJKA 4DF4A 1RT2A 3RMCA 4W5TA 4HUEA 1VSLA 3SQ2A 4FXDA 4HUFA 1ITGA 2KZMA 4BDYA 4BDPA 2JGUA 4OKEA 1J5OA 1RBTA 2JLEA 3NBPA 4HUGA 4FLWA 3P1GA 1Q9YA 1RNHA 3KIOA 1XC9A 3OYLA 1I3AA 4CIGA 3VQEA 1RT4A 2WONA 4E7HA 2W42A 4CJ4A 3L3UA 5JS2A 4N41A 5CZ1A 4DU3A 1RT7A 1YTAA 1A5WA 4H8KA 4FZZA 4AHSA 3OJUA 3D0PA 1EXQA 4DF8A 3NH0A 3VA0A 1D9FA 4CJRA 4CFDA 4DSLA 1JLAA 4E7KA 1EP4A 3VA3A 4E7JA 2IC3A 3QEVA 1SKRA 3H08A 4E7LA 1U4BA 1NK7A 2O4IA 4LH5A 1RILA 2VG5A 4CHNA 3SYZA 5I3UA 3CFOA 3V1OA 4CK1A 4ID1A 3TAPA 1HYVA 1UWBA 1XWLA 2IDOA 3LP2A 3CFPA 1XI1A 3RRGA 3AO2A 2XY8A 1FKOA 1B92A 1C1CA 3ZSWA 3DOKA 4DS5A 1TK5A 1KSPA 3AVJA 1QE1A 5KRTA 4AILC 4FJXA 5SWMA 3SQ1A 3SPYA 3VQ6A 4M3ZA 1L3SA 4Z4CA 3LDSA 3NF9A 4DTOA 3LP0A 1BQMA 3MECA 4I2PA 4NYFA 1LW2A 4DQPA 3AVLA 1IO2A 3E01A 3KK2A 1CZ9A 2OZMA 3L2WA 3VQ9A 1RDDA 3AO5A 4EZ9A 4DSJA 4F2RA 3B6PA 4DS4A 4XIUA 3TWHA 2Q3SA 3NGIA 1EKEA 3MEEA 4AHVA 4CK3A 4Z4GA 4CJUA 5HBMA 3EZ5A 1TK8A 4DU1A 3QNOA 4J2AA 1A5XA 4CJLA 3IAYA 4H4OA 5KGWA 1L3UA 1TK0A 3DLEA 1TL3A 3SZ2A 1J9AA 4K8ZA 3M8QA 4DTRA 5J1EA 3ZT3A 3NGZA 2BE2A 2DFFA 4I7FA 3VQPA 3OYDA 4CJTA 4ELUA 2HVIA 1I39A 3AVKA 4YNQA 3QEPA 4BWMA 1BI4A 1EETA 2PYJA 1NK9A 1R0AA 1WAJA 4IDKA 1T7PA 4CEOA 2KTQA 3ZSVA 4KHSA 3NAEA 4FJ9A 3V9SA 4FJGA 3ZT4A 1DTTA 3LP3A 5CYMA 1IKWA 2IGIA 5HRNA 3LZJA 3I0RA 1TL1A 3QEWA 4FJHA 2QKBA 3ZSZA 1RDBA 1KFDA 3RR7A 3KD5E 3THVA 1W9HA 1TVRA 2FBXA 3S9HA 3NF7A 3HVTA 3VQ8A 3L8BA 3SV4A 4DSFA 4MQ3A 4Y1DA 3HJFA 4GW6A 3U3GA 3KJVA 1HJRA 1QSSA 4CJKA 3V4IA 4HVJA 3ZT0A 1JL1A 1C1AA 2ITGA 4DFKA 3AVMA 4C8LA 4CF2A 3WNGA 1TKXA 1C0MA 4QAGA 4JRQA 4FJIA 1FKPA 1K6YA 3HT3A 1NOYA 4KHUA 1VSHA 4RW8A 3OS0A 3SJJA 1BCOA 1D8YA 1CLQA 1HQUA 4LH4A 3T3FA 2B6AA 2R7YA 1RT5A 5J2NA 1Q9XA 1C0UA 1LWEA 3WNFA 1BGXT 1TKDA 3O3GA 3DMJA 1NK6A 3AVFA 4NYNA 2OPPA 5KI6A 3K5LA 4DTUA 2G8UA 1JLQA 2X6SA 4CJQA 1YT3A 3KK1A 1RTIA 4KHYA 4C8KA 3AVAA 2YNGA 1KCFA 3C94A 4CHZA 4DMNA 1KVBA 3BDPA 5KTQA 3S3OA 4E89A 4KAZA 4F2SA 3L2RA 4KTZA 4OGEA 3PX4A 3SUQA 3NHGA 4FK0A 3DYAA 1BHLA 1HPZA 1UA1A 4M3WA 3V81A 4KI4A 1L3TA 1Y97A 4CJPA 1WSIA 2OA8A 2ETJA 3I0SA 4RW6A 2NUBA 2GUIA 4DQQA 3SQ4A 4RG8A 3CYMA 4C8OA 4B9MA 3MEGA 4CFCA 4FCYA 4CERA 2P5GA 3VN5A 5CY4A 1F21A 4M41A 4DFPA 1RBSA 1NJZA 4M3YA 2F8SA 2D0CA 3HXMA 3V1RA 3BGRA 4HCBA 1J54A 4KFBA 1NJWA 1FXXA 4AHRA 3SPZA 2DFHA 4FJNA 4RW7A 4DSIA 5CZ2A 4IKFA 3ZSOA 1KRPA 4LSLA 1WSGA 1IG9A 4Y1CA 3VQ4A 3TI0A 1HNVA 4CGGA 4ELVA 1RT1A 3K5NA 2YNIA 4DFJA 1NKBA 2OYQA 1NJXA 3ZSRA 3HK2A 4CEZA 3PO4A 2DFEA 2A1SA 1JXBA 1RTDA 4I9LA 1LAWA 2IAJA 3A2FA 2YNHA 3AA4A 3AVGA 4M42A 1HMVA 1TKTA 4CEFA 3MXIA 2HHVA 3PX6A 2D0BA 4M45A 3OYAA 3V9UA 3TABA 4B9UA 3HPGA 1ZBLA 4FLUA 3NF6A 4Z4FA 2Y1IA 1XHXA 1U04A 3M8RA 2Y1JA 2KW4A 3TANA 5C42A 2FBVA 3MEDA 4GMJB 2KQ2A 3V1QA 3IS9A 3O3HA 4DTXA 4ZTJA 2PZSA 4Z4IA 2DY4A 1JLFA 3G10A 3HP9A 3HVRA 3SCXA 3K5OA 4IG0A 4CGDA 5JS1A 4BDZA 1C6VA 4FK4A 1TGOA 4CHPA 3OYJA 1SL1A 2E4LA 1VSIA 3AO4A 4CJEA 1LAVA 1O1WA 5J2PA 3KLEA 3SUNA 4PQUA 1HNIA 1QHTA 2EHGA 4CGHA 5E41A 4WE1A 4YFUA 4L8RB 3SQ0A 4DFMA 2Z1IA 3HP6A 3JYTA 3QIOA 3DLRA 4FZYA 1TAQA 4CJSA 3M8SA 2Z1JA 3OYKA 3PV8A 3RMAA 2HHQA 4CFAA 3K59A 3HM9A 1L5UA 1JLBA 1KLMA 5C24A 2FBTA 3VQQA 4JRPA 4B9VA 1S6PA 4CGJA 1SKSA 1IKYA 1WSJA 4MFBA 1JLCA 4AHUA 1VRTA 1SKWA 4E1MA 3SNNA 1S1WA 1WSHA 3WNEA 3V9WA 1WN7A 4DQIA 4DTPA 5K14A 3CG7A
chains in the Genus database with same CATH superfamily
3VTHA 1U2VA 4B9SA 2D0PA 3G71N 4O44A 3V9XA 1H1VA 2HNDA 2YNFA 3BUZB 2YHWA 2XRIA 4AH9A 4BR0A 4CZIA 3FZKA 3KD1E 3CJ7A 3CM5A 4CECA 1NK5A 3CJ1A 4KHNA 2O8CA 1TKZA 2KFZA 3QBWA 4O5BA 4DTJA 3PY8A 2X74A 4JI2K 4BVOA 3LAKA 4FWPA 2E88A 4NCBA 3O9SA 2HNZA 4B08A 3OYFA 2JWKA 1QQMA 1YVUA 4F8RA 3ZT2A 1CXQA 2V52B 2I5JA 3PSIA 4OPKA 2VWKA 3AO1A 2BH1A 4OJRA 3SV3A 3RMBA 4A2AA 4DR6K 4LD0A 3THWA 2NLXA 2GWJA 4CHQA 2FSNA 2IVPA 1VSMA 5FRMA 1GLEG 2HHTA 2B4JA 1VQLN 3L2UA 2GBZA 2HB5A 5BR9A 2VWJA 1VSFA 4ID5A 3O9TA 1RBUA 5BRHA 4JKCA 1NGEA 3OYIA 3OYCA 1IKVA 3DI6A 2P9IB 1JKHA 3DLBA 4KREA 4W5QA 3ZETB 4NCAA 1CXUA 4BWJA 3PUFA 4CJ7A 3K9KA 1RBRA 4N47A 1VQNN 2VG6A 4EP4A 3LPTA 4PKGA 1UA0A 1KAYA 5AQOA 1VQ4N 1YJWN 1WOQA 2YCHA 4J2EA 3T1AA 1N5YA 4E7IA 2UUAK 4O0JA 2P9SA 4Z94A 3ZX2A 2YHAA 2NNWA 3CIPA 4FYDA 5JICA 4WCEL 3FZFA 3U6FA 2NRXA 3MK6A 3P83D 1BL3A 1RBVA 1S1VA 1NLVA 4ISGA 1T44A 2WOMA 1LW0A 1SAZA 5HRSA 2HVHA 4FL9A 4W5OA 3THYB 4IOXA 1S6QA 1JCEA 1HYSA 3T7ZA 4FWLA 3PX0A 2O8CB 1WSEA 4B9NA 3I8DA 4JKGB 4Y0WA 4CJVA 4DTSA 1N34K 4Z4EA 2Z1GA 2P5OA 3DWLA 4AQYK 3V9ZA 4Z4HA 5J2QA 1BIZA 1E4FT 2IVOA 4FW2A 2NRVA 1U48A 3L6QA 2WFBA 4DV3K 1DKGD 1NGBA 4TSXA 1VSKA 1ZBSA 3FR0A 2Q2RA 1QQCA 4CJFA 3EY1A 3K5MA 3TAEA 1VQON 1D9DA 3EO3A 4B8AB 3JSMA 1S5JA 5JVHL 1OH7A 3QEXA 4OPAA 1W0HA 3O4QA 4E3SA 4FK2A 1HQEA 3HO1A 3DRPA 4H0TB 1CZBA 3ISNC 3TAQA 3CQXA 2BDPA 2RN2A 1RTHA 1XNRK 2G8VA 2UXCK 2P9IA 5HRRA 4LSNA 1NJIO 2P1JA 5ADXA 5LJVA 4WQ4C 4JV5K 3TARA 4PKIA 5FPMA 4DSKA 5AJ3K 3K0SA 2QWRA 1SQKA 3CM6A 3THYA 1S1UA 3RMDA 4BRDA 3AVNA 3CJ9A 1LWCA 4XH4A 4CBWA 4BE1A 4LF7K 1S1TA 3O80A 3AAPA 3HTVA 4BR4A 5DMRA 5AZJB 4BRAA 3HYFA 1GOBA 1DTQA 4M63C 4FZXC 4CGIA 4DR5K 1RDCA 3AV9A 2ATQA 2X6NA 1HX1A 4HHTA 1NK0A 1XNQK 4AHCA 2HHXA 1EX4A 4JI0K 1DGKN 1SV5A 5A2QO 4M7YA 2HMIA 3K57A 4OKJA 1R59O 2V7YA 1T8EA 4EZ6A 4JKGA 3CHWA 2NRRA 2ZJPL 5CR4A 3OBYA 4KI6A 2YI1A 5FRNA 1NJYA 3EYZA 4F3OA 1JLEA 4GVMA 1HLUA 3MDQA 3RR8A 3FZMA 3DLHA 4FJKA 1RT2A 1QZ5A 1N36K 2FXUA 2KZMA 2P9KB 4BDPA 3GG4A 5C15A 1J5OA 3VQEA 3OW2M 3AGRA 3E66A 4CJ4A 3L3UA 4DU3A 4H8KA 4AHSA 4DF8A 2KLAA 3VA0A 4AM6A 5AZJA 4H0YB 5AQGA 1SKRA 1YF5L 3V1OA 3TAPA 1HYVA 1XWLA 1P8ZA 3O4WA 1FKOA 1B92A 4LF5K 4DS5A 4IO9L 5M1KA 1NBWA 4U7BA 4F9OA 3SQ1A 5AR0A 1T6CA 4Z4CA 3NF9A 2QWMA 1BQMA 3MECA 3CCUN 1CZ9A 3KWGA 5AQRA 5GIOA 4BC2A 4XIUA 2Q3SA 3MEEA 4K42A 4CJUA 1TK8A 4DU1A 3QNOA 5AQSA 3AAQA 4H4OA 5FLXO 2A6AA 3KK7A 3ZT3A 3NGZA 2BE2A 4ELUA 3QDKA 5EXWA 2PYJA 1NK9A 3ZSVA 3NAEA 3EKSA 1DTTA 3CCQN 3QEWA 2QTDA 4EFHA 5BPNA 3VQ8A 3SV4A 3VOVA 1ATSA 2HF3A 1QSSA 1HJRA 4FJGA 3ZT0A 4C8LA 1C1AA 2ITGA 3AVMA 1C0MA 5DM6L 4JRQA 3HT3A 4KHUA 1VSHA 5E84A 3OS0A 3SJJA 1D8YA 3IFRA 2Q1NA 4HTLA 5J2NA 1Q9XA 1C0UA 3WNFA 2AA4A 2O8EA 1QVGM 3R8EA 3MX2A 5F1XA 4MO5A 3Q7CA 4CZKA 4O5FA 4EHUA 1RTIA 4KHYA 1E3MA 3AVAA 1W97L 4IO8A 4R79A 3D2FA 1KVBA 5KTQA 3S3OA 3SMPA 3CC2N 4E89A 3CI5A 3CC4N 4KTZA 3D6RA 3SUQA 4HWIA 3NHGA 3VEXA 3A8YA 5BN9A 4M3WA 3V81A 4KI4A 1L3TA 5AZIA 3FGUA 3M1FA 5BREA 3CCEN 3I0SA 4RW6A 1OH8A 3O9RA 1HNZK 2GUIA 1ATRA 4DQQA 3CYMA 4B9MA 4DR7K 1RBSA 4M3YA 1ZXOA 3BGRA 4HCBA 1NJWA 2DFHA 2AP1A 4JEPA 4DSIA 4IKFA 3ZSOA 3O8MA 3SK3A 3VQ4A 3TI0A 1HNVA 3ULEB 1RT1A 4GVEA 3JAMO 1JJ2M 4CEZA 3PO4A 2DFEA 3DXMA 1LAWA 1GLBG 2P9UA 3AA4A 3WXLA 5LY3A 4LC9B 1IBMK 3V9UA 3HPGA 2UXBK 2KHOA 2OTJN 3TANA 3PIPL 4JI6K 3CCVN 2KQ2A 4ZTJA 4DTXA 4Z4IA 5JLFA 3HVRA 5FPNA 3K5OA 4IG0A 1MDUB 3THXA 1C6VA 4H0XB 1SL1A 3AO4A 4CJEA 4PQUA 1C0FA 4PKHA 5E41A 4WE1A 4BR7A 3EZWA 4L8RB 3SQ0A 4DFMA 2Z1IA 3H1VX 3AARA 1OKJA 1SZ2A 1BG3A 3HM9A 2CGKA 1GLCG 1VQ8N 3O5BA 5EVZA 3R9PA 1SKSA 3HRGA 3OBWA 3L4IA 1WSHA 5K14A 3CG7A 5KPTA 3T1HK 3O1WA 3P38A 3G0ZA 4CF1A 1X9MA 4O8UA 1JCGA 4E0DA 4K8XA 4OLAA 1A5VA 2EX3A 3ENBA 4DV0K 4WFBL 1HJOA 3KLIA 4QCLA 3B6OA 3RRHA 3MCPA 1RDAA 1U45A 3C6TA 5AZIB 4DV1K 2XY5A 1QTMA 4CGFA 4IFYA 4LF4K 4MLHA 1K73O 5FROA 4K43A 4Q5VA 4H5TA 3HBTA 1U6ZA 2J4RA 4FM1A 2BANA 3ENHA 3ASMA 3TU5A 2QA4N 3NGYA 2XY6A 4FWNA 1ASVA 4FVMA 3DLGA 1Z6RA 3TAMA 4HTUA 1ZBHA 3T69A 3HL8A 1NG9A 3MN9A 1KVAA 4FM0A 3OYHA 5GIPA 3QERA 4M7XA 3PO5A 1K9MO 3O9QA 3SLCA 5TKYA 3WNHA 2P9UB 3K2PA 4J2DA 1ASWA 3VQ5A 4CE9A 1GOCA 4ICLA 1TV6A 1EO1A 4DLEA 4I9QA 1NGIA 4OGCA 3CFRA 5BR8K 3EE8A 4KB0A 1XHZA 3NDKA 5HLFA 5M1FA 4PL8A 3ZETA 5AQPA 3VEVA 1YAGA 2VGMA 3WQTA 4KTQA 3A0IX 5EX5A 2F96A 3IKMA 4YOVA 5IWAK 4K0KK 3EN9A 2ZQBA 2O8FB 3DRSA 4BRHA 1XQSC 1YTUA 2D5RA 5EY4A 2ASMA 2P9SB 5M1QA 4FLXA 2G8WA 4JKEA 1UAXA 2ZGZA 5LJWA 1U47A 1X9WA 5GADP 3LWLA 3QETA 2YHBA 1IG8A 3DRRA 5TKWA 4CF0A 2IS3A 3SAFA 4W5NA 4A5AA 5AQTA 2GX9A 3MWPA 4CZEA 4FM2A 4BC5A 1D5AA 1OVQA 2P9PA 4CJ3A 3LAMA 3AY9A 3BF3A 3LANA 4BRPA 4YHHK 4CZHA 3QEIA 2HHHK 4ILGB 2E6MA 3L2QA 4I2QA 1NMDA 3OS2A 4CIFA 2QK9A 5AQHA 2G8FA 1B9DA 1KC8O 4OLBA 4BR5A 3UKUB 3ZEUA 1Z05A 4DHYA 4DTMA 4R5PA 1RTJA 2RHKA 4NO7A 2PY5A 4N76A 3U3YA 4JKAA 1T05A 4DU4A 3U9DA 1NGDA 1ESVA 3NCIA 1BWFO 4H5WA 1TAUA 4BR9A 3HM8A 5F2RA 1KFSA 5C25A 2A41A 3AA5X 1YITN 3A5OC 3CD6N 3NH1A 4DLGA 1BQNA 4CZMA 4CF9A 2E2PA 5KPRA 4N5SA 4JS4A 4O0IA 4CESA 1ILYA 4DR3K 3VQBA 3ZT1A 1T03A 4JKDA 5F0XA 2OPSA 3S3NA 4WFNL 4ISEA 4FWSA 2HHSA 1REVA 3IDHA 4CJ5A 1C0TA 1Z26A 1NGCA 3MXMA 3OY9A 4K41A 3AA2A 3D7EO 3OVNA 3THWB 2KFNA 2QWOA 3P4IA 3VQDA 4KRFA 2YHXA 1WSFA 4BGBA 1MU2A 2D0OA 4BC4A 5HL7L 2QW9A 2O4GA 3CCMN 3QFPA 4JS5A 3VGKA 5T7BA 2YJFA 3K58A 2PAVA 5KRSA 4H4MA 4BACA 1HPMA 3KWIA 3KTQA 4KTWA 3FZHA 4A61A 3BZKA 3M3ZA 3S3MA 3QLHA 1NWKA 4DF4A 3KVGA 3E1YA 2W40A 4W5TA 1VSLA 3SQ2A 4BRKA 2VGNA 2JGUA 4OKEA 3NBPA 5AQFA 4HUGA 1RNHA 3OA9A 1XC9A 3OYLA 1I3AA 1BO5O 1RT4A 1QHAA 3J80O 3TTDA 1QQNA 4LFCK 4JD2B 3Q7BA 1M90O 3QEVA 3H08A 1DEJA 1U4BA 1Q81O 4EAHD 4YOTA 4RTFD 4X64K 3LP2A 4WQ5A 1C1CA 4BREA 3ZSWA 3WQUA 1TK5A 4B1ZA 5KRTA 4FJXA 4M3ZA 4YDUC 3LDSA 3LP0A 4NYFA 3CCLN 2FSKA 4DQPA 1IO2A 4EZ9A 3AO5A 4B1WB 3M5RA 3B6PA 4DS4A 3OHRA 1EKEA 4OO1J 3EZ5A 5AQVA 4J2AA 3IAYA 4YY3K 5C12A 1TL3A 3SZ2A 3CXCM 4K8ZA 3M8QA 5J1EA 1CZAN 1YXQA 3G4SN 2HVIA 1MA9B 3AVKA 4YNQA 3VEOA 3U4LA 3NMUA 1R0AA 3WXIA 3ZT4A 2I7PA 3IMXA 1IKWA 5H1SQ 5DM7L 1KFDA 3KD5E 2FBXA 4DSFA 2GTDA 4Y1DA 3GDQA 3IUCA 2QKKA 4FVUA 1VQ9N 4QAGA 1WB9A 1FKPA 1K6YA 1NOYA 3VPZA 4OX9K 4H0OA 4IEEA 4RW8A 5AQUA 3J7ZO 3VERA 3WXMB 2R7YA 3WEEA 1LWEA 2BUPA 5E26A 3K5LA 4I6MB 4GKKK 1JLQA 4CJQA 5IT9O 1YT3A 3KK1A 3C7NA 4C8KA 2V7ZA 1KCFA 2HMPA 3C94A 4DMNA 3BDPA 5ELZA 1XUPO 1LCUA 4KAZA 3KZBA 3QBXA 4OGEA 3ZX3A 3PX4A 4DCHA 1WSIA 2HF4A 2ETJA 5AQIA 3P31A 2NUBA 3W0LA 3TSUA 4C8OA 4WF9L 3MEGA 2P5GA 3F9MA 4C1NI 1F21A 3E9LA 3ENOA 4H03B 3HXMA 1J54A 4KFBA 1FXXA 1LOTB 4AHRA 3SPZA 4FJNA 4RWTA 2IVNA 4DV4K 3G6EN 3ATVA 5M1OA 2E2NA 2FSJA 4DFJA 1NKBA 2A5XA 1RTDA 4I9LA 1TKTA 2HOEA 4CEFA 3MXIA 1W2BM 1NMNA 5BPLA 1ZBLA 3NF6A 4IXCA 1XHXA 4FWRA 1VQMN 2PZSA 1M1KO 2HBLA 2E4LA 1VSIA 3SUNA 3KLEA 2O8BA 2EHGA 3BY5A 4CBXA 2JWLA 3UE5A 1J6ZA 3M8SA 4CFAA 3LM2A 3K59A 1JLBA 5C24A 2FBTA 4FSVA 1S6PA 2W6LA 4CGJA 1WSJA 4WQ4A 4OPHA 4MFBA 4AHUA 4BRGA 3V9WA 1HKGA 4FOIA 4WQ5C 1E4GT 4CEAA 4FW1A 3CF5L 4CEEA 4Q0BA 5GAGP 4XH1A 3CPEA 1WLJA 3NE6A 3DXKA 4FLZA 1NKEA 4PHTX 4KV8A 3OYBA 1NKCA 3QINA 2QI2A 4ELTA 4LY7A 2P9LA 4HCCA 3OYMA 1BA0A 1VQ5N 4PWDA 4ZTFA 3FFIA 4CVNE 1ZBFA 3MMVA 1VRUA 2GWKA 2XHBA 5LMNK 5AFUA 1SL2A 3VQCA 1JXEA 1NGAA 3SUOA 2GEMA 4DB3A 5CHIA 1X9SA 4CHYA 2A1RA 3GL1A 4FJ7A 4DQRA 1B9FA 3OTOK 4QS8A 2PBDA 1LV5A 1X1PA 2EWSA 4WFAL 2WC9A 3V6DA 4PUOA 2NRZA 4B8CA 1SL0A 5J2MA 3O3FA 3C65A 2ZF5O 3LPUA 3E9OA 3C95A 1S9GA 2RF2A 3MWTA 2CH5A 2RE2A 2VG7A 2RPIA 1I94K 4N56A 3IRXA 3ZSQA 2O8EB 1VSDA 4KH4A 4W5RA 2BGGA 4IZ9A 2PFUA 4BQLA 1GOAA 5JVGL 3H6EA 4JYAK 3BEXA 4DWIA 2UYTA 2O8BB 4B9LA 4KB1A 5AQMA 3UKRA 1J5EK 4Z0UA 3E9PA 5C0YA 4QS7A 3I56N 2UUCK 1BISA 2D4WA 3LALA 2IIRA 3LDPA 1YUWA 1IH7A 3EE9A 3UIQA 1QS4A 1BCMA 4F3TA 2QM1A 1WNSA 1OVYA 4AHTA 4XH5A 3OYNA 3HPHA 1DLOA 3OYEA 2E6LA 3VQ7A 5HRPA 3U8XA 3R1XA 1S3XA 1RDWX 1QQOA 2LSNA 3S41A 5AQXA 2QXFA 3QICA 1YIJN 3QIPA 1N6QA 1VQKN 4FO0A 3F73A 3DXMB 3G25A 1YHQN 4JHDA 2G8IA 3KK3A 4CD1A 3ZLJA 1VSJA 1QSYA 5KQDA 3ZX0A 4DUYK 3AO3A 1RT3A 1G99A 4NCGA 3N4QA 1BI4B 4CBUA 4BRMA 1ZBUA 4B3TK 5AQWA 4FLYA 1GLAG 3ZSYA 3PSFA 1IBLK 1T3VA 3H3OB 5C10A 2HHUA 2YKNA 1C0GA 4DV5K 4KO0A 3VF6A 2XO7A 2XY7A 1FK9A 4ELVA 2OPRA 3EKUA 3F9KA 4B1UB 2UU9K 1UOCA 4AM7A 3KKRA 2ZJQL 4CFBA 4KHQA 3I55N 4DUZK 4CEBA 4ISFA 4NLBA 4E1JA 1NGGA 2OZSA 1JLGA 1K8KB 3RSEA 3SBGA 4FLVA 1X9JA 4XEIA 3ALYA 4CF8A 3AVBA 3J7YP 1KD1O 1TUUA 4BRNA 4PY5A 2DTUA 3DLKA 2FC0A 2A42A 4CZFA 1RT6A 3H46O 2P51A 4DV7K 1IJJA 1VAZA 4FWKA 4U67L 5MLCQ 1WAFA 3RWUA 4CHOA 3ZSXA 2PYLA 3VF2A 1NNEA 1SS6A 4C8MA 2F9WA 1NOZA 3AVHA 1TYQA 4GV3A 3BP8A 2W6KA 4CW7B 4JK9A 3VTIA 3ULDA 2F9TA 3ATUA 2FF3B 4OPJA 3LZIA 3VGMA 1HUXA 1JCFA 4FJ8A 3VENA 4GKJK 3R6MA 4RCHA 4JHDB 5BRDA 3OYGA 2OPQA 1IKXA 5SZTA 4HUEA 2H3GX 5AQQA 1ITGA 1WUAA 4FLWA 4KBOA 1IV0A 3KIOA 3H3NO 1NGJA 4IOAL 2WONA 1GLJO 4E7HA 4N41A 5JS2A 1YTAA 4FZZA 2O8FA 3OJUA 2YJEA 3D0PA 3T1YK 4MLEA 3ID6A 1XMQK 4JD2A 4CFDA 4DSLA 1EQYA 5AQKA 1JLAA 3UB5A 1EP4A 4NB4A 4BRLA 4E7KA 2IC3A 4CHNA 1RILA 5I3UA 3SBTA 4CK1A 4CD3A 4ID1A 4A57A 3QFUA 3RRGA 2XY8A 3VESA 2QWNA 3DOKA 2NRWA 3I33A 3K9JA 1KSPA 3KHYA 4IDHA 4BRFA 5SWMA 3N4PA 4DTOA 4I2PA 1LW2A 3AVLA 3E01A 2OZMA 3CETA 5FPDA 4LF9K 4AHVA 3QB0A 4CJLA 1KQSM 4B3RK 4A59A 4EHTA 5KGWA 1L3UA 1KAXA 3P39A 4DTRA 1BUPA 2W41A 4I7FA 2DFFA 3CPWM 4JI5K 3OYDA 2YHYA 1I39A 2VQEK 3H1QA 4BWMA 1WAJA 2KKZA 4A62A 4CEOA 3ZEUB 4FJ9A 3V9SA 1NGHA 3LP3A 2IGIA 5HRNA 1QVFM 3CJBA 4FJHA 1RGIA 1RDBA 3ZSZA 3RR7A 3THVA 1W9HA 1TVRA 4NLCA 2FF6A 3NF7A 3HJFA 2E20A 3U3GA 3CERA 1NGFA 2HSTA 4DR4K 1GLDG 2P9NB 2HBKA 3WNGA 1TKXA 1HNXK 3O08A 1BCOA 4H5NA 3T3FA 2B6AA 1RT5A 3O1BA 2CGJA 5C2FA 1BGXT 4IEIA 1TKDA 3DMJA 1NK6A 3AVFA 5KI6A 2A40A 3VEWA 4I6MA 2E2OA 3MN6A 1XC3A 3C7NB 5AQNA 1RDUA 1OH6A 4F2SA 2O8DB 1V4TA 2VYPA 4FK0A 4B1VA 2ZJRL 1UA1A 3HZ6A 1S72N 1Y97A 2OA8A 4FWQA 1YJNN 2DPNA 3LDOA 4JK8A 5BRFA 3BF1A 1HKCA 4CFCA 4DR2K 3VN5A 4JKHA 4DFPA 4M41A 2F8SA 3V1RA 4DV6K 4RW7A 2E8AA 2WBNA 1KRPA 1IG9A 2QWLA 4FWOA 1HR0K 4Y1CA 3SMSA 4CGGA 3K5NA 2Q0UA 1NJXA 3ZYYX 2IAJA 4JI4K 3A2FA 2YNHA 1HMVA 4DKWA 2D0BA 4M45A 3OYAA 4B9UA 5HOOA 4Z4FA 2Y1IA 3M8RA 1ATNA 2FBVA 3V1QA 3MEDA 1NU0A 4GMJB 3IS9A 4NXMK 4LF6K 1KAZA 4V19S 2DY4A 1JLFA 3HP9A 3JXUA 5JS1A 4BDZA 4FK4A 4CHPA 3OYJA 3O6WA 1O1WA 4BC3A 2ASOA 1HNIA 1QHTA 4UY8O 4YFUA 3HP6A 2VCPA 3JYTA 3DLRA 4FZYA 3OYKA 3SAHA 3RMAA 3CC7N 2HHQA 1Y64A 1FW6A 3L0QA 3MN7A 1L5UA 3VQQA 4C23A 4B9VA 1SKWA 1JLCA 4B3MK 2CH6A 4DQIA 1WN7A 4JK7A 4DTPA 4GY2B 1HKBA 4IWVA 4JAXA 3DLLL 1U2VB 4YORA 4KH6A 4CI6A 2A3ZA 3NFAA 3TPQA 4UQGA 5D3GA 3DXKB 3NF8A 4G9ZA 4X62K 2I7NA 2WTUA 3WXJA 3GBTA 2O8DA 1Z25A 3DOLA 4BRIA 4CEDA 4RW9A 4JLHA 2GV9A 4BRCA 4B1XB 2P9LB 2RKIA 5AFUH 3I8BA 3D45A 5EU7A 3L4QA 2FBYA 3KLHA 2ITMA 3FLCO 2ZM6K 3VETA 5GINA 4BE2A 3M6GA 3A5MC 4GV9A 2F7TA 1KVCA 2ZE2A 4IG3A 1ZBIA 4X65K 4M3TA 3O9UA 4CZGA 2AJQA 3FFKB 3SI6A 4B9QA 3QNNA 4BROA 5BN8A 3HSTB 1HRHA 1C1BA 1DT9A 3OS1A 3WXKA 5HP1A 4YOYA 3D2EB 4G1QA 4H5RA 4CK2A 1QSLA 2F8TA 1WBDA 3L3VA 1KTQA 3CCSN 3NH2A 3ID8A 3WEEB 2NZTA 4DSEA 4OVLA 1EWQA 2B5JA 4CZJA 4MDAA 4M3RA 2KZZA 4H0PA 1VQPN 1S22A 4C8NA 2NRTA 4PA1A 2P9KA 4KPYA 5JLHA 3CMAN 4M3UA 2D0AA 3C6UA 3ITHA 1FJGK 4FJJA 4FLTA 4FJLA 4FPBA 4MO4A 2NRHA 1Q7YO 3J8AA 4O4GA 3B8AX 2OCEA 4ZHRA 4FJMA 4IJNA 1GLFO 3M8PA 5AQLA 1TUYA 3ZCMA 4JI8K 1N8RO 1J53A 3CCJN 1Q8IA 3W3DA 3WUHA 1SUQA 4F4KA 1S9EA 3C6AA 3VQAA 5I9EB 5ADXH 3VGLA 3HOTA 3CQ8A 3MAQA 4B9TA 3LP1A 5CYQA 5AQYA 4EIAA 3IG1A 3TAGA 1OH5A 1L3VA 4L3QA 2Q0RA 2GELA 4B3OA 3CQYA 3DAWA 4LFBK 3O4NA 3QMLA 4DR1K 4O55A 1VSEA 1ASUA 4C1NK 1VHXA 2Z1HA 3TSPA 3L2VA 3QESA 1NK4A 3C6HA 3C0BA 2HW3A 4E1NA 2Q97A 4JI1K 4CIEA 1JL2A 4H0VB 4M3XA 2E1YA 4EP5A 3P5JA 2ZWHA 4E19A 4AF1A 3SUPA 5KGXA 4CEQA 3MXJA 4QS9A 3D2EA 3RTVA 5EOYA 1P90A 3BZCA 4CJWA 2G8KA 1O13A 1NK8A 3VEZA 5I42A 1YJ9N 4CCHA 5DK5A 2IOCA 1W7AA 1XMOK 1X3NA 1BU6O 4IFVA 3TSQA 2BTFA 5KQ8A 4LF8K 1Q18A 4CZLA 3AGKA 3FE1A 1K8KA 3RSEB 3TR8A 4O8KA 3QO9A 5FDLA 4B3SK 1KLNA 3OJSA 3VMFB 2HHWA 3T19A 2G8HA 2HNYA 3A5LC 5HROA 1QZ6A 4PL7A 3PLAA 4BE0A 1G15A 3GOIA 4RW4A 1VQ7N 4ILJA 3HSCA 3AVCA 4IBNA 1Q82O 5LL6Z 4BG8A 1U49A 3KKSA 4DTNA 2E1ZA 2HBJA 2YV0X 5C2DA 1IBKK 3DM2A 3LDLA 4A2BA 3KLGA 1HYZA 4OKKA 2ZD1A 3AVIA 4DG1A 4DQSA 1NM1A 4JN4A 3LWMA 3SAGA 3KLFA 4J2BA 2ZGYA 5GAEP 4BRQA 2YKMA 1EWRA 3F5TA 4KH5A 3HPOA 2X78A 1RCHA 1HNWK 4GV6A 3LM9A 4QOZB 3TAFA 1S1XA 4FJ5A 1T6DA 1N33K 3HI0A 4KKOA 2ASPA 3AA3A 4NXNK 1ZYQA 1BIUA 4LFAK 4JNEA 1VK0A 4IFEA 4KHWA 1D4XA 1LWFA 3RMCA 4FXDA 3F2KA 4HUFA 4BDYA 3DJCA 2Q31A 1RBTA 2JLEA 1MWMA 3P1GA 3VEYA 1Q9YA 4CIGA 3UKRB 2VQFK 3FZLA 2W42A 1YI2N 5CZ1A 1RT7A 1A5WA 5M1PA 1EXQA 1D9FA 4YOXA 3NH0A 2GUPA 4CJRA 4FWMA 4JI3K 5JMVA 4JI7K 3VA3A 4E7JA 4E7LA 1NK7A 2O4IA 5M1NA 4LH5A 2VG5A 3SYZA 3CFOA 4JKBA 1MWKA 4B1YB 2IDOA 1UWBA 3CFPA 1XI1A 1K8AO 3AO2A 2QWPA 4IJAA 3AVJA 1QE1A 4AILC 2QEXN 3SPYA 3VQ6A 1L3SA 3GE1A 3KK2A 1X3MA 3L2WA 3VQ9A 1RDDA 2UXDK 4DSJA 4F2RA 4BGAA 1ZC6A 3TWHA 3NGIA 4BQZA 4CK3A 4Z4GA 5HBMA 4BG9A 3CMEN 3EEQA 1A5XA 3RVCA 2WUSA 1TK0A 3DLEA 1J9AA 1VQ6N 4FOEA 3VQPA 4CJTA 1Q86O 3QEPA 1BI4A 1EETA 3NVKA 4IDKA 1T7PA 2KTQA 3WT0A 4KHSA 1YVNA 2E2QA 5CYMA 3CCRN 3LZJA 3I0RA 1TL1A 4JKFA 2QKBA 3U9ZA 3S9HA 3HVTA 3L8BA 4WYBA 4MQ3A 4GW6A 3A5NC 3KJVA 4CJKA 3V4IA 4HVJA 1JL1A 4DFKA 1WBBA 2P9NA 3R3LA 4CF2A 5KPZA 4FJIA 2QXLA 3NVMA 4H5VA 1CLQA 4J8FA 1HQUA 4LH4A 2V51B 3EL2A 3O3GA 2YX6A 4NYNA 2OPPA 4X66K 4DTUA 2G8UA 2X6SA 3HOSA 4ILHA 2OTLN 3D2FB 2YNGA 3LDQA 4K25A 4CHZA 4BY9C 3LL3A 1BA1A 2FLOA 4IOCL 3H45C 3L2RA 3DYAA 1BHLA 1HPZA 4CJPA 1TYQB 3MCAB 1GLLO 1BDGA 5B8HA 4MDBA 3SQ4A 4RG8A 4FCYA 4YDUA 4GNIA 4CERA 4BR2A 5CY4A 3LDNA 1NJZA 2D0CA 1N32K 5BPMA 5CZ2A 4BVPA 4LSLA 1WSGA 3J81O 3ULEA 2YNIA 2OYQA 3VF4A 2P9PB 3ZSRA 3CJAA 3MX5A 3HK2A 1BOTO 2A1SA 1JXBA 2HBMA 2VWBA 3AVGA 5FPEA 4M42A 4DQ8A 2HHVA 2D1KA 3PX6A 3CJCA 3TABA 4FLUA 2OANA 1U04A 2Y1JA 2KW4A 3JS6A 1V4SA 5C42A 4FPAA 2E5LK 3O3HA 3G10A 4DV2K 3SCXA 4CGDA 3THXB 4A5BA 1TGOA 3TTCA 3MN5A 1LAVA 2Q36A 2QWQA 5J2PA 3UKUA 4CGHA 5CE3A 3SJHA 4KHPK 2CGLA 3J7AP 2F4VK 3QIOA 5GAHP 1TAQA 4CJSA 2Z1JA 3PV8A 1KXPA 1KLMA 1RFQA 5AQJA 4JRPA 2UUBK 3PIOL 1IKYA 1VRTA 4E1MA 3SNNA 1S1WA 4YOUA 5LMUK 4YOWA 3WNEA 3TTFA 5AQZA
chains in the Genus database with same CATH topology
4CEAA 4FW1A 4CEEA 4B9SA 4Q0BA 4O44A 3G0ZA 4CF1A 2HNDA 2YNFA 3V9XA 3NFAA 1WLJA 4UQGA 2XRIA 3NE6A 1X9MA 4AH9A 4FLZA 4E0DA 4K8XA 5D3GA 4OLAA 3NF8A 1A5VA 2EX3A 3KD1E 1Z25A 3DOLA 1NKEA 3CM5A 4CEDA 4KV8A 4CECA 3OYBA 4RW9A 1NK5A 3KLIA 3QINA 4JLHA 3B6OA 1NKCA 3RRHA 4QCLA 4KHNA 4ELTA 2GV9A 1RDAA 1TKZA 4LY7A 2KFZA 1U45A 3C6TA 4HCCA 3OYMA 4O5BA 4DTJA 3PY8A 2X74A 4PWDA 4ZTFA 2RKIA 3FFIA 3LAKA 2XY5A 1QTMA 1ZBFA 4IFYA 4CGFA 1VRUA 3D45A 2XHBA 5EU7A 4NCBA 2HNZA 2FBYA 4B08A 3KLHA 3OYFA 1SL2A 3VQCA 1JXEA 1YVUA 5FROA 3SUOA 4F8RA 4Q5VA 3ZT2A 1CXQA 4BE2A 1X9SA 2I5JA 4OPKA 2BANA 2VWKA 3AO1A 3ASMA 4OJRA 4FM1A 3NGYA 4CHYA 3SV3A 2XY6A 3RMBA 1KVCA 2ZE2A 4IG3A 4LD0A 2A1RA 1ASVA 4FJ7A 4FVMA 4M3TA 4DQRA 1ZBIA 2AJQA 1B9FA 3DLGA 3SI6A 3QNNA 3TAMA 4HTUA 4CHQA 1ZBHA 3HL8A 3HSTB 1HRHA 1C1BA 1X1PA 1LV5A 1VSMA 3OS1A 1KVAA 4FM0A 3V6DA 5FRMA 2HHTA 5HP1A 3OYHA 2B4JA 3QERA 4PUOA 3L2UA 3PO5A 4B8CA 2GBZA 2HB5A 4G1QA 3WNHA 3K2PA 1SL0A 5J2MA 3O3FA 4J2DA 4CK2A 1ASWA 1QSLA 2F8TA 2VWJA 3VQ5A 3LPUA 1VSFA 4CE9A 4ID5A 1GOCA 3L3VA 1KTQA 3C95A 1RBUA 4ICLA 1S9GA 2RF2A 1TV6A 3NH2A 3OYIA 3OYCA 2VG7A 4DLEA 4I9QA 2RPIA 4DSEA 1IKVA 4N56A 3DI6A 4OVLA 4OGCA 2B5JA 1JKHA 3IRXA 3ZSQA 1VSDA 3CFRA 3DLBA 4M3RA 4W5RA 4KB0A 4KREA 4W5QA 1XHZA 2BGGA 3NDKA 1GOAA 5HLFA 2KZZA 4NCAA 1CXUA 4BWJA 3PUFA 4C8NA 4PA1A 4KPYA 4DWIA 4M3UA 4KTQA 4B9LA 1RBRA 4N47A 4KB1A 2VG6A 4EP4A 2D0AA 3C6UA 3LPTA 3ITHA 1UA0A 2F96A 4FJJA 4Z0UA 4FLTA 4FJLA 2ZQBA 3DRSA 4J2EA 1BISA 3T1AA 1N5YA 1YTUA 2D5RA 3LALA 4E7IA 4O4GA 4O0JA 1IH7A 4ZHRA 4FJMA 2YHAA 4FLXA 3UIQA 4FYDA 1QS4A 3M8PA 1BCMA 2G8WA 4F3TA 1UAXA 3ZCMA 1J53A 1WNSA 1U47A 1Q8IA 1X9WA 1SUQA 4AHTA 3OYNA 4F4KA 3HPHA 3LWLA 3U6FA 1DLOA 1S9EA 3VQAA 3OYEA 2E6LA 3P83D 3VQ7A 1BL3A 3QETA 5HRPA 1RBVA 1S1VA 2WOMA 2YHBA 3CQ8A 1LW0A 5HRSA 3MAQA 3DRRA 4CF0A 2HVHA 2IS3A 4W5OA 4B9TA 4W5NA 3LP1A 2LSNA 5CYQA 1S6QA 2QXFA 1HYSA 3PX0A 4FM2A 1D5AA 1WSEA 3QIPA 1N6QA 3IG1A 3TAGA 4B9NA 1L3VA 4CJ3A 3LAMA 3F73A 4B3OA 3I8DA 4CJVA 3LANA 4DTSA 3O4NA 3QEIA 4O55A 1VSEA 2Z1GA 4Z4EA 2G8IA 2P5OA 3KK3A 1ASUA 3V9ZA 4Z4HA 5J2QA 1BIZA 1VSJA 2E6MA 3L2QA 2Z1HA 1QSYA 3L2VA 4FW2A 4I2QA 3OS2A 3QESA 4CIFA 1NK4A 1U48A 2QK9A 3AO3A 1RT3A 2G8FA 1B9DA 4TSXA 4NCGA 2HW3A 4E1NA 1VSKA 4CIEA 4OLBA 1BI4B 1QQCA 1JL2A 4CJFA 3EY1A 4M3XA 3K5MA 3TAEA 1D9DA 4EP5A 1ZBUA 3P5JA 4DTMA 4B8AB 4E19A 4R5PA 4FLYA 3JSMA 3SUPA 1RTJA 3ZSYA 1S5JA 5KGXA 3MXJA 4CEQA 3QEXA 3RTVA 1W0HA 3O4QA 4E3SA 4FK2A 1HQEA 2PY5A 4N76A 3DRPA 3U3YA 3HO1A 2YKNA 1CZBA 1T05A 2HHUA 3ISNC 4CJWA 4DU4A 2G8KA 4KO0A 2XY7A 2XO7A 1FK9A 3TAQA 2OPRA 3F9KA 3NCIA 5I42A 1NK8A 1UOCA 4CCHA 2BDPA 5DK5A 2IOCA 2RN2A 1RTHA 3KKRA 2G8VA 1TAUA 4KHQA 5HRRA 4CFBA 4LSNA 4IFVA 1KFSA 5C25A 3AA5X 4CEBA 2P1JA 2OZSA 3NH1A 4DLGA 3TARA 1JLGA 4DSKA 3TR8A 4FLVA 3QO9A 5FDLA 3ALYA 3CM6A 1KLNA 1S1UA 3OJSA 1BQNA 3AVBA 4CF8A 4PY5A 2HHWA 4CF9A 3T19A 2G8HA 3RMDA 2HNYA 2DTUA 3DLKA 2FC0A 3AVNA 4N5SA 4JS4A 1LWCA 5HROA 4O0IA 1RT6A 4CESA 2P51A 4BE1A 3VQBA 4BE0A 1S1TA 1WAFA 3ZT1A 1T03A 3RWUA 4CHOA 3ZSXA 2OPSA 3S3NA 1G15A 2PYLA 5DMRA 4RW4A 2HHSA 1REVA 4CJ5A 4C8MA 1C0TA 3HYFA 1GOBA 1DTQA 3AVCA 1NOZA 4IBNA 3AVHA 4FZXC 4CGIA 1Z26A 3MXMA 1RDCA 1U49A 3AV9A 3OY9A 3KKSA 4DTNA 2YV0X 2ATQA 2X6NA 4HHTA 1NK0A 3AA2A 3OVNA 4AHCA 3DM2A 3ULDA 2HHXA 2KFNA 3VQDA 3KLGA 1EX4A 4KRFA 4OPJA 1HYZA 1WSFA 3LZIA 1SV5A 4OKKA 2ZD1A 3AVIA 1MU2A 4DG1A 2HMIA 2QKKA 4FJ8A 4DQSA 2O4GA 4JS5A 3LWMA 3KLFA 4J2BA 3K57A 4OKJA 2YKMA 5T7BA 3K58A 3HPOA 2X78A 1T8EA 4EZ6A 1RCHA 5KRSA 4QOZB 4H4MA 4BACA 3TAFA 1S1XA 3KTQA 4FJ5A 4KI6A 4KTWA 4KKOA 5FRNA 1NJYA 3EYZA 3OYGA 3AA3A 4F3OA 1ZYQA 1JLEA 1BIUA 4GVMA 3QLHA 3S3MA 3RR8A 2OPQA 1IKXA 1VK0A 4KHWA 5SZTA 1LWFA 3DLHA 4FJKA 4DF4A 1RT2A 3RMCA 4W5TA 4HUEA 1VSLA 3SQ2A 4FXDA 4HUFA 1ITGA 2KZMA 4BDYA 4BDPA 2JGUA 4OKEA 1J5OA 1RBTA 2JLEA 3NBPA 4HUGA 4FLWA 3P1GA 1Q9YA 1RNHA 3KIOA 1XC9A 3OYLA 1I3AA 4CIGA 3VQEA 1RT4A 2WONA 4E7HA 2W42A 4CJ4A 3L3UA 5JS2A 4N41A 5CZ1A 4DU3A 1RT7A 1YTAA 1A5WA 4H8KA 4FZZA 4AHSA 3OJUA 3D0PA 1EXQA 4DF8A 3NH0A 3VA0A 1D9FA 4CJRA 4CFDA 4DSLA 1JLAA 4E7KA 1EP4A 3VA3A 4E7JA 2IC3A 3QEVA 1SKRA 3H08A 4E7LA 1U4BA 1NK7A 2O4IA 4LH5A 1RILA 2VG5A 4CHNA 3SYZA 5I3UA 3CFOA 3V1OA 4CK1A 4ID1A 3TAPA 1HYVA 1UWBA 1XWLA 2IDOA 3LP2A 3CFPA 1XI1A 3RRGA 3AO2A 2XY8A 1FKOA 1B92A 1C1CA 3ZSWA 3DOKA 4DS5A 1TK5A 1KSPA 3AVJA 1QE1A 5KRTA 4AILC 4FJXA 5SWMA 3SQ1A 3SPYA 3VQ6A 4M3ZA 1L3SA 4Z4CA 3LDSA 3NF9A 4DTOA 3LP0A 1BQMA 3MECA 4I2PA 4NYFA 1LW2A 4DQPA 3AVLA 1IO2A 3E01A 3KK2A 1CZ9A 2OZMA 3L2WA 3VQ9A 1RDDA 3AO5A 4EZ9A 4DSJA 4F2RA 3B6PA 4DS4A 4XIUA 3TWHA 2Q3SA 3NGIA 1EKEA 3MEEA 4AHVA 4CK3A 4Z4GA 4CJUA 5HBMA 3EZ5A 1TK8A 4DU1A 3QNOA 4J2AA 1A5XA 4CJLA 3IAYA 4H4OA 5KGWA 1L3UA 1TK0A 3DLEA 1TL3A 3SZ2A 1J9AA 4K8ZA 3M8QA 4DTRA 5J1EA 3ZT3A 3NGZA 2BE2A 2DFFA 4I7FA 3VQPA 3OYDA 4CJTA 4ELUA 2HVIA 1I39A 3AVKA 4YNQA 3QEPA 4BWMA 1BI4A 1EETA 2PYJA 1NK9A 1R0AA 1WAJA 4IDKA 1T7PA 4CEOA 2KTQA 3ZSVA 4KHSA 3NAEA 4FJ9A 3V9SA 4FJGA 3ZT4A 1DTTA 3LP3A 5CYMA 1IKWA 2IGIA 5HRNA 3LZJA 3I0RA 1TL1A 3QEWA 4FJHA 2QKBA 3ZSZA 1RDBA 1KFDA 3RR7A 3KD5E 3THVA 1W9HA 1TVRA 2FBXA 3S9HA 3NF7A 3HVTA 3VQ8A 3L8BA 3SV4A 4DSFA 4MQ3A 4Y1DA 3HJFA 4GW6A 3U3GA 3KJVA 1HJRA 1QSSA 4CJKA 3V4IA 4HVJA 3ZT0A 1JL1A 1C1AA 2ITGA 4DFKA 3AVMA 4C8LA 4CF2A 3WNGA 1TKXA 1C0MA 4QAGA 4JRQA 4FJIA 1FKPA 1K6YA 3HT3A 1NOYA 4KHUA 1VSHA 4RW8A 3OS0A 3SJJA 1BCOA 1D8YA 1CLQA 1HQUA 4LH4A 3T3FA 2B6AA 2R7YA 1RT5A 5J2NA 1Q9XA 1C0UA 1LWEA 3WNFA 1BGXT 1TKDA 3O3GA 3DMJA 1NK6A 3AVFA 4NYNA 2OPPA 5KI6A 3K5LA 4DTUA 2G8UA 1JLQA 2X6SA 4CJQA 1YT3A 3KK1A 1RTIA 4KHYA 4C8KA 3AVAA 2YNGA 1KCFA 3C94A 4CHZA 4DMNA 1KVBA 3BDPA 5KTQA 3S3OA 4E89A 4KAZA 4F2SA 3L2RA 4KTZA 4OGEA 3PX4A 3SUQA 3NHGA 4FK0A 3DYAA 1BHLA 1HPZA 1UA1A 4M3WA 3V81A 4KI4A 1L3TA 1Y97A 4CJPA 1WSIA 2OA8A 2ETJA 3I0SA 4RW6A 2NUBA 2GUIA 4DQQA 3SQ4A 4RG8A 3CYMA 4C8OA 4B9MA 3MEGA 4CFCA 4FCYA 4CERA 2P5GA 3VN5A 5CY4A 1F21A 4M41A 4DFPA 1RBSA 1NJZA 4M3YA 2F8SA 2D0CA 3HXMA 3V1RA 3BGRA 4HCBA 1J54A 4KFBA 1NJWA 1FXXA 4AHRA 3SPZA 2DFHA 4FJNA 4RW7A 4DSIA 5CZ2A 4IKFA 3ZSOA 1KRPA 4LSLA 1WSGA 1IG9A 4Y1CA 3VQ4A 3TI0A 1HNVA 4CGGA 4ELVA 1RT1A 3K5NA 2YNIA 4DFJA 1NKBA 2OYQA 1NJXA 3ZSRA 3HK2A 4CEZA 3PO4A 2DFEA 2A1SA 1JXBA 1RTDA 4I9LA 1LAWA 2IAJA 3A2FA 2YNHA 3AA4A 3AVGA 4M42A 1HMVA 1TKTA 4CEFA 3MXIA 2HHVA 3PX6A 2D0BA 4M45A 3OYAA 3V9UA 3TABA 4B9UA 3HPGA 1ZBLA 4FLUA 3NF6A 4Z4FA 2Y1IA 1XHXA 1U04A 3M8RA 2Y1JA 2KW4A 3TANA 5C42A 2FBVA 3MEDA 4GMJB 2KQ2A 3V1QA 3IS9A 3O3HA 4DTXA 4ZTJA 2PZSA 4Z4IA 2DY4A 1JLFA 3G10A 3HP9A 3HVRA 3SCXA 3K5OA 4IG0A 4CGDA 5JS1A 4BDZA 1C6VA 4FK4A 1TGOA 4CHPA 3OYJA 1SL1A 2E4LA 1VSIA 3AO4A 4CJEA 1LAVA 1O1WA 5J2PA 3KLEA 3SUNA 4PQUA 1HNIA 1QHTA 2EHGA 4CGHA 5E41A 4WE1A 4YFUA 4L8RB 3SQ0A 4DFMA 2Z1IA 3HP6A 3JYTA 3QIOA 3DLRA 4FZYA 1TAQA 4CJSA 3M8SA 2Z1JA 3OYKA 3PV8A 3RMAA 2HHQA 4CFAA 3K59A 3HM9A 1L5UA 1JLBA 1KLMA 5C24A 2FBTA 3VQQA 4JRPA 4B9VA 1S6PA 4CGJA 1SKSA 1IKYA 1WSJA 4MFBA 1JLCA 4AHUA 1VRTA 1SKWA 4E1MA 3SNNA 1S1WA 1WSHA 3WNEA 3V9WA 1WN7A 4DQIA 4DTPA 5K14A 3CG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CEA A;  4FW1 A;  4CEE A;  4B9S A;  4Q0B A;  4O44 A;  3G0Z A;  4CF1 A;  2HND A;  2YNF A;  3V9X A;  3NFA A;  1WLJ A;  4UQG A;  2XRI A;  3NE6 A;  1X9M A;  4AH9 A;  4FLZ A;  4E0D A;  4K8X A;  5D3G A;  4OLA A;  3NF8 A;  1A5V A;  2EX3 A;  3KD1 E;  1Z25 A;  3DOL A;  1NKE A;  3CM5 A;  4CED A;  4KV8 A;  4CEC A;  3OYB A;  4RW9 A;  1NK5 A;  3KLI A;  3QIN A;  4JLH A;  3B6O A;  1NKC A;  3RRH A;  4QCL A;  4KHN A;  4ELT A;  2GV9 A;  1RDA A;  1TKZ A;  4LY7 A;  2KFZ A;  1U45 A;  3C6T A;  4HCC A;  3OYM A;  4O5B A;  4DTJ A;  3PY8 A;  2X74 A;  4PWD A;  4ZTF A;  2RKI A;  3FFI A;  3LAK A;  2XY5 A;  1QTM A;  1ZBF A;  4IFY A;  4CGF A;  1VRU A;  3D45 A;  2XHB A;  5EU7 A;  4NCB A;  2HNZ A;  2FBY A;  4B08 A;  3KLH A;  3OYF A;  1SL2 A;  3VQC A;  1JXE A;  1YVU A;  5FRO A;  3SUO A;  4F8R A;  4Q5V A;  3ZT2 A;  1CXQ A;  4BE2 A;  1X9S A;  2I5J A;  4OPK A;  2BAN A;  2VWK A;  3AO1 A;  3ASM A;  4OJR A;  4FM1 A;  3NGY A;  4CHY A;  3SV3 A;  2XY6 A;  3RMB A;  1KVC A;  2ZE2 A;  4IG3 A;  4LD0 A;  2A1R A;  1ASV A;  4FJ7 A;  4FVM A;  4M3T A;  4DQR A;  1ZBI A;  2AJQ A;  1B9F A;  3DLG A;  3SI6 A;  3QNN A;  3TAM A;  4HTU A;  4CHQ A;  1ZBH A;  3HL8 A;  3HST B;  1HRH A;  1C1B A;  1X1P A;  1LV5 A;  1VSM A;  3OS1 A;  1KVA A;  4FM0 A;  3V6D A;  5FRM A;  2HHT A;  5HP1 A;  3OYH A;  2B4J A;  3QER A;  4PUO A;  3L2U A;  3PO5 A;  4B8C A;  2GBZ A;  2HB5 A;  4G1Q A;  3WNH A;  3K2P A;  1SL0 A;  5J2M A;  3O3F A;  4J2D A;  4CK2 A;  1ASW A;  1QSL A;  2F8T A;  2VWJ A;  3VQ5 A;  3LPU A;  1VSF A;  4CE9 A;  4ID5 A;  1GOC A;  3L3V A;  1KTQ A;  3C95 A;  1RBU A;  4ICL A;  1S9G A;  2RF2 A;  1TV6 A;  3NH2 A;  3OYI A;  3OYC A;  2VG7 A;  4DLE A;  4I9Q A;  2RPI A;  4DSE A;  1IKV A;  4N56 A;  3DI6 A;  4OVL A;  4OGC A;  2B5J A;  1JKH A;  3IRX A;  3ZSQ A;  1VSD A;  3CFR A;  3DLB A;  4M3R A;  4W5R A;  4KB0 A;  4KRE A;  4W5Q A;  1XHZ A;  2BGG A;  3NDK A;  1GOA A;  5HLF A;  2KZZ A;  4NCA A;  1CXU A;  4BWJ A;  3PUF A;  4C8N A;  4PA1 A;  4KPY A;  4DWI A;  4M3U A;  4KTQ A;  4B9L A;  1RBR A;  4N47 A;  4KB1 A;  2VG6 A;  4EP4 A;  2D0A A;  3C6U A;  3LPT A;  3ITH A;  1UA0 A;  2F96 A;  4FJJ A;  4Z0U A;  4FLT A;  4FJL A;  2ZQB A;  3DRS A;  4J2E A;  1BIS A;  3T1A A;  1N5Y A;  1YTU A;  2D5R A;  3LAL A;  4E7I A;  4O4G A;  4O0J A;  1IH7 A;  4ZHR A;  4FJM A;  2YHA A;  4FLX A;  3UIQ A;  4FYD A;  1QS4 A;  3M8P A;  1BCM A;  2G8W A;  4F3T A;  1UAX A;  3ZCM A;  1J53 A;  1WNS A;  1U47 A;  1Q8I A;  1X9W A;  1SUQ A;  4AHT A;  3OYN A;  4F4K A;  3HPH A;  3LWL A;  3U6F A;  1DLO A;  1S9E A;  3VQA A;  3OYE A;  2E6L A;  3P83 D;  3VQ7 A;  1BL3 A;  3QET A;  5HRP A;  1RBV A;  1S1V A;  2WOM A;  2YHB A;  3CQ8 A;  1LW0 A;  5HRS A;  3MAQ A;  3DRR A;  4CF0 A;  2HVH A;  2IS3 A;  4W5O A;  4B9T A;  4W5N A;  3LP1 A;  2LSN A;  5CYQ A;  1S6Q A;  2QXF A;  1HYS A;  3PX0 A;  4FM2 A;  1D5A A;  1WSE A;  3QIP A;  1N6Q A;  3IG1 A;  3TAG A;  4B9N A;  1L3V A;  4CJ3 A;  3LAM A;  3F73 A;  4B3O A;  3I8D A;  4CJV A;  3LAN A;  4DTS A;  3O4N A;  3QEI A;  4O55 A;  1VSE A;  2Z1G A;  4Z4E A;  2G8I A;  2P5O A;  3KK3 A;  1ASU A;  3V9Z A;  4Z4H A;  5J2Q A;  1BIZ A;  1VSJ A;  2E6M A;  3L2Q A;  2Z1H A;  1QSY A;  3L2V A;  4FW2 A;  4I2Q A;  3OS2 A;  3QES A;  4CIF A;  1NK4 A;  1U48 A;  2QK9 A;  3AO3 A;  1RT3 A;  2G8F A;  1B9D A;  4TSX A;  4NCG A;  2HW3 A;  4E1N A;  1VSK A;  4CIE A;  4OLB A;  1BI4 B;  1QQC A;  1JL2 A;  4CJF A;  3EY1 A;  4M3X A;  3K5M A;  3TAE A;  1D9D A;  4EP5 A;  1ZBU A;  3P5J A;  4DTM A;  4B8A B;  4E19 A;  4R5P A;  4FLY A;  3JSM A;  3SUP A;  1RTJ A;  3ZSY A;  1S5J A;  5KGX A;  3MXJ A;  4CEQ A;  3QEX A;  3RTV A;  1W0H A;  3O4Q A;  4E3S A;  4FK2 A;  1HQE A;  2PY5 A;  4N76 A;  3DRP A;  3U3Y A;  3HO1 A;  2YKN A;  1CZB A;  1T05 A;  2HHU A;  3ISN C;  4CJW A;  4DU4 A;  2G8K A;  4KO0 A;  2XY7 A;  2XO7 A;  1FK9 A;  3TAQ A;  2OPR A;  3F9K A;  3NCI A;  5I42 A;  1NK8 A;  1UOC A;  4CCH A;  2BDP A;  5DK5 A;  2IOC A;  2RN2 A;  1RTH A;  3KKR A;  2G8V A;  1TAU A;  4KHQ A;  5HRR A;  4CFB A;  4LSN A;  4IFV A;  1KFS A;  5C25 A;  3AA5 X;  4CEB A;  2P1J A;  2OZS A;  3NH1 A;  4DLG A;  3TAR A;  1JLG A;  4DSK A;  3TR8 A;  4FLV A;  3QO9 A;  5FDL A;  3ALY A;  3CM6 A;  1KLN A;  1S1U A;  3OJS A;  1BQN A;  3AVB A;  4CF8 A;  4PY5 A;  2HHW A;  4CF9 A;  3T19 A;  2G8H A;  3RMD A;  2HNY A;  2DTU A;  3DLK A;  2FC0 A;  3AVN A;  4N5S A;  4JS4 A;  1LWC A;  5HRO A;  4O0I A;  1RT6 A;  4CES A;  2P51 A;  4BE1 A;  3VQB A;  4BE0 A;  1S1T A;  1WAF A;  3ZT1 A;  1T03 A;  3RWU A;  4CHO A;  3ZSX A;  2OPS A;  3S3N A;  1G15 A;  2PYL A;  5DMR A;  4RW4 A;  2HHS A;  1REV A;  4CJ5 A;  4C8M A;  1C0T A;  3HYF A;  1GOB A;  1DTQ A;  3AVC A;  1NOZ A;  4IBN A;  3AVH A;  4FZX C;  4CGI A;  1Z26 A;  3MXM A;  1RDC A;  1U49 A;  3AV9 A;  3OY9 A;  3KKS A;  4DTN A;  2YV0 X;  2ATQ A;  2X6N A;  4HHT A;  1NK0 A;  3AA2 A;  3OVN A;  4AHC A;  3DM2 A;  3ULD A;  2HHX A;  2KFN A;  3VQD A;  3KLG A;  1EX4 A;  4KRF A;  4OPJ A;  1HYZ A;  1WSF A;  3LZI A;  1SV5 A;  4OKK A;  2ZD1 A;  3AVI A;  1MU2 A;  4DG1 A;  2HMI A;  2QKK A;  4FJ8 A;  4DQS A;  2O4G A;  4JS5 A;  3LWM A;  3KLF A;  4J2B A;  3K57 A;  4OKJ A;  2YKM A;  5T7B A;  3K58 A;  3HPO A;  2X78 A;  1T8E A;  4EZ6 A;  1RCH A;  5KRS A;  4QOZ B;  4H4M A;  4BAC A;  3TAF A;  1S1X A;  3KTQ A;  4FJ5 A;  4KI6 A;  4KTW A;  4KKO A;  5FRN A;  1NJY A;  3EYZ A;  3OYG A;  3AA3 A;  4F3O A;  1ZYQ A;  1JLE A;  1BIU A;  4GVM A;  3QLH A;  3S3M A;  3RR8 A;  2OPQ A;  1IKX A;  1VK0 A;  4KHW A;  5SZT A;  1LWF A;  3DLH A;  4FJK A;  4DF4 A;  1RT2 A;  3RMC A;  4W5T A;  4HUE A;  1VSL A;  3SQ2 A;  4FXD A;  4HUF A;  1ITG A;  2KZM A;  4BDY A;  4BDP A;  2JGU A;  4OKE A;  1J5O A;  1RBT A;  2JLE A;  3NBP A;  4HUG A;  4FLW A;  3P1G A;  1Q9Y A;  1RNH A;  3KIO A;  1XC9 A;  3OYL A;  1I3A A;  4CIG A;  3VQE A;  1RT4 A;  2WON A;  4E7H A;  2W42 A;  4CJ4 A;  3L3U A;  5JS2 A;  4N41 A;  5CZ1 A;  4DU3 A;  1RT7 A;  1YTA A;  1A5W A;  4H8K A;  4FZZ A;  4AHS A;  3OJU A;  3D0P A;  1EXQ A;  4DF8 A;  3NH0 A;  3VA0 A;  1D9F A;  4CJR A;  4CFD A;  4DSL A;  1JLA A;  4E7K A;  1EP4 A;  3VA3 A;  4E7J A;  2IC3 A;  3QEV A;  1SKR A;  3H08 A;  4E7L A;  1U4B A;  1NK7 A;  2O4I A;  4LH5 A;  1RIL A;  2VG5 A;  4CHN A;  3SYZ A;  5I3U A;  3CFO A;  3V1O A;  4CK1 A;  4ID1 A;  3TAP A;  1HYV A;  1UWB A;  1XWL A;  2IDO A;  3LP2 A;  3CFP A;  1XI1 A;  3RRG A;  3AO2 A;  2XY8 A;  1FKO A;  1B92 A;  1C1C A;  3ZSW A;  3DOK A;  4DS5 A;  1TK5 A;  1KSP A;  3AVJ A;  1QE1 A;  5KRT A;  4AIL C;  4FJX A;  5SWM A;  3SQ1 A;  3SPY A;  3VQ6 A;  4M3Z A;  1L3S A;  4Z4C A;  3LDS A;  3NF9 A;  4DTO A;  3LP0 A;  1BQM A;  3MEC A;  4I2P A;  4NYF A;  1LW2 A;  4DQP A;  3AVL A;  1IO2 A;  3E01 A;  3KK2 A;  1CZ9 A;  2OZM A;  3L2W A;  3VQ9 A;  1RDD A;  3AO5 A;  4EZ9 A;  4DSJ A;  4F2R A;  3B6P A;  4DS4 A;  4XIU A;  3TWH A;  2Q3S A;  3NGI A;  1EKE A;  3MEE A;  4AHV A;  4CK3 A;  4Z4G A;  4CJU A;  5HBM A;  3EZ5 A;  1TK8 A;  4DU1 A;  3QNO A;  4J2A A;  1A5X A;  4CJL A;  3IAY A;  4H4O A;  5KGW A;  1L3U A;  1TK0 A;  3DLE A;  1TL3 A;  3SZ2 A;  1J9A A;  4K8Z A;  3M8Q A;  4DTR A;  5J1E A;  3ZT3 A;  3NGZ A;  2BE2 A;  2DFF A;  4I7F A;  3VQP A;  3OYD A;  4CJT A;  4ELU A;  2HVI A;  1I39 A;  3AVK A;  4YNQ A;  3QEP A;  4BWM A;  1BI4 A;  1EET A;  2PYJ A;  1NK9 A;  1R0A A;  1WAJ A;  4IDK A;  1T7P A;  4CEO A;  2KTQ A;  3ZSV A;  4KHS A;  3NAE A;  4FJ9 A;  3V9S A;  4FJG A;  3ZT4 A;  1DTT A;  3LP3 A;  5CYM A;  1IKW A;  2IGI A;  5HRN A;  3LZJ A;  3I0R A;  1TL1 A;  3QEW A;  4FJH A;  2QKB A;  3ZSZ A;  1RDB A;  1KFD A;  3RR7 A;  3KD5 E;  3THV A;  1W9H A;  1TVR A;  2FBX A;  3S9H A;  3NF7 A;  3HVT A;  3VQ8 A;  3L8B A;  3SV4 A;  4DSF A;  4MQ3 A;  4Y1D A;  3HJF A;  4GW6 A;  3U3G A;  3KJV A;  1HJR A;  1QSS A;  4CJK A;  3V4I A;  4HVJ A;  3ZT0 A;  1JL1 A;  1C1A A;  2ITG A;  4DFK A;  3AVM A;  4C8L A;  4CF2 A;  3WNG A;  1TKX A;  1C0M A;  4QAG A;  4JRQ A;  4FJI A;  1FKP A;  1K6Y A;  3HT3 A;  1NOY A;  4KHU A;  1VSH A;  4RW8 A;  3OS0 A;  3SJJ A;  1BCO A;  1D8Y A;  1CLQ A;  1HQU A;  4LH4 A;  3T3F A;  2B6A A;  2R7Y A;  1RT5 A;  5J2N A;  1Q9X A;  1C0U A;  1LWE A;  3WNF A;  1BGX T;  1TKD A;  3O3G A;  3DMJ A;  1NK6 A;  3AVF A;  4NYN A;  2OPP A;  5KI6 A;  3K5L A;  4DTU A;  2G8U A;  1JLQ A;  2X6S A;  4CJQ A;  1YT3 A;  3KK1 A;  1RTI A;  4KHY A;  4C8K A;  3AVA A;  2YNG A;  1KCF A;  3C94 A;  4CHZ A;  4DMN A;  1KVB A;  3BDP A;  5KTQ A;  3S3O A;  4E89 A;  4KAZ A;  4F2S A;  3L2R A;  4KTZ A;  4OGE A;  3PX4 A;  3SUQ A;  3NHG A;  4FK0 A;  3DYA A;  1BHL A;  1HPZ A;  1UA1 A;  4M3W A;  3V81 A;  4KI4 A;  1L3T A;  1Y97 A;  4CJP A;  1WSI A;  2OA8 A;  2ETJ A;  3I0S A;  4RW6 A;  2NUB A;  2GUI A;  4DQQ A;  3SQ4 A;  4RG8 A;  3CYM A;  4C8O A;  4B9M A;  3MEG A;  4CFC A;  4FCY A;  4CER A;  2P5G A;  3VN5 A;  5CY4 A;  1F21 A;  4M41 A;  4DFP A;  1RBS A;  1NJZ A;  4M3Y A;  2F8S A;  2D0C A;  3HXM A;  3V1R A;  3BGR A;  4HCB A;  1J54 A;  4KFB A;  1NJW A;  1FXX A;  4AHR A;  3SPZ A;  2DFH A;  4FJN A;  4RW7 A;  4DSI A;  5CZ2 A;  4IKF A;  3ZSO A;  1KRP A;  4LSL A;  1WSG A;  1IG9 A;  4Y1C A;  3VQ4 A;  3TI0 A;  1HNV A;  4CGG A;  4ELV A;  1RT1 A;  3K5N A;  2YNI A;  4DFJ A;  1NKB A;  2OYQ A;  1NJX A;  3ZSR A;  3HK2 A;  4CEZ A;  3PO4 A;  2DFE A;  2A1S A;  1JXB A;  1RTD A;  4I9L A;  1LAW A;  2IAJ A;  3A2F A;  2YNH A;  3AA4 A;  3AVG A;  4M42 A;  1HMV A;  1TKT A;  4CEF A;  3MXI A;  2HHV A;  3PX6 A;  2D0B A;  4M45 A;  3OYA A;  3V9U A;  3TAB A;  4B9U A;  3HPG A;  1ZBL A;  4FLU A;  3NF6 A;  4Z4F A;  2Y1I A;  1XHX A;  1U04 A;  3M8R A;  2Y1J A;  2KW4 A;  3TAN A;  5C42 A;  2FBV A;  3MED A;  4GMJ B;  2KQ2 A;  3V1Q A;  3IS9 A;  3O3H A;  4DTX A;  4ZTJ A;  2PZS A;  4Z4I A;  2DY4 A;  1JLF A;  3G10 A;  3HP9 A;  3HVR A;  3SCX A;  3K5O A;  4IG0 A;  4CGD A;  5JS1 A;  4BDZ A;  1C6V A;  4FK4 A;  1TGO A;  4CHP A;  3OYJ A;  1SL1 A;  2E4L A;  1VSI A;  3AO4 A;  4CJE A;  1LAV A;  1O1W A;  5J2P A;  3KLE A;  3SUN A;  4PQU A;  1HNI A;  1QHT A;  2EHG A;  4CGH A;  5E41 A;  4WE1 A;  4YFU A;  4L8R B;  3SQ0 A;  4DFM A;  2Z1I A;  3HP6 A;  3JYT A;  3QIO A;  3DLR A;  4FZY A;  1TAQ A;  4CJS A;  3M8S A;  2Z1J A;  3OYK A;  3PV8 A;  3RMA A;  2HHQ A;  4CFA A;  3K59 A;  3HM9 A;  1L5U A;  1JLB A;  1KLM A;  5C24 A;  2FBT A;  3VQQ A;  4JRP A;  4B9V A;  1S6P A;  4CGJ A;  1SKS A;  1IKY A;  1WSJ A;  4MFB A;  1JLC A;  4AHU A;  1VRT A;  1SKW A;  4E1M A;  3SNN A;  1S1W A;  1WSH A;  3WNE A;  3V9W A;  1WN7 A;  4DQI A;  4DTP A;  5K14 A;  3CG7 A; 
#chains in the Genus database with same CATH topology
 3VTH A;  1U2V A;  4B9S A;  2D0P A;  3G71 N;  4O44 A;  3V9X A;  1H1V A;  2HND A;  2YNF A;  3BUZ B;  2YHW A;  2XRI A;  4AH9 A;  4BR0 A;  4CZI A;  3FZK A;  3KD1 E;  3CJ7 A;  3CM5 A;  4CEC A;  1NK5 A;  3CJ1 A;  4KHN A;  2O8C A;  1TKZ A;  2KFZ A;  3QBW A;  4O5B A;  4DTJ A;  3PY8 A;  2X74 A;  4JI2 K;  4BVO A;  3LAK A;  4FWP A;  2E88 A;  4NCB A;  3O9S A;  2HNZ A;  4B08 A;  3OYF A;  2JWK A;  1QQM A;  1YVU A;  4F8R A;  3ZT2 A;  1CXQ A;  2V52 B;  2I5J A;  3PSI A;  4OPK A;  2VWK A;  3AO1 A;  2BH1 A;  4OJR A;  3SV3 A;  3RMB A;  4A2A A;  4DR6 K;  4LD0 A;  3THW A;  2NLX A;  2GWJ A;  4CHQ A;  2FSN A;  2IVP A;  1VSM A;  5FRM A;  1GLE G;  2HHT A;  2B4J A;  1VQL N;  3L2U A;  2GBZ A;  2HB5 A;  5BR9 A;  2VWJ A;  1VSF A;  4ID5 A;  3O9T A;  1RBU A;  5BRH A;  4JKC A;  1NGE A;  3OYI A;  3OYC A;  1IKV A;  3DI6 A;  2P9I B;  1JKH A;  3DLB A;  4KRE A;  4W5Q A;  3ZET B;  4NCA A;  1CXU A;  4BWJ A;  3PUF A;  4CJ7 A;  3K9K A;  1RBR A;  4N47 A;  1VQN N;  2VG6 A;  4EP4 A;  3LPT A;  4PKG A;  1UA0 A;  1KAY A;  5AQO A;  1VQ4 N;  1YJW N;  1WOQ A;  2YCH A;  4J2E A;  3T1A A;  1N5Y A;  4E7I A;  2UUA K;  4O0J A;  2P9S A;  4Z94 A;  3ZX2 A;  2YHA A;  2NNW A;  3CIP A;  4FYD A;  5JIC A;  4WCE L;  3FZF A;  3U6F A;  2NRX A;  3MK6 A;  3P83 D;  1BL3 A;  1RBV A;  1S1V A;  1NLV A;  4ISG A;  1T44 A;  2WOM A;  1LW0 A;  1SAZ A;  5HRS A;  2HVH A;  4FL9 A;  4W5O A;  3THY B;  4IOX A;  1S6Q A;  1JCE A;  1HYS A;  3T7Z A;  4FWL A;  3PX0 A;  2O8C B;  1WSE A;  4B9N A;  3I8D A;  4JKG B;  4Y0W A;  4CJV A;  4DTS A;  1N34 K;  4Z4E A;  2Z1G A;  2P5O A;  3DWL A;  4AQY K;  3V9Z A;  4Z4H A;  5J2Q A;  1BIZ A;  1E4F T;  2IVO A;  4FW2 A;  2NRV A;  1U48 A;  3L6Q A;  2WFB A;  4DV3 K;  1DKG D;  1NGB A;  4TSX A;  1VSK A;  1ZBS A;  3FR0 A;  2Q2R A;  1QQC A;  4CJF A;  3EY1 A;  3K5M A;  3TAE A;  1VQO N;  1D9D A;  3EO3 A;  4B8A B;  3JSM A;  1S5J A;  5JVH L;  1OH7 A;  3QEX A;  4OPA A;  1W0H A;  3O4Q A;  4E3S A;  4FK2 A;  1HQE A;  3HO1 A;  3DRP A;  4H0T B;  1CZB A;  3ISN C;  3TAQ A;  3CQX A;  2BDP A;  2RN2 A;  1RTH A;  1XNR K;  2G8V A;  2UXC K;  2P9I A;  5HRR A;  4LSN A;  1NJI O;  2P1J A;  5ADX A;  5LJV A;  4WQ4 C;  4JV5 K;  3TAR A;  4PKI A;  5FPM A;  4DSK A;  5AJ3 K;  3K0S A;  2QWR A;  1SQK A;  3CM6 A;  3THY A;  1S1U A;  3RMD A;  4BRD A;  3AVN A;  3CJ9 A;  1LWC A;  4XH4 A;  4CBW A;  4BE1 A;  4LF7 K;  1S1T A;  3O80 A;  3AAP A;  3HTV A;  4BR4 A;  5DMR A;  5AZJ B;  4BRA A;  3HYF A;  1GOB A;  1DTQ A;  4M63 C;  4FZX C;  4CGI A;  4DR5 K;  1RDC A;  3AV9 A;  2ATQ A;  2X6N A;  1HX1 A;  4HHT A;  1NK0 A;  1XNQ K;  4AHC A;  2HHX A;  1EX4 A;  4JI0 K;  1DGK N;  1SV5 A;  5A2Q O;  4M7Y A;  2HMI A;  3K57 A;  4OKJ A;  1R59 O;  2V7Y A;  1T8E A;  4EZ6 A;  4JKG A;  3CHW A;  2NRR A;  2ZJP L;  5CR4 A;  3OBY A;  4KI6 A;  2YI1 A;  5FRN A;  1NJY A;  3EYZ A;  4F3O A;  1JLE A;  4GVM A;  1HLU A;  3MDQ A;  3RR8 A;  3FZM A;  3DLH A;  4FJK A;  1RT2 A;  1QZ5 A;  1N36 K;  2FXU A;  2KZM A;  2P9K B;  4BDP A;  3GG4 A;  5C15 A;  1J5O A;  3VQE A;  3OW2 M;  3AGR A;  3E66 A;  4CJ4 A;  3L3U A;  4DU3 A;  4H8K A;  4AHS A;  4DF8 A;  2KLA A;  3VA0 A;  4AM6 A;  5AZJ A;  4H0Y B;  5AQG A;  1SKR A;  1YF5 L;  3V1O A;  3TAP A;  1HYV A;  1XWL A;  1P8Z A;  3O4W A;  1FKO A;  1B92 A;  4LF5 K;  4DS5 A;  4IO9 L;  5M1K A;  1NBW A;  4U7B A;  4F9O A;  3SQ1 A;  5AR0 A;  1T6C A;  4Z4C A;  3NF9 A;  2QWM A;  1BQM A;  3MEC A;  3CCU N;  1CZ9 A;  3KWG A;  5AQR A;  5GIO A;  4BC2 A;  4XIU A;  2Q3S A;  3MEE A;  4K42 A;  4CJU A;  1TK8 A;  4DU1 A;  3QNO A;  5AQS A;  3AAQ A;  4H4O A;  5FLX O;  2A6A A;  3KK7 A;  3ZT3 A;  3NGZ A;  2BE2 A;  4ELU A;  3QDK A;  5EXW A;  2PYJ A;  1NK9 A;  3ZSV A;  3NAE A;  3EKS A;  1DTT A;  3CCQ N;  3QEW A;  2QTD A;  4EFH A;  5BPN A;  3VQ8 A;  3SV4 A;  3VOV A;  1ATS A;  2HF3 A;  1QSS A;  1HJR A;  4FJG A;  3ZT0 A;  4C8L A;  1C1A A;  2ITG A;  3AVM A;  1C0M A;  5DM6 L;  4JRQ A;  3HT3 A;  4KHU A;  1VSH A;  5E84 A;  3OS0 A;  3SJJ A;  1D8Y A;  3IFR A;  2Q1N A;  4HTL A;  5J2N A;  1Q9X A;  1C0U A;  3WNF A;  2AA4 A;  2O8E A;  1QVG M;  3R8E A;  3MX2 A;  5F1X A;  4MO5 A;  3Q7C A;  4CZK A;  4O5F A;  4EHU A;  1RTI A;  4KHY A;  1E3M A;  3AVA A;  1W97 L;  4IO8 A;  4R79 A;  3D2F A;  1KVB A;  5KTQ A;  3S3O A;  3SMP A;  3CC2 N;  4E89 A;  3CI5 A;  3CC4 N;  4KTZ A;  3D6R A;  3SUQ A;  4HWI A;  3NHG A;  3VEX A;  3A8Y A;  5BN9 A;  4M3W A;  3V81 A;  4KI4 A;  1L3T A;  5AZI A;  3FGU A;  3M1F A;  5BRE A;  3CCE N;  3I0S A;  4RW6 A;  1OH8 A;  3O9R A;  1HNZ K;  2GUI A;  1ATR A;  4DQQ A;  3CYM A;  4B9M A;  4DR7 K;  1RBS A;  4M3Y A;  1ZXO A;  3BGR A;  4HCB A;  1NJW A;  2DFH A;  2AP1 A;  4JEP A;  4DSI A;  4IKF A;  3ZSO A;  3O8M A;  3SK3 A;  3VQ4 A;  3TI0 A;  1HNV A;  3ULE B;  1RT1 A;  4GVE A;  3JAM O;  1JJ2 M;  4CEZ A;  3PO4 A;  2DFE A;  3DXM A;  1LAW A;  1GLB G;  2P9U A;  3AA4 A;  3WXL A;  5LY3 A;  4LC9 B;  1IBM K;  3V9U A;  3HPG A;  2UXB K;  2KHO A;  2OTJ N;  3TAN A;  3PIP L;  4JI6 K;  3CCV N;  2KQ2 A;  4ZTJ A;  4DTX A;  4Z4I A;  5JLF A;  3HVR A;  5FPN A;  3K5O A;  4IG0 A;  1MDU B;  3THX A;  1C6V A;  4H0X B;  1SL1 A;  3AO4 A;  4CJE A;  4PQU A;  1C0F A;  4PKH A;  5E41 A;  4WE1 A;  4BR7 A;  3EZW A;  4L8R B;  3SQ0 A;  4DFM A;  2Z1I A;  3H1V X;  3AAR A;  1OKJ A;  1SZ2 A;  1BG3 A;  3HM9 A;  2CGK A;  1GLC G;  1VQ8 N;  3O5B A;  5EVZ A;  3R9P A;  1SKS A;  3HRG A;  3OBW A;  3L4I A;  1WSH A;  5K14 A;  3CG7 A;  5KPT A;  3T1H K;  3O1W A;  3P38 A;  3G0Z A;  4CF1 A;  1X9M A;  4O8U A;  1JCG A;  4E0D A;  4K8X A;  4OLA A;  1A5V A;  2EX3 A;  3ENB A;  4DV0 K;  4WFB L;  1HJO A;  3KLI A;  4QCL A;  3B6O A;  3RRH A;  3MCP A;  1RDA A;  1U45 A;  3C6T A;  5AZI B;  4DV1 K;  2XY5 A;  1QTM A;  4CGF A;  4IFY A;  4LF4 K;  4MLH A;  1K73 O;  5FRO A;  4K43 A;  4Q5V A;  4H5T A;  3HBT A;  1U6Z A;  2J4R A;  4FM1 A;  2BAN A;  3ENH A;  3ASM A;  3TU5 A;  2QA4 N;  3NGY A;  2XY6 A;  4FWN A;  1ASV A;  4FVM A;  3DLG A;  1Z6R A;  3TAM A;  4HTU A;  1ZBH A;  3T69 A;  3HL8 A;  1NG9 A;  3MN9 A;  1KVA A;  4FM0 A;  3OYH A;  5GIP A;  3QER A;  4M7X A;  3PO5 A;  1K9M O;  3O9Q A;  3SLC A;  5TKY A;  3WNH A;  2P9U B;  3K2P A;  4J2D A;  1ASW A;  3VQ5 A;  4CE9 A;  1GOC A;  4ICL A;  1TV6 A;  1EO1 A;  4DLE A;  4I9Q A;  1NGI A;  4OGC A;  3CFR A;  5BR8 K;  3EE8 A;  4KB0 A;  1XHZ A;  3NDK A;  5HLF A;  5M1F A;  4PL8 A;  3ZET A;  5AQP A;  3VEV A;  1YAG A;  2VGM A;  3WQT A;  4KTQ A;  3A0I X;  5EX5 A;  2F96 A;  3IKM A;  4YOV A;  5IWA K;  4K0K K;  3EN9 A;  2ZQB A;  2O8F B;  3DRS A;  4BRH A;  1XQS C;  1YTU A;  2D5R A;  5EY4 A;  2ASM A;  2P9S B;  5M1Q A;  4FLX A;  2G8W A;  4JKE A;  1UAX A;  2ZGZ A;  5LJW A;  1U47 A;  1X9W A;  5GAD P;  3LWL A;  3QET A;  2YHB A;  1IG8 A;  3DRR A;  5TKW A;  4CF0 A;  2IS3 A;  3SAF A;  4W5N A;  4A5A A;  5AQT A;  2GX9 A;  3MWP A;  4CZE A;  4FM2 A;  4BC5 A;  1D5A A;  1OVQ A;  2P9P A;  4CJ3 A;  3LAM A;  3AY9 A;  3BF3 A;  3LAN A;  4BRP A;  4YHH K;  4CZH A;  3QEI A;  2HHH K;  4ILG B;  2E6M A;  3L2Q A;  4I2Q A;  1NMD A;  3OS2 A;  4CIF A;  2QK9 A;  5AQH A;  2G8F A;  1B9D A;  1KC8 O;  4OLB A;  4BR5 A;  3UKU B;  3ZEU A;  1Z05 A;  4DHY A;  4DTM A;  4R5P A;  1RTJ A;  2RHK A;  4NO7 A;  2PY5 A;  4N76 A;  3U3Y A;  4JKA A;  1T05 A;  4DU4 A;  3U9D A;  1NGD A;  1ESV A;  3NCI A;  1BWF O;  4H5W A;  1TAU A;  4BR9 A;  3HM8 A;  5F2R A;  1KFS A;  5C25 A;  2A41 A;  3AA5 X;  1YIT N;  3A5O C;  3CD6 N;  3NH1 A;  4DLG A;  1BQN A;  4CZM A;  4CF9 A;  2E2P A;  5KPR A;  4N5S A;  4JS4 A;  4O0I A;  4CES A;  1ILY A;  4DR3 K;  3VQB A;  3ZT1 A;  1T03 A;  4JKD A;  5F0X A;  2OPS A;  3S3N A;  4WFN L;  4ISE A;  4FWS A;  2HHS A;  1REV A;  3IDH A;  4CJ5 A;  1C0T A;  1Z26 A;  1NGC A;  3MXM A;  3OY9 A;  4K41 A;  3AA2 A;  3D7E O;  3OVN A;  3THW B;  2KFN A;  2QWO A;  3P4I A;  3VQD A;  4KRF A;  2YHX A;  1WSF A;  4BGB A;  1MU2 A;  2D0O A;  4BC4 A;  5HL7 L;  2QW9 A;  2O4G A;  3CCM N;  3QFP A;  4JS5 A;  3VGK A;  5T7B A;  2YJF A;  3K58 A;  2PAV A;  5KRS A;  4H4M A;  4BAC A;  1HPM A;  3KWI A;  3KTQ A;  4KTW A;  3FZH A;  4A61 A;  3BZK A;  3M3Z A;  3S3M A;  3QLH A;  1NWK A;  4DF4 A;  3KVG A;  3E1Y A;  2W40 A;  4W5T A;  1VSL A;  3SQ2 A;  4BRK A;  2VGN A;  2JGU A;  4OKE A;  3NBP A;  5AQF A;  4HUG A;  1RNH A;  3OA9 A;  1XC9 A;  3OYL A;  1I3A A;  1BO5 O;  1RT4 A;  1QHA A;  3J80 O;  3TTD A;  1QQN A;  4LFC K;  4JD2 B;  3Q7B A;  1M90 O;  3QEV A;  3H08 A;  1DEJ A;  1U4B A;  1Q81 O;  4EAH D;  4YOT A;  4RTF D;  4X64 K;  3LP2 A;  4WQ5 A;  1C1C A;  4BRE A;  3ZSW A;  3WQU A;  1TK5 A;  4B1Z A;  5KRT A;  4FJX A;  4M3Z A;  4YDU C;  3LDS A;  3LP0 A;  4NYF A;  3CCL N;  2FSK A;  4DQP A;  1IO2 A;  4EZ9 A;  3AO5 A;  4B1W B;  3M5R A;  3B6P A;  4DS4 A;  3OHR A;  1EKE A;  4OO1 J;  3EZ5 A;  5AQV A;  4J2A A;  3IAY A;  4YY3 K;  5C12 A;  1TL3 A;  3SZ2 A;  3CXC M;  4K8Z A;  3M8Q A;  5J1E A;  1CZA N;  1YXQ A;  3G4S N;  2HVI A;  1MA9 B;  3AVK A;  4YNQ A;  3VEO A;  3U4L A;  3NMU A;  1R0A A;  3WXI A;  3ZT4 A;  2I7P A;  3IMX A;  1IKW A;  5H1S Q;  5DM7 L;  1KFD A;  3KD5 E;  2FBX A;  4DSF A;  2GTD A;  4Y1D A;  3GDQ A;  3IUC A;  2QKK A;  4FVU A;  1VQ9 N;  4QAG A;  1WB9 A;  1FKP A;  1K6Y A;  1NOY A;  3VPZ A;  4OX9 K;  4H0O A;  4IEE A;  4RW8 A;  5AQU A;  3J7Z O;  3VER A;  3WXM B;  2R7Y A;  3WEE A;  1LWE A;  2BUP A;  5E26 A;  3K5L A;  4I6M B;  4GKK K;  1JLQ A;  4CJQ A;  5IT9 O;  1YT3 A;  3KK1 A;  3C7N A;  4C8K A;  2V7Z A;  1KCF A;  2HMP A;  3C94 A;  4DMN A;  3BDP A;  5ELZ A;  1XUP O;  1LCU A;  4KAZ A;  3KZB A;  3QBX A;  4OGE A;  3ZX3 A;  3PX4 A;  4DCH A;  1WSI A;  2HF4 A;  2ETJ A;  5AQI A;  3P31 A;  2NUB A;  3W0L A;  3TSU A;  4C8O A;  4WF9 L;  3MEG A;  2P5G A;  3F9M A;  4C1N I;  1F21 A;  3E9L A;  3ENO A;  4H03 B;  3HXM A;  1J54 A;  4KFB A;  1FXX A;  1LOT B;  4AHR A;  3SPZ A;  4FJN A;  4RWT A;  2IVN A;  4DV4 K;  3G6E N;  3ATV A;  5M1O A;  2E2N A;  2FSJ A;  4DFJ A;  1NKB A;  2A5X A;  1RTD A;  4I9L A;  1TKT A;  2HOE A;  4CEF A;  3MXI A;  1W2B M;  1NMN A;  5BPL A;  1ZBL A;  3NF6 A;  4IXC A;  1XHX A;  4FWR A;  1VQM N;  2PZS A;  1M1K O;  2HBL A;  2E4L A;  1VSI A;  3SUN A;  3KLE A;  2O8B A;  2EHG A;  3BY5 A;  4CBX A;  2JWL A;  3UE5 A;  1J6Z A;  3M8S A;  4CFA A;  3LM2 A;  3K59 A;  1JLB A;  5C24 A;  2FBT A;  4FSV A;  1S6P A;  2W6L A;  4CGJ A;  1WSJ A;  4WQ4 A;  4OPH A;  4MFB A;  4AHU A;  4BRG A;  3V9W A;  1HKG A;  4FOI A;  4WQ5 C;  1E4G T;  4CEA A;  4FW1 A;  3CF5 L;  4CEE A;  4Q0B A;  5GAG P;  4XH1 A;  3CPE A;  1WLJ A;  3NE6 A;  3DXK A;  4FLZ A;  1NKE A;  4PHT X;  4KV8 A;  3OYB A;  1NKC A;  3QIN A;  2QI2 A;  4ELT A;  4LY7 A;  2P9L A;  4HCC A;  3OYM A;  1BA0 A;  1VQ5 N;  4PWD A;  4ZTF A;  3FFI A;  4CVN E;  1ZBF A;  3MMV A;  1VRU A;  2GWK A;  2XHB A;  5LMN K;  5AFU A;  1SL2 A;  3VQC A;  1JXE A;  1NGA A;  3SUO A;  2GEM A;  4DB3 A;  5CHI A;  1X9S A;  4CHY A;  2A1R A;  3GL1 A;  4FJ7 A;  4DQR A;  1B9F A;  3OTO K;  4QS8 A;  2PBD A;  1LV5 A;  1X1P A;  2EWS A;  4WFA L;  2WC9 A;  3V6D A;  4PUO A;  2NRZ A;  4B8C A;  1SL0 A;  5J2M A;  3O3F A;  3C65 A;  2ZF5 O;  3LPU A;  3E9O A;  3C95 A;  1S9G A;  2RF2 A;  3MWT A;  2CH5 A;  2RE2 A;  2VG7 A;  2RPI A;  1I94 K;  4N56 A;  3IRX A;  3ZSQ A;  2O8E B;  1VSD A;  4KH4 A;  4W5R A;  2BGG A;  4IZ9 A;  2PFU A;  4BQL A;  1GOA A;  5JVG L;  3H6E A;  4JYA K;  3BEX A;  4DWI A;  2UYT A;  2O8B B;  4B9L A;  4KB1 A;  5AQM A;  3UKR A;  1J5E K;  4Z0U A;  3E9P A;  5C0Y A;  4QS7 A;  3I56 N;  2UUC K;  1BIS A;  2D4W A;  3LAL A;  2IIR A;  3LDP A;  1YUW A;  1IH7 A;  3EE9 A;  3UIQ A;  1QS4 A;  1BCM A;  4F3T A;  2QM1 A;  1WNS A;  1OVY A;  4AHT A;  4XH5 A;  3OYN A;  3HPH A;  1DLO A;  3OYE A;  2E6L A;  3VQ7 A;  5HRP A;  3U8X A;  3R1X A;  1S3X A;  1RDW X;  1QQO A;  2LSN A;  3S41 A;  5AQX A;  2QXF A;  3QIC A;  1YIJ N;  3QIP A;  1N6Q A;  1VQK N;  4FO0 A;  3F73 A;  3DXM B;  3G25 A;  1YHQ N;  4JHD A;  2G8I A;  3KK3 A;  4CD1 A;  3ZLJ A;  1VSJ A;  1QSY A;  5KQD A;  3ZX0 A;  4DUY K;  3AO3 A;  1RT3 A;  1G99 A;  4NCG A;  3N4Q A;  1BI4 B;  4CBU A;  4BRM A;  1ZBU A;  4B3T K;  5AQW A;  4FLY A;  1GLA G;  3ZSY A;  3PSF A;  1IBL K;  1T3V A;  3H3O B;  5C10 A;  2HHU A;  2YKN A;  1C0G A;  4DV5 K;  4KO0 A;  3VF6 A;  2XO7 A;  2XY7 A;  1FK9 A;  4ELV A;  2OPR A;  3EKU A;  3F9K A;  4B1U B;  2UU9 K;  1UOC A;  4AM7 A;  3KKR A;  2ZJQ L;  4CFB A;  4KHQ A;  3I55 N;  4DUZ K;  4CEB A;  4ISF A;  4NLB A;  4E1J A;  1NGG A;  2OZS A;  1JLG A;  1K8K B;  3RSE A;  3SBG A;  4FLV A;  1X9J A;  4XEI A;  3ALY A;  4CF8 A;  3AVB A;  3J7Y P;  1KD1 O;  1TUU A;  4BRN A;  4PY5 A;  2DTU A;  3DLK A;  2FC0 A;  2A42 A;  4CZF A;  1RT6 A;  3H46 O;  2P51 A;  4DV7 K;  1IJJ A;  1VAZ A;  4FWK A;  4U67 L;  5MLC Q;  1WAF A;  3RWU A;  4CHO A;  3ZSX A;  2PYL A;  3VF2 A;  1NNE A;  1SS6 A;  4C8M A;  2F9W A;  1NOZ A;  3AVH A;  1TYQ A;  4GV3 A;  3BP8 A;  2W6K A;  4CW7 B;  4JK9 A;  3VTI A;  3ULD A;  2F9T A;  3ATU A;  2FF3 B;  4OPJ A;  3LZI A;  3VGM A;  1HUX A;  1JCF A;  4FJ8 A;  3VEN A;  4GKJ K;  3R6M A;  4RCH A;  4JHD B;  5BRD A;  3OYG A;  2OPQ A;  1IKX A;  5SZT A;  4HUE A;  2H3G X;  5AQQ A;  1ITG A;  1WUA A;  4FLW A;  4KBO A;  1IV0 A;  3KIO A;  3H3N O;  1NGJ A;  4IOA L;  2WON A;  1GLJ O;  4E7H A;  4N41 A;  5JS2 A;  1YTA A;  4FZZ A;  2O8F A;  3OJU A;  2YJE A;  3D0P A;  3T1Y K;  4MLE A;  3ID6 A;  1XMQ K;  4JD2 A;  4CFD A;  4DSL A;  1EQY A;  5AQK A;  1JLA A;  3UB5 A;  1EP4 A;  4NB4 A;  4BRL A;  4E7K A;  2IC3 A;  4CHN A;  1RIL A;  5I3U A;  3SBT A;  4CK1 A;  4CD3 A;  4ID1 A;  4A57 A;  3QFU A;  3RRG A;  2XY8 A;  3VES A;  2QWN A;  3DOK A;  2NRW A;  3I33 A;  3K9J A;  1KSP A;  3KHY A;  4IDH A;  4BRF A;  5SWM A;  3N4P A;  4DTO A;  4I2P A;  1LW2 A;  3AVL A;  3E01 A;  2OZM A;  3CET A;  5FPD A;  4LF9 K;  4AHV A;  3QB0 A;  4CJL A;  1KQS M;  4B3R K;  4A59 A;  4EHT A;  5KGW A;  1L3U A;  1KAX A;  3P39 A;  4DTR A;  1BUP A;  2W41 A;  4I7F A;  2DFF A;  3CPW M;  4JI5 K;  3OYD A;  2YHY A;  1I39 A;  2VQE K;  3H1Q A;  4BWM A;  1WAJ A;  2KKZ A;  4A62 A;  4CEO A;  3ZEU B;  4FJ9 A;  3V9S A;  1NGH A;  3LP3 A;  2IGI A;  5HRN A;  1QVF M;  3CJB A;  4FJH A;  1RGI A;  1RDB A;  3ZSZ A;  3RR7 A;  3THV A;  1W9H A;  1TVR A;  4NLC A;  2FF6 A;  3NF7 A;  3HJF A;  2E20 A;  3U3G A;  3CER A;  1NGF A;  2HST A;  4DR4 K;  1GLD G;  2P9N B;  2HBK A;  3WNG A;  1TKX A;  1HNX K;  3O08 A;  1BCO A;  4H5N A;  3T3F A;  2B6A A;  1RT5 A;  3O1B A;  2CGJ A;  5C2F A;  1BGX T;  4IEI A;  1TKD A;  3DMJ A;  1NK6 A;  3AVF A;  5KI6 A;  2A40 A;  3VEW A;  4I6M A;  2E2O A;  3MN6 A;  1XC3 A;  3C7N B;  5AQN A;  1RDU A;  1OH6 A;  4F2S A;  2O8D B;  1V4T A;  2VYP A;  4FK0 A;  4B1V A;  2ZJR L;  1UA1 A;  3HZ6 A;  1S72 N;  1Y97 A;  2OA8 A;  4FWQ A;  1YJN N;  2DPN A;  3LDO A;  4JK8 A;  5BRF A;  3BF1 A;  1HKC A;  4CFC A;  4DR2 K;  3VN5 A;  4JKH A;  4DFP A;  4M41 A;  2F8S A;  3V1R A;  4DV6 K;  4RW7 A;  2E8A A;  2WBN A;  1KRP A;  1IG9 A;  2QWL A;  4FWO A;  1HR0 K;  4Y1C A;  3SMS A;  4CGG A;  3K5N A;  2Q0U A;  1NJX A;  3ZYY X;  2IAJ A;  4JI4 K;  3A2F A;  2YNH A;  1HMV A;  4DKW A;  2D0B A;  4M45 A;  3OYA A;  4B9U A;  5HOO A;  4Z4F A;  2Y1I A;  3M8R A;  1ATN A;  2FBV A;  3V1Q A;  3MED A;  1NU0 A;  4GMJ B;  3IS9 A;  4NXM K;  4LF6 K;  1KAZ A;  4V19 S;  2DY4 A;  1JLF A;  3HP9 A;  3JXU A;  5JS1 A;  4BDZ A;  4FK4 A;  4CHP A;  3OYJ A;  3O6W A;  1O1W A;  4BC3 A;  2ASO A;  1HNI A;  1QHT A;  4UY8 O;  4YFU A;  3HP6 A;  2VCP A;  3JYT A;  3DLR A;  4FZY A;  3OYK A;  3SAH A;  3RMA A;  3CC7 N;  2HHQ A;  1Y64 A;  1FW6 A;  3L0Q A;  3MN7 A;  1L5U A;  3VQQ A;  4C23 A;  4B9V A;  1SKW A;  1JLC A;  4B3M K;  2CH6 A;  4DQI A;  1WN7 A;  4JK7 A;  4DTP A;  4GY2 B;  1HKB A;  4IWV A;  4JAX A;  3DLL L;  1U2V B;  4YOR A;  4KH6 A;  4CI6 A;  2A3Z A;  3NFA A;  3TPQ A;  4UQG A;  5D3G A;  3DXK B;  3NF8 A;  4G9Z A;  4X62 K;  2I7N A;  2WTU A;  3WXJ A;  3GBT A;  2O8D A;  1Z25 A;  3DOL A;  4BRI A;  4CED A;  4RW9 A;  4JLH A;  2GV9 A;  4BRC A;  4B1X B;  2P9L B;  2RKI A;  5AFU H;  3I8B A;  3D45 A;  5EU7 A;  3L4Q A;  2FBY A;  3KLH A;  2ITM A;  3FLC O;  2ZM6 K;  3VET A;  5GIN A;  4BE2 A;  3M6G A;  3A5M C;  4GV9 A;  2F7T A;  1KVC A;  2ZE2 A;  4IG3 A;  1ZBI A;  4X65 K;  4M3T A;  3O9U A;  4CZG A;  2AJQ A;  3FFK B;  3SI6 A;  4B9Q A;  3QNN A;  4BRO A;  5BN8 A;  3HST B;  1HRH A;  1C1B A;  1DT9 A;  3OS1 A;  3WXK A;  5HP1 A;  4YOY A;  3D2E B;  4G1Q A;  4H5R A;  4CK2 A;  1QSL A;  2F8T A;  1WBD A;  3L3V A;  1KTQ A;  3CCS N;  3NH2 A;  3ID8 A;  3WEE B;  2NZT A;  4DSE A;  4OVL A;  1EWQ A;  2B5J A;  4CZJ A;  4MDA A;  4M3R A;  2KZZ A;  4H0P A;  1VQP N;  1S22 A;  4C8N A;  2NRT A;  4PA1 A;  2P9K A;  4KPY A;  5JLH A;  3CMA N;  4M3U A;  2D0A A;  3C6U A;  3ITH A;  1FJG K;  4FJJ A;  4FLT A;  4FJL A;  4FPB A;  4MO4 A;  2NRH A;  1Q7Y O;  3J8A A;  4O4G A;  3B8A X;  2OCE A;  4ZHR A;  4FJM A;  4IJN A;  1GLF O;  3M8P A;  5AQL A;  1TUY A;  3ZCM A;  4JI8 K;  1N8R O;  1J53 A;  3CCJ N;  1Q8I A;  3W3D A;  3WUH A;  1SUQ A;  4F4K A;  1S9E A;  3C6A A;  3VQA A;  5I9E B;  5ADX H;  3VGL A;  3HOT A;  3CQ8 A;  3MAQ A;  4B9T A;  3LP1 A;  5CYQ A;  5AQY A;  4EIA A;  3IG1 A;  3TAG A;  1OH5 A;  1L3V A;  4L3Q A;  2Q0R A;  2GEL A;  4B3O A;  3CQY A;  3DAW A;  4LFB K;  3O4N A;  3QML A;  4DR1 K;  4O55 A;  1VSE A;  1ASU A;  4C1N K;  1VHX A;  2Z1H A;  3TSP A;  3L2V A;  3QES A;  1NK4 A;  3C6H A;  3C0B A;  2HW3 A;  4E1N A;  2Q97 A;  4JI1 K;  4CIE A;  1JL2 A;  4H0V B;  4M3X A;  2E1Y A;  4EP5 A;  3P5J A;  2ZWH A;  4E19 A;  4AF1 A;  3SUP A;  5KGX A;  4CEQ A;  3MXJ A;  4QS9 A;  3D2E A;  3RTV A;  5EOY A;  1P90 A;  3BZC A;  4CJW A;  2G8K A;  1O13 A;  1NK8 A;  3VEZ A;  5I42 A;  1YJ9 N;  4CCH A;  5DK5 A;  2IOC A;  1W7A A;  1XMO K;  1X3N A;  1BU6 O;  4IFV A;  3TSQ A;  2BTF A;  5KQ8 A;  4LF8 K;  1Q18 A;  4CZL A;  3AGK A;  3FE1 A;  1K8K A;  3RSE B;  3TR8 A;  4O8K A;  3QO9 A;  5FDL A;  4B3S K;  1KLN A;  3OJS A;  3VMF B;  2HHW A;  3T19 A;  2G8H A;  2HNY A;  3A5L C;  5HRO A;  1QZ6 A;  4PL7 A;  3PLA A;  4BE0 A;  1G15 A;  3GOI A;  4RW4 A;  1VQ7 N;  4ILJ A;  3HSC A;  3AVC A;  4IBN A;  1Q82 O;  5LL6 Z;  4BG8 A;  1U49 A;  3KKS A;  4DTN A;  2E1Z A;  2HBJ A;  2YV0 X;  5C2D A;  1IBK K;  3DM2 A;  3LDL A;  4A2B A;  3KLG A;  1HYZ A;  4OKK A;  2ZD1 A;  3AVI A;  4DG1 A;  4DQS A;  1NM1 A;  4JN4 A;  3LWM A;  3SAG A;  3KLF A;  4J2B A;  2ZGY A;  5GAE P;  4BRQ A;  2YKM A;  1EWR A;  3F5T A;  4KH5 A;  3HPO A;  2X78 A;  1RCH A;  1HNW K;  4GV6 A;  3LM9 A;  4QOZ B;  3TAF A;  1S1X A;  4FJ5 A;  1T6D A;  1N33 K;  3HI0 A;  4KKO A;  2ASP A;  3AA3 A;  4NXN K;  1ZYQ A;  1BIU A;  4LFA K;  4JNE A;  1VK0 A;  4IFE A;  4KHW A;  1D4X A;  1LWF A;  3RMC A;  4FXD A;  3F2K A;  4HUF A;  4BDY A;  3DJC A;  2Q31 A;  1RBT A;  2JLE A;  1MWM A;  3P1G A;  3VEY A;  1Q9Y A;  4CIG A;  3UKR B;  2VQF K;  3FZL A;  2W42 A;  1YI2 N;  5CZ1 A;  1RT7 A;  1A5W A;  5M1P A;  1EXQ A;  1D9F A;  4YOX A;  3NH0 A;  2GUP A;  4CJR A;  4FWM A;  4JI3 K;  5JMV A;  4JI7 K;  3VA3 A;  4E7J A;  4E7L A;  1NK7 A;  2O4I A;  5M1N A;  4LH5 A;  2VG5 A;  3SYZ A;  3CFO A;  4JKB A;  1MWK A;  4B1Y B;  2IDO A;  1UWB A;  3CFP A;  1XI1 A;  1K8A O;  3AO2 A;  2QWP A;  4IJA A;  3AVJ A;  1QE1 A;  4AIL C;  2QEX N;  3SPY A;  3VQ6 A;  1L3S A;  3GE1 A;  3KK2 A;  1X3M A;  3L2W A;  3VQ9 A;  1RDD A;  2UXD K;  4DSJ A;  4F2R A;  4BGA A;  1ZC6 A;  3TWH A;  3NGI A;  4BQZ A;  4CK3 A;  4Z4G A;  5HBM A;  4BG9 A;  3CME N;  3EEQ A;  1A5X A;  3RVC A;  2WUS A;  1TK0 A;  3DLE A;  1J9A A;  1VQ6 N;  4FOE A;  3VQP A;  4CJT A;  1Q86 O;  3QEP A;  1BI4 A;  1EET A;  3NVK A;  4IDK A;  1T7P A;  2KTQ A;  3WT0 A;  4KHS A;  1YVN A;  2E2Q A;  5CYM A;  3CCR N;  3LZJ A;  3I0R A;  1TL1 A;  4JKF A;  2QKB A;  3U9Z A;  3S9H A;  3HVT A;  3L8B A;  4WYB A;  4MQ3 A;  4GW6 A;  3A5N C;  3KJV A;  4CJK A;  3V4I A;  4HVJ A;  1JL1 A;  4DFK A;  1WBB A;  2P9N A;  3R3L A;  4CF2 A;  5KPZ A;  4FJI A;  2QXL A;  3NVM A;  4H5V A;  1CLQ A;  4J8F A;  1HQU A;  4LH4 A;  2V51 B;  3EL2 A;  3O3G A;  2YX6 A;  4NYN A;  2OPP A;  4X66 K;  4DTU A;  2G8U A;  2X6S A;  3HOS A;  4ILH A;  2OTL N;  3D2F B;  2YNG A;  3LDQ A;  4K25 A;  4CHZ A;  4BY9 C;  3LL3 A;  1BA1 A;  2FLO A;  4IOC L;  3H45 C;  3L2R A;  3DYA A;  1BHL A;  1HPZ A;  4CJP A;  1TYQ B;  3MCA B;  1GLL O;  1BDG A;  5B8H A;  4MDB A;  3SQ4 A;  4RG8 A;  4FCY A;  4YDU A;  4GNI A;  4CER A;  4BR2 A;  5CY4 A;  3LDN A;  1NJZ A;  2D0C A;  1N32 K;  5BPM A;  5CZ2 A;  4BVP A;  4LSL A;  1WSG A;  3J81 O;  3ULE A;  2YNI A;  2OYQ A;  3VF4 A;  2P9P B;  3ZSR A;  3CJA A;  3MX5 A;  3HK2 A;  1BOT O;  2A1S A;  1JXB A;  2HBM A;  2VWB A;  3AVG A;  5FPE A;  4M42 A;  4DQ8 A;  2HHV A;  2D1K A;  3PX6 A;  3CJC A;  3TAB A;  4FLU A;  2OAN A;  1U04 A;  2Y1J A;  2KW4 A;  3JS6 A;  1V4S A;  5C42 A;  4FPA A;  2E5L K;  3O3H A;  3G10 A;  4DV2 K;  3SCX A;  4CGD A;  3THX B;  4A5B A;  1TGO A;  3TTC A;  3MN5 A;  1LAV A;  2Q36 A;  2QWQ A;  5J2P A;  3UKU A;  4CGH A;  5CE3 A;  3SJH A;  4KHP K;  2CGL A;  3J7A P;  2F4V K;  3QIO A;  5GAH P;  1TAQ A;  4CJS A;  2Z1J A;  3PV8 A;  1KXP A;  1KLM A;  1RFQ A;  5AQJ A;  4JRP A;  2UUB K;  3PIO L;  1IKY A;  1VRT A;  4E1M A;  3SNN A;  1S1W A;  4YOU A;  5LMU K;  4YOW A;  3WNE A;  3TTF A;  5AQZ A; 
#chains in the Genus database with same CATH homology
 4CEA A;  4FW1 A;  4CEE A;  4B9S A;  4Q0B A;  4O44 A;  3G0Z A;  4CF1 A;  2HND A;  2YNF A;  3V9X A;  3NFA A;  1WLJ A;  4UQG A;  2XRI A;  3NE6 A;  1X9M A;  4AH9 A;  4FLZ A;  4E0D A;  4K8X A;  5D3G A;  4OLA A;  3NF8 A;  1A5V A;  2EX3 A;  3KD1 E;  1Z25 A;  3DOL A;  1NKE A;  3CM5 A;  4CED A;  4KV8 A;  4CEC A;  3OYB A;  4RW9 A;  1NK5 A;  3KLI A;  3QIN A;  4JLH A;  3B6O A;  1NKC A;  3RRH A;  4QCL A;  4KHN A;  4ELT A;  2GV9 A;  1RDA A;  1TKZ A;  4LY7 A;  2KFZ A;  1U45 A;  3C6T A;  4HCC A;  3OYM A;  4O5B A;  4DTJ A;  3PY8 A;  2X74 A;  4PWD A;  4ZTF A;  2RKI A;  3FFI A;  3LAK A;  2XY5 A;  1QTM A;  1ZBF A;  4IFY A;  4CGF A;  1VRU A;  3D45 A;  2XHB A;  5EU7 A;  4NCB A;  2HNZ A;  2FBY A;  4B08 A;  3KLH A;  3OYF A;  1SL2 A;  3VQC A;  1JXE A;  1YVU A;  5FRO A;  3SUO A;  4F8R A;  4Q5V A;  3ZT2 A;  1CXQ A;  4BE2 A;  1X9S A;  2I5J A;  4OPK A;  2BAN A;  2VWK A;  3AO1 A;  3ASM A;  4OJR A;  4FM1 A;  3NGY A;  4CHY A;  3SV3 A;  2XY6 A;  3RMB A;  1KVC A;  2ZE2 A;  4IG3 A;  4LD0 A;  2A1R A;  1ASV A;  4FJ7 A;  4FVM A;  4M3T A;  4DQR A;  1ZBI A;  2AJQ A;  1B9F A;  3DLG A;  3SI6 A;  3QNN A;  3TAM A;  4HTU A;  4CHQ A;  1ZBH A;  3HL8 A;  3HST B;  1HRH A;  1C1B A;  1X1P A;  1LV5 A;  1VSM A;  3OS1 A;  1KVA A;  4FM0 A;  3V6D A;  5FRM A;  2HHT A;  5HP1 A;  3OYH A;  2B4J A;  3QER A;  4PUO A;  3L2U A;  3PO5 A;  4B8C A;  2GBZ A;  2HB5 A;  4G1Q A;  3WNH A;  3K2P A;  1SL0 A;  5J2M A;  3O3F A;  4J2D A;  4CK2 A;  1ASW A;  1QSL A;  2F8T A;  2VWJ A;  3VQ5 A;  3LPU A;  1VSF A;  4CE9 A;  4ID5 A;  1GOC A;  3L3V A;  1KTQ A;  3C95 A;  1RBU A;  4ICL A;  1S9G A;  2RF2 A;  1TV6 A;  3NH2 A;  3OYI A;  3OYC A;  2VG7 A;  4DLE A;  4I9Q A;  2RPI A;  4DSE A;  1IKV A;  4N56 A;  3DI6 A;  4OVL A;  4OGC A;  2B5J A;  1JKH A;  3IRX A;  3ZSQ A;  1VSD A;  3CFR A;  3DLB A;  4M3R A;  4W5R A;  4KB0 A;  4KRE A;  4W5Q A;  1XHZ A;  2BGG A;  3NDK A;  1GOA A;  5HLF A;  2KZZ A;  4NCA A;  1CXU A;  4BWJ A;  3PUF A;  4C8N A;  4PA1 A;  4KPY A;  4DWI A;  4M3U A;  4KTQ A;  4B9L A;  1RBR A;  4N47 A;  4KB1 A;  2VG6 A;  4EP4 A;  2D0A A;  3C6U A;  3LPT A;  3ITH A;  1UA0 A;  2F96 A;  4FJJ A;  4Z0U A;  4FLT A;  4FJL A;  2ZQB A;  3DRS A;  4J2E A;  1BIS A;  3T1A A;  1N5Y A;  1YTU A;  2D5R A;  3LAL A;  4E7I A;  4O4G A;  4O0J A;  1IH7 A;  4ZHR A;  4FJM A;  2YHA A;  4FLX A;  3UIQ A;  4FYD A;  1QS4 A;  3M8P A;  1BCM A;  2G8W A;  4F3T A;  1UAX A;  3ZCM A;  1J53 A;  1WNS A;  1U47 A;  1Q8I A;  1X9W A;  1SUQ A;  4AHT A;  3OYN A;  4F4K A;  3HPH A;  3LWL A;  3U6F A;  1DLO A;  1S9E A;  3VQA A;  3OYE A;  2E6L A;  3P83 D;  3VQ7 A;  1BL3 A;  3QET A;  5HRP A;  1RBV A;  1S1V A;  2WOM A;  2YHB A;  3CQ8 A;  1LW0 A;  5HRS A;  3MAQ A;  3DRR A;  4CF0 A;  2HVH A;  2IS3 A;  4W5O A;  4B9T A;  4W5N A;  3LP1 A;  2LSN A;  5CYQ A;  1S6Q A;  2QXF A;  1HYS A;  3PX0 A;  4FM2 A;  1D5A A;  1WSE A;  3QIP A;  1N6Q A;  3IG1 A;  3TAG A;  4B9N A;  1L3V A;  4CJ3 A;  3LAM A;  3F73 A;  4B3O A;  3I8D A;  4CJV A;  3LAN A;  4DTS A;  3O4N A;  3QEI A;  4O55 A;  1VSE A;  2Z1G A;  4Z4E A;  2G8I A;  2P5O A;  3KK3 A;  1ASU A;  3V9Z A;  4Z4H A;  5J2Q A;  1BIZ A;  1VSJ A;  2E6M A;  3L2Q A;  2Z1H A;  1QSY A;  3L2V A;  4FW2 A;  4I2Q A;  3OS2 A;  3QES A;  4CIF A;  1NK4 A;  1U48 A;  2QK9 A;  3AO3 A;  1RT3 A;  2G8F A;  1B9D A;  4TSX A;  4NCG A;  2HW3 A;  4E1N A;  1VSK A;  4CIE A;  4OLB A;  1BI4 B;  1QQC A;  1JL2 A;  4CJF A;  3EY1 A;  4M3X A;  3K5M A;  3TAE A;  1D9D A;  4EP5 A;  1ZBU A;  3P5J A;  4DTM A;  4B8A B;  4E19 A;  4R5P A;  4FLY A;  3JSM A;  3SUP A;  1RTJ A;  3ZSY A;  1S5J A;  5KGX A;  3MXJ A;  4CEQ A;  3QEX A;  3RTV A;  1W0H A;  3O4Q A;  4E3S A;  4FK2 A;  1HQE A;  2PY5 A;  4N76 A;  3DRP A;  3U3Y A;  3HO1 A;  2YKN A;  1CZB A;  1T05 A;  2HHU A;  3ISN C;  4CJW A;  4DU4 A;  2G8K A;  4KO0 A;  2XY7 A;  2XO7 A;  1FK9 A;  3TAQ A;  2OPR A;  3F9K A;  3NCI A;  5I42 A;  1NK8 A;  1UOC A;  4CCH A;  2BDP A;  5DK5 A;  2IOC A;  2RN2 A;  1RTH A;  3KKR A;  2G8V A;  1TAU A;  4KHQ A;  5HRR A;  4CFB A;  4LSN A;  4IFV A;  1KFS A;  5C25 A;  3AA5 X;  4CEB A;  2P1J A;  2OZS A;  3NH1 A;  4DLG A;  3TAR A;  1JLG A;  4DSK A;  3TR8 A;  4FLV A;  3QO9 A;  5FDL A;  3ALY A;  3CM6 A;  1KLN A;  1S1U A;  3OJS A;  1BQN A;  3AVB A;  4CF8 A;  4PY5 A;  2HHW A;  4CF9 A;  3T19 A;  2G8H A;  3RMD A;  2HNY A;  2DTU A;  3DLK A;  2FC0 A;  3AVN A;  4N5S A;  4JS4 A;  1LWC A;  5HRO A;  4O0I A;  1RT6 A;  4CES A;  2P51 A;  4BE1 A;  3VQB A;  4BE0 A;  1S1T A;  1WAF A;  3ZT1 A;  1T03 A;  3RWU A;  4CHO A;  3ZSX A;  2OPS A;  3S3N A;  1G15 A;  2PYL A;  5DMR A;  4RW4 A;  2HHS A;  1REV A;  4CJ5 A;  4C8M A;  1C0T A;  3HYF A;  1GOB A;  1DTQ A;  3AVC A;  1NOZ A;  4IBN A;  3AVH A;  4FZX C;  4CGI A;  1Z26 A;  3MXM A;  1RDC A;  1U49 A;  3AV9 A;  3OY9 A;  3KKS A;  4DTN A;  2YV0 X;  2ATQ A;  2X6N A;  4HHT A;  1NK0 A;  3AA2 A;  3OVN A;  4AHC A;  3DM2 A;  3ULD A;  2HHX A;  2KFN A;  3VQD A;  3KLG A;  1EX4 A;  4KRF A;  4OPJ A;  1HYZ A;  1WSF A;  3LZI A;  1SV5 A;  4OKK A;  2ZD1 A;  3AVI A;  1MU2 A;  4DG1 A;  2HMI A;  2QKK A;  4FJ8 A;  4DQS A;  2O4G A;  4JS5 A;  3LWM A;  3KLF A;  4J2B A;  3K57 A;  4OKJ A;  2YKM A;  5T7B A;  3K58 A;  3HPO A;  2X78 A;  1T8E A;  4EZ6 A;  1RCH A;  5KRS A;  4QOZ B;  4H4M A;  4BAC A;  3TAF A;  1S1X A;  3KTQ A;  4FJ5 A;  4KI6 A;  4KTW A;  4KKO A;  5FRN A;  1NJY A;  3EYZ A;  3OYG A;  3AA3 A;  4F3O A;  1ZYQ A;  1JLE A;  1BIU A;  4GVM A;  3QLH A;  3S3M A;  3RR8 A;  2OPQ A;  1IKX A;  1VK0 A;  4KHW A;  5SZT A;  1LWF A;  3DLH A;  4FJK A;  4DF4 A;  1RT2 A;  3RMC A;  4W5T A;  4HUE A;  1VSL A;  3SQ2 A;  4FXD A;  4HUF A;  1ITG A;  2KZM A;  4BDY A;  4BDP A;  2JGU A;  4OKE A;  1J5O A;  1RBT A;  2JLE A;  3NBP A;  4HUG A;  4FLW A;  3P1G A;  1Q9Y A;  1RNH A;  3KIO A;  1XC9 A;  3OYL A;  1I3A A;  4CIG A;  3VQE A;  1RT4 A;  2WON A;  4E7H A;  2W42 A;  4CJ4 A;  3L3U A;  5JS2 A;  4N41 A;  5CZ1 A;  4DU3 A;  1RT7 A;  1YTA A;  1A5W A;  4H8K A;  4FZZ A;  4AHS A;  3OJU A;  3D0P A;  1EXQ A;  4DF8 A;  3NH0 A;  3VA0 A;  1D9F A;  4CJR A;  4CFD A;  4DSL A;  1JLA A;  4E7K A;  1EP4 A;  3VA3 A;  4E7J A;  2IC3 A;  3QEV A;  1SKR A;  3H08 A;  4E7L A;  1U4B A;  1NK7 A;  2O4I A;  4LH5 A;  1RIL A;  2VG5 A;  4CHN A;  3SYZ A;  5I3U A;  3CFO A;  3V1O A;  4CK1 A;  4ID1 A;  3TAP A;  1HYV A;  1UWB A;  1XWL A;  2IDO A;  3LP2 A;  3CFP A;  1XI1 A;  3RRG A;  3AO2 A;  2XY8 A;  1FKO A;  1B92 A;  1C1C A;  3ZSW A;  3DOK A;  4DS5 A;  1TK5 A;  1KSP A;  3AVJ A;  1QE1 A;  5KRT A;  4AIL C;  4FJX A;  5SWM A;  3SQ1 A;  3SPY A;  3VQ6 A;  4M3Z A;  1L3S A;  4Z4C A;  3LDS A;  3NF9 A;  4DTO A;  3LP0 A;  1BQM A;  3MEC A;  4I2P A;  4NYF A;  1LW2 A;  4DQP A;  3AVL A;  1IO2 A;  3E01 A;  3KK2 A;  1CZ9 A;  2OZM A;  3L2W A;  3VQ9 A;  1RDD A;  3AO5 A;  4EZ9 A;  4DSJ A;  4F2R A;  3B6P A;  4DS4 A;  4XIU A;  3TWH A;  2Q3S A;  3NGI A;  1EKE A;  3MEE A;  4AHV A;  4CK3 A;  4Z4G A;  4CJU A;  5HBM A;  3EZ5 A;  1TK8 A;  4DU1 A;  3QNO A;  4J2A A;  1A5X A;  4CJL A;  3IAY A;  4H4O A;  5KGW A;  1L3U A;  1TK0 A;  3DLE A;  1TL3 A;  3SZ2 A;  1J9A A;  4K8Z A;  3M8Q A;  4DTR A;  5J1E A;  3ZT3 A;  3NGZ A;  2BE2 A;  2DFF A;  4I7F A;  3VQP A;  3OYD A;  4CJT A;  4ELU A;  2HVI A;  1I39 A;  3AVK A;  4YNQ A;  3QEP A;  4BWM A;  1BI4 A;  1EET A;  2PYJ A;  1NK9 A;  1R0A A;  1WAJ A;  4IDK A;  1T7P A;  4CEO A;  2KTQ A;  3ZSV A;  4KHS A;  3NAE A;  4FJ9 A;  3V9S A;  4FJG A;  3ZT4 A;  1DTT A;  3LP3 A;  5CYM A;  1IKW A;  2IGI A;  5HRN A;  3LZJ A;  3I0R A;  1TL1 A;  3QEW A;  4FJH A;  2QKB A;  3ZSZ A;  1RDB A;  1KFD A;  3RR7 A;  3KD5 E;  3THV A;  1W9H A;  1TVR A;  2FBX A;  3S9H A;  3NF7 A;  3HVT A;  3VQ8 A;  3L8B A;  3SV4 A;  4DSF A;  4MQ3 A;  4Y1D A;  3HJF A;  4GW6 A;  3U3G A;  3KJV A;  1HJR A;  1QSS A;  4CJK A;  3V4I A;  4HVJ A;  3ZT0 A;  1JL1 A;  1C1A A;  2ITG A;  4DFK A;  3AVM A;  4C8L A;  4CF2 A;  3WNG A;  1TKX A;  1C0M A;  4QAG A;  4JRQ A;  4FJI A;  1FKP A;  1K6Y A;  3HT3 A;  1NOY A;  4KHU A;  1VSH A;  4RW8 A;  3OS0 A;  3SJJ A;  1BCO A;  1D8Y A;  1CLQ A;  1HQU A;  4LH4 A;  3T3F A;  2B6A A;  2R7Y A;  1RT5 A;  5J2N A;  1Q9X A;  1C0U A;  1LWE A;  3WNF A;  1BGX T;  1TKD A;  3O3G A;  3DMJ A;  1NK6 A;  3AVF A;  4NYN A;  2OPP A;  5KI6 A;  3K5L A;  4DTU A;  2G8U A;  1JLQ A;  2X6S A;  4CJQ A;  1YT3 A;  3KK1 A;  1RTI A;  4KHY A;  4C8K A;  3AVA A;  2YNG A;  1KCF A;  3C94 A;  4CHZ A;  4DMN A;  1KVB A;  3BDP A;  5KTQ A;  3S3O A;  4E89 A;  4KAZ A;  4F2S A;  3L2R A;  4KTZ A;  4OGE A;  3PX4 A;  3SUQ A;  3NHG A;  4FK0 A;  3DYA A;  1BHL A;  1HPZ A;  1UA1 A;  4M3W A;  3V81 A;  4KI4 A;  1L3T A;  1Y97 A;  4CJP A;  1WSI A;  2OA8 A;  2ETJ A;  3I0S A;  4RW6 A;  2NUB A;  2GUI A;  4DQQ A;  3SQ4 A;  4RG8 A;  3CYM A;  4C8O A;  4B9M A;  3MEG A;  4CFC A;  4FCY A;  4CER A;  2P5G A;  3VN5 A;  5CY4 A;  1F21 A;  4M41 A;  4DFP A;  1RBS A;  1NJZ A;  4M3Y A;  2F8S A;  2D0C A;  3HXM A;  3V1R A;  3BGR A;  4HCB A;  1J54 A;  4KFB A;  1NJW A;  1FXX A;  4AHR A;  3SPZ A;  2DFH A;  4FJN A;  4RW7 A;  4DSI A;  5CZ2 A;  4IKF A;  3ZSO A;  1KRP A;  4LSL A;  1WSG A;  1IG9 A;  4Y1C A;  3VQ4 A;  3TI0 A;  1HNV A;  4CGG A;  4ELV A;  1RT1 A;  3K5N A;  2YNI A;  4DFJ A;  1NKB A;  2OYQ A;  1NJX A;  3ZSR A;  3HK2 A;  4CEZ A;  3PO4 A;  2DFE A;  2A1S A;  1JXB A;  1RTD A;  4I9L A;  1LAW A;  2IAJ A;  3A2F A;  2YNH A;  3AA4 A;  3AVG A;  4M42 A;  1HMV A;  1TKT A;  4CEF A;  3MXI A;  2HHV A;  3PX6 A;  2D0B A;  4M45 A;  3OYA A;  3V9U A;  3TAB A;  4B9U A;  3HPG A;  1ZBL A;  4FLU A;  3NF6 A;  4Z4F A;  2Y1I A;  1XHX A;  1U04 A;  3M8R A;  2Y1J A;  2KW4 A;  3TAN A;  5C42 A;  2FBV A;  3MED A;  4GMJ B;  2KQ2 A;  3V1Q A;  3IS9 A;  3O3H A;  4DTX A;  4ZTJ A;  2PZS A;  4Z4I A;  2DY4 A;  1JLF A;  3G10 A;  3HP9 A;  3HVR A;  3SCX A;  3K5O A;  4IG0 A;  4CGD A;  5JS1 A;  4BDZ A;  1C6V A;  4FK4 A;  1TGO A;  4CHP A;  3OYJ A;  1SL1 A;  2E4L A;  1VSI A;  3AO4 A;  4CJE A;  1LAV A;  1O1W A;  5J2P A;  3KLE A;  3SUN A;  4PQU A;  1HNI A;  1QHT A;  2EHG A;  4CGH A;  5E41 A;  4WE1 A;  4YFU A;  4L8R B;  3SQ0 A;  4DFM A;  2Z1I A;  3HP6 A;  3JYT A;  3QIO A;  3DLR A;  4FZY A;  1TAQ A;  4CJS A;  3M8S A;  2Z1J A;  3OYK A;  3PV8 A;  3RMA A;  2HHQ A;  4CFA A;  3K59 A;  3HM9 A;  1L5U A;  1JLB A;  1KLM A;  5C24 A;  2FBT A;  3VQQ A;  4JRP A;  4B9V A;  1S6P A;  4CGJ A;  1SKS A;  1IKY A;  1WSJ A;  4MFB A;  1JLC A;  4AHU A;  1VRT A;  1SKW A;  4E1M A;  3SNN A;  1S1W A;  1WSH A;  3WNE A;  3V9W A;  1WN7 A;  4DQI A;  4DTP A;  5K14 A;  3CG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...