1BHO1

Mac-1 i domain magnesium complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
189
structure length
189
Chain Sequence
b'SDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD11B
molecule tags Cell adhesion
source organism Homo sapiens
publication title Cation binding to the integrin CD11b I domain and activation model assessment
pubmed doi rcsb
total genus 68
structure length 189
sequence length 189
chains with identical sequence 2
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1bho100
2XWBF 2ICAA 1OAKA 4PN7A 1YVRA 3PPWA 1CQPA 2VDRB 5KYUA 5HJ2A 3F78A 1UEXC 4JDUA 2X5NA 3PPYA 1M10A 1JLMA 3PPXA 3EH1A 3QA3E 1U0OC 2ODPA 3EOAI 1PT6A 1RTKA 3V4PB 1LFAA 4CN9A 4WK0B 4Z7QB 3HXOA 3ZDXB 5BV8A 4HQLA 1M2OA 1MJNA 4WJKB 3FCUB 1YVPA 1JEQB 4HQOA 1M1XB 4CN8A 1N9ZA 1XDDA 3T3MB 4MMYB 3FCSB 1RRKA 4G1MB 3BN3A 2ADFA 2ODQA 3V4VB 1RS0A 2QTVA 1MQ8B 4DMUB 3EG9A 5ES4B 5LN1A 1AO3A 1PD0A 1QCYA 1AUQA 3RAGA 3ZE1B 1U0NA 1XDGA 5E6SA 1SHTX 3VI4B 1PCXA 3EGXB 4UM8B 4WFQA 4Z7OB 1ZOOA 4M76B 2NUTB 1SHUX 3F74A 3K6SB 1PD1A 3EG9B 4WK4B 3K72B 3EH2A 3EFOB 4MMXB 4NEHB 5HGJA 5KYNA 4NENB 4Z7NB 3NIGB 1IJBA 2I91A 1DGQA 1M1UA 5KYYA 1FE8A 2XWJI 4IXDA 3ZDZB 1QC5A 4A0QA 5KYXA 1ZONA 1JEQA 3BQMB 1M2VA 3TW0A 3IBSA 5KYXB 2NUPA 1Q0PA 4UM9D 2I6SA 3NIFB 2WINI 4F1JA 4C29A 4NENA 1ZOPA 3NIDB 3T3PB 1AOXA 1DZIA 4IGIA 3HXQA 4HQFA 2VDMB 3E2MA 3K6SA 2B2XA 2VDLB 4CNBA 2NUTA 5HDBB 3TCXB 1CK4A 1IJKA 1IDN1 1ATZA 4O02B 2VDOB 3M6FA 1JV2B 2NUPB 2IUEA 3GXBA 3IJEB 2O7NA 3ZQKA 4F1KA 5E6SB 3ZE2B 1M2VB 1BHO1 1RD4A 4HQNA 3EGDA 1BHQ1 4IHKA 3TXAA 5E6UB 5KYWB 1IDOA 2VDQB 2M32A 1JEYB 1TYEB 1QC5B 1V7PC 3K71B 4MMZB 5KYYB 4C2AA 4HQKA 4XW2A 5E6RB 1MQAA 2I6QA 2VC2B 3PPVA 5E6RA 2WW8A 3EFOA 4WK2B 1L5GB 3N2NA 4C2BA 4UM9B 1SQ0A 1XUOA 2XGGA 1MQ9A 1T6BY 2VDKB 4G1EB 3BQNB 3HI6A 5E6UA 3VI3B 3EGDB 1JEYA 5KYWA 1MHPA 2NVOA 3ZDYB 3Q3GE 4BJ3A 1U8CB 4FX5A 1N3YA 3EGXA 3TVYA 2VDPB 1FNSA 1T0PA 3EOBI 1MF7A 3ZE0B 2VDNB 1NA5A 5KYUB
chains in the Genus database with same CATH superfamily
3J7TA 3R24A 4CKXA 2XWBF 3B5IA 4PAOA 3URMA 4OHUA 4WCVA 3EVCA 5IK2D 3ZU4A 4R2IA 3PPWA 1N8TA 3EASA 4A8JC 2O2CA 3BXXA 2G88A 1NG9A 3BMOB 2YH2A 4LHEA 3DAGA 3GJZA 3EOAI 1XP8A 2ZCUA 1K7YA 4C3OB 2Z2JA 1NT2A 3UW3A 2NV2B 1WEHA 1WBJB 2ZBEA 1Y6JA 3GUYA 4A15A 4P36A 4DA4A 2FQYA 4U5XA 1NRWA 1P2FA 1UM8A 1TE2A 3VMMA 2FX5A 3SGLA 1C8BA 1Z12A 5CYOA 4P84A 2ZZKA 4RLQA 4B7AA 1TTTA 4MIEA 3V4VB 1MN6A 2OOKA 2W93A 1G0OA 3JD4A 1YBFA 3AZQA 1PR3A 3S0JA 2ATXA 5JI2E 5JZBA 1P62B 2PO5A 1KKUA 1N2EA 2E6KA 2NAFA 4KN5A 4OV6B 5DCUA 3TI9A 4YVFA 1LVHA 2OCIA 5EIAA 3FGOA 1B6TA 4TMYA 3A2KA 4U63A 3R6LA 4RKRA 4C4ZA 1XPUA 4H1UA 1NRJB 3L8CA 3FOZA 1N3IA 1XFDA 3AJAA 3GLTA 3B20A 4FS8A 3ZWOA 1GQRA 2Q8QA 4NCNA 2HXYA 4NCXA 2OT3B 1AKNA 3NBZC 1INLA 3K94A 1D2EA 2CB9A 4CMBA 5HXAA 1DOAA 1FYVA 2WM9B 2Y9PB 4PC3A 1KHHA 4U2CA 4ZDWA 3T54A 1ZM3A 4YUAA 3AUTA 3D2CA 2M2IA 5F73A 2VJOA 5JAHA 1FLNA 1JUDA 3HXLA 3VAYA 2WMNB 4C1NA 1LS1A 2XOEA 1YWGO 3LY5A 2CZQA 3ZDZB 4YJHA 5FWAA 2HH9A 2OCPA 5AVYA 1FVHA 3ETHA 4PO8A 3DMRA 1JXAA 1F6WA 5CEJA 3JAMA 1AGPA 2WABA 1IJFA 3TSYA 2FSFA 4CM8A 4OFWA 4PCAA 4MZXA 4CR8A 1A95A 1QHHB 4DRXB 1WQ1R 1RE0A 4I3FA 1OE0A 3HB5X 1KPIA 3KZNA 4IMRA 3B1KA 4E5UA 7REQB 3QF4A 2JD2A 4UOZA 4G0UA 2HHCA 2F8SA 1M2WA 1GPLA 2O3SA 3JPYA 5I9BA 2B36A 3QUAA 5K2MA 1EBBA 4QNRA 5KCZA 4N5MA 4LY3A 4C0QC 2I62A 1FFSA 2OWDA 3Q1KA 4NMXB 1XPRA 2P5YA 2QBYB 4MLCA 5GINE 2WWVD 4ZJPA 5T41A 4UTPA 2DWQA 2MR5A 4OLHA 3AUSA 4GZLA 3U16A 1EWVA 2FWRA 3BVPA 3GBSA 4RLSA 1F0KA 5LP1A 4JBWA 5A3JA 2WV7A 5IUNC 2FPRA 3V7NA 1A9PA 1PJ3A 3R1IA 1GTJ1 2PGXA 3IPRA 3P1JA 4LPKA 4TMXA 2AE2A 4WBSA 4DOMA 2H1OA 1W7AA 3I72A 1TAQA 1BYUA 3QUBA 3ZZ1A 2LIPA 2IS1A 5B3JC 1RXUA 4G4JA 2ILVA 1ZMOA 1EPUA 1XVIA 4D3ZA 1ZK4A 3GVPA 3N75A 4IHJF 2CV2A 3PPIA 2DF8A 2BFBA 5AK6A 3M3DA 3C24A 1P39A 1U5BA 2G72A 4K6CA 2F64A 3IKMB 4AY2A 2KE5A 3KXLA 5IZCA 1GADO 1VBKA 1N1EA 1B8OA 4D80A 3BWMA 3PTZA 4B79A 2AT1A 3CLRC 3DOFA 3PUWA 2R3SA 1EK1A 3BILA 3EMDA 3RW9A 1DC6A 2DQSA 2X9NA 2Z1MA 4NESA 4UTOA 4LDZA 3RTAA 4EZIA 1NM5A 4B3MB 4Q19A 2H2DA 4L16A 1SEVA 1GJRA 1GRQA 1R0ZA 4UNRA 3JQAA 4TUYB 4WASA 1XMVA 3ETNA 3R7WA 1RXEA 5A7HA 2ZBFA 4AMGA 1PUIA 4YRFA 4OBXA 1JHYA 3O83A 1X1RA 3TZKA 2ZPUA 4FW8A 1YVUA 2ZBPA 3R7FA 3F3SA 1ODLA 3A2LA 3HKCB 3L8YA 4KIWA 1QDEA 4GZ3A 4LY0A 1JA0A 3I1IA 5AKLA 4RKEA 4EW6A 4OHVA 1FDSA 1QK4A 4JJGA 4YB8A 3EGVA 3QV1A 1YRBA 5DNYB 4QBTA 3EMVA 5BW6B 1BS1A 1DV2A 2Y67A 3I6IA 3EAQA 3UF0A 1VL1A 2ZVJA 3X2SA 5LKRA 3FYUA 2SECE 1VDZA 2NSJA 1WXHA 3QA9A 3HPQA 4UUOA 5BV7A 5B6IA 1JWLA 1LPNA 3G6WA 1PW7A 2OHGA 5K3CA 4NDAA 2WAYA 4DDKA 5GTDA 2Z09A 3GFRA 4MB2A 3CEAA 3VYWA 4AYWA 4BB9A 1O95D 3R7NA 2EF1A 1WW3A 3I9KA 2C4WA 3DXZA 4BB6A 5A4MS 1ZUWA 1HG0A 3UGQA 1WO8A 4K03A 2VHVA 4QHYA 4P4TA 1CP3A 5JRDS 1IH8A 1Y6QA 4Q1DA 1C7FA 3WLNA 3N5CA 3P19A 2XDQA 5M5BA 3FUWA 4X1IA 4ZREA 2DJ5A 3OKPA 4R8MA 1P2UA 2QRJA 2CHQA 1CS0B 3SP1A 5D5PA 4EL0A 4JBIA 1LWNA 1KNXA 4HHEA 2JFXA 3NYRA 1XJQA 3O4GA 4UAGA 2ARKA 2PSEA 2TECE 3F4BA 1ZA2A 4Z6KA 2RHRA 4A91A 2CZGA 3VYRB 2EKZA 4KL8S 1YHYA 3HGTA 5CLQA 4OX9B 1RWWA 4DFDA 2WIJA 1MBZA 1QRDA 1KJIA 1G8JA 2I9PA 5JRJA 1Y63A 3R3JA 3ZXSA 2HRZA 3ZKWA 3PA8A 3A70A 2ZDHA 4MI6A 4O02B 3KKQA 4KN8A 1NDUA 2C1ZA 5AM1A 4JXZA 4BWVA 2Q4DA 4B83A 2GN4A 1BG6A 1IHUA 3HUTA 4LN1A 1X87A 3SEFA 2WB4A 4D9BA 2M32A 4HX2A 4E4TA 821PA 3BMCB 1JI0A 2JATA 3MW8A 4Z99A 3MJTA 4X6XA 4J7UA 4KODA 3ZIUA 3LQRA 1DJMA 3O5AA 2OXEA 2Q1XA 1DKPA 3PXBA 4ZJZA 1A5TA 4EYGA 3LMKA 4MYTA 4G25A 3MLBA 1MAWA 2AE1A 4JZYA 1KMCA 4PBSA 3SC2B 2X5XA 2WVHA 1IB0A 2PFKA 5EMLA 1DU4A 4AIIA 4YRMA 4B82A 7MDHA 5AVXA 4QM6A 2A5FA 2CFIA 1PQ4A 5DIFA 1VJCA 4O2AB 4WESB 3UHOA 1Q6YA 5MF6A 2I8CA 1FXUA 1N5RA 1S2IA 4PHHA 2XODA 4N8SA 2ZUTA 4AP6A 2H6EA 3DW3X 3IBFA 3PGA1 4U8HA 4FFBB 3ZXUB 1EIZA 1L3IA 1PZFA 2ZRFA 3GCDA 4FMCF 5F1PA 2J7PA 4FDUA 5CFPA 3MCUA 2DFVA 3V1YA 4ZYZA 1UEXC 2EF0A 4JBYA 1IY1A 3H9BA 5F1OA 1P2TA 3ZYCA 3DHVA 3BWYA 1JJVA 3GARA 3BUSA 2VHUA 3TBFA 3M9WA 2M1XA 4XM1A 4YLGA 2AJTA 3P0FA 4HQ0A 2D0DA 3MK31 3TAHA 1N78A 3B51X 1P5JA 4OJMX 4H3KB 1XFAA 1ZCFA 4ZZIA 5ECDA 4N47A 1W2HA 4B3GA 3ZPXA 4AJLA 3KZVA 3P94A 4MQFA 3FW1A 3Q3IA 4Q5IA 1GUAA 2R8EA 5K0GA 5TV2A 2XYGA 1D5WA 1VL8A 2CNNA 2W83A 2XAUA 4P2BA 3W5UA 4DVJA 3NONA 3FHOA 1OXUA 3FKSD 3OZRA 3NC4A 4H6VA 4UQPA 4LF5B 4F6RB 4EYEA 1JTEA 1CSEE 1TT5B 4PM4A 3GGGA 4JLKA 2IHZA 4IRXA 3RS3A 3IQHX 1XMOB 3COJA 1TA4A 3K70D 3GBPA 1NW4A 1Y7IA 2YHAA 2O57A 1OZHA 3MB5A 4M0DA 4XR9A 3SXUA 3QEBZ 2AFVA 4NH4A 4Y2PA 5K6RA 4DV1B 4RCVA 3KEOA 3TQFA 4EA9A 4NXMB 1EVIA 3HO8A 2PGNA 1YQGA 1Y3DE 3EDCA 2Y0EA 4O25A 1MO2A 2EP7A 5F64A 3DGFC 1EAYA 1GTMA 3TUJC 5IDYA 3UNXA 1M0TA 2LGJA 4LC0A 4WGGA 2CLLB 1J5XA 3ST7A 4ARCA 5FOVA 3IAFA 5D1NA 2FJ0A 3GJRA 2FUCA 2H0RA 1E89A 2O6LA 2F8MA 1HT2E 1Z4IA 4GVLA 2O8FB 3EUEA 3SFTA 3FTEA 3UN1A 4RHTA 2EP8A 5JO0A 2BKLA 1FLAA 3BTSA 1YRQA 2CJFA 3TW4A 3I8OA 3AL3A 4KQGA 1KMIY 1XAGA 4TYNA 4NNPA 1QS0A 2FKAA 1P8AA 3KUKA 2RGBA 3DB2A 3H9QA 3OIVA 1ONPA 4J91A 4ZCMA 3DLBA 2J08A 2H2WA 4C3ZA 1T8PA 5CFNA 1L7OA 3KTAB 4I8XA 2LW7A 2HA4A 2J4CA 5J5VA 3UAVA 2YKGA 1QP0A 1VSQA 3EF0A 2NVBA 4NMLA 4DJFC 3HYSA 1TQ8A 4JX9A 3KKPA 3BGSA 3SBXA 3TE6A 2P4HX 2L17A 4LVCA 1U28C 1U5CA 1JAXA 1H93A 4EI8A 3B1YA 4GMFA 4W7SA 4YCSA 2W90A 2Y2UA 6REQA 3TZQA 2NADA 2X1VA 3QBDA 2ZIXB 4K6MA 2UUCB 1VPLA 1OYWA 3NTLA 2D2VA 2Y77A 1OXXK 2VDJA 3MBKA 3D8NA 1OTYA 1U8CB 4LPSA 3U3ZA 1IBMB 1ZUNA 2C9CA 4I08A 3EVBA 3TCKA 4EG4A 2VPXA 5E38A 2J45A 3N7AA 2RGRA 2Z8XA 3H4IA 3LNTA 3LPDA 4MOWA 1NVVQ 4UXIA 1QHXA 2XUGA 4PYMA 3DOHA 1SXJC 4GPIB 5ILGA 4CGZA 2QTHA 1PJ2A 1E5DA 2RJNA 4ZZ3A 3P97A 4XJTA 3VR6D 3QMWA 2GF9A 1Q57A 4X61A 3B3FA 4BIIA 4ZI7A 5FADA 1UMBB 3CVXA 3T9AA 1I1QB 1KS2A 1KSHA 1NBMA 1U9IC 2DBRA 6AT1A 2JJ1A 4HADA 1KK1A 1M83A 1B0PA 2PN1A 2ZJ5A 4M83A 4RPCA 1YC2A 3GFTA 4YT8A 5CIWA 3QXHA 4EHBA 1BJTA 3HJAA 3P9NA 2DTDA 4Z53A 5G53C 1N9ZA 3C45A 4RABA 1HNWB 2Q99A 3SQLA 1QPZA 4PZEA 4EUNA 2GZ1A 4R9SA 2CEAA 1V4BA 1V3TA 4RD6A 1T15A 4XUCA 1N5JA 3RVLA 4TV8A 3FMIA 5JIBA 4AJ4A 5K4HA 1A96A 1MKYA 3N86A 2HA7A 1I4DD 4DJDC 1Q3KA 1QF9A 4NZ9A 4H0CA 5COAA 1IHDA 4GDMA 5BMOA 3B6ZA 4NK5A 5F52A 2JL1A 4KB5A 4R98A 4TS1A 2LCQA 1YS2X 4I4TF 3GHHA 4ZVRA 3X44A 4C03A 2F00A 3W5CA 3SR0A 4WFQA 4O2BB 3QE4A 1G8AA 3ONNA 4DHEA 2AR9A 2P27A 4TL9A 2I6TA 2O3TA 1XTIA 3TQSA 3RYHA 4ERNA 4C07A 5BQPA 3EG9B 1HLDA 2IW3A 2FG7C 2XNSA 4FCCA 5EZYB 4EL5A 1FSPA 1EWYA 1H94A 4K6GA 1GZDA 3NW9A 2BMDA 5DHSA 1CQIB 3A4YA 3AHIA 3NORA 1PJBA 2GNPA 2WOJA 2TMKA 4GYKA 4NQZA 4ONEA 3BZUA 1JHDA 5AOCA 1ZGGA 3HVIA 2XRZA 3M1IA 4I9GA 1RYYA 1JR2A 4B3FX 3C2QA 2V6JA 4PU0A 2HDWA 4BV8A 3B1JA 3HB9A 1JU9A 2H3HA 2PNJA 4HUTA 2IY8A 4L1KA 4AY4A 1W35A 3OTIA 2PWZA 4QQNA 4JIMA 1RFLA 1WCIB 1HMYA 4WIAA 5ALPA 1AMUA 2ZRQA 1ZR4A 1ZR2A 1KFCB 2CFCA 4EB6B 3TXYA 2VP3A 2ABWA 3AHDA 5BUQA 4MUXA 5IC5A 1KIFA 2QU8A 2V3VA 4YMSA 2BGUA 1JVBA 2XKKA 4KP7A 1EWKA 3PXGA 3T5AA 1Y8ZA 5LQRA 2V96A 4IHJB 2O59A 1YDFA 2JBAA 1O0CA 1MEEA 1UFQA 1QB8A 1QZTA 1XKQA 1XD2A 3KKMA 1K89A 5E3JA 5LYYA 1YZTA 3MG9A 1CUHA 4HDMB 1QYIA 3W8FA 4D9IA 3ZVNA 2XOKA 4O4JA 3I62A 3RFVA 2W2PA 4FOTA 2BAGA 4R1PA 3ESRA 4DG5A 1FFCA 1YAJA 3C4JA 3R6DA 1AC5A 2C96A 3PNQA 1GRNA 1M2FA 3C3DA 3O7MA 4I50B 2QX7A 4JB2A 4LDQA 4TKZA 2B9VA 1ZM4A 1FYFA 5DLYA 1D8TA 2Q9BA 4UKDA 3IT3A 4ZVLA 1KH2A 4IHQA 3NKFA 1UEIA 3AKCA 3NJ8A 3O2SB 1C4WA 4FK8A 4A8JB 2ZUUA 3BGDA 4Q4DA 4Y9SA 4Z8YA 3N2KA 3OI7A 3PDWA 1E98A 5E1MA 1CLUA 2M6LA 1XQYA 3HI6A 3FPAA 4A2WA 2GCPA 1TMKA 1BWPA 2OMEA 3T7RA 4ARAA 4EHJA 2V65A 1VG0B 3V48A 2SKDA 1RC0A 4IJ5A 1NKVA 2D1TA 5D85A 2QZPA 1R27A 3ZJ5A 5KNBA 1BA2A 2ZB7A 3G9ZA 5KVCA 2R5FA 2HJSA 2Z04A 1XU7A 4BNHA 1G7TA 5G0VA 5ICGA 3F78A 2XXAA 3VR4A 4ALIA 1I7PA 4P93A 3AEQA 1WMAA 2GM3A 4KOEC 5EQJB 1KHTA 4BNGA 3FZEA 3BDIA 4XTRA 4EFNA 4P83A 1H2EA 2A84A 2CVOA 3OIUA 4RF3A 4MWZA 1YZFA 3BWEA 3A4VA 4CZ2A 3CUEF 1MFZA 4OB7A 1RJFA 1QIMA 2HHJA 3OF5A 3STXA 1XZLA 4BP9A 1F8UA 5JH7F 2R6HA 3JQAB 4TUYA 1G8KA 1GAQA 4A8TA 3BRCA 1RHKA 7AT1A 3AKYA 1RADA 1TJ4A 2FVYA 2H4YA 5EIFA 4MUNA 1IBRA 5A3RA 3DBHA 2IDKA 3ELYA 5BMVF 5LN1A 2XMCA 4HLDA 5TNXA 4EJ0A 2RC5A 2QR5A 1UFVA 1N3BA 1NVBA 1U0NA 4FC7A 3F8WA 3AWDA 3PGKA 4DQUA 2C2OA 1VOTA 1ORDA 2VSQA 4LHYA 4C7KA 3ZBTA 3ZE8A 4YHHB 2J67A 1FMTA 1FRQA 2VT2A 3FBTA 5JC1A 3GFBA 4AULA 3EEYA 1J8QA 4N5DA 1JFTA 2JHCA 3WGTA 2MDTA 1X14A 2OV4A 4DILA 4P35A 2Q27A 1MTOA 2EJTA 2FSSA 1QIGA 3T6KA 5T6MA 4A8JA 2VJAA 3ZLTA 3IR6A 3LRPA 1E6CA 1R7RA 1SC4A 3T1VA 5KNLA 4B3HA 2JCYA 1U0FA 4XIJA 3UMBA 1QC5A 3KO8A 5AJVB 3A32A 5H83A 3H87A 4IV0A 4LZPA 3GZJA 3HN2A 3ND9A 4AZSA 1GYRA 1D2NA 4WNAA 3EVGA 2C5FA 2FGJA 4I14A 4YCJA 4BNDA 2RGEA 2EFJA 2GZDA 4LV8B 4NABA 2JGRA 4PG6A 4WMLA 2FEAA 2CHEA 4MV6A 2IHNA 5KVAA 5KTKA 1P72A 1I4WA 1MB9A 1J07A 2J9GA 2X8WA 5BQOA 3X1YA 2VHTA 3ICCA 2C3PA 1EK5A 4YJDA 2FZLA 2PPLA 3M1AA 4L4UA 2ONCA 5CA1B 3AUFA 1AU9A 1JAZA 2ZJOA 4CM8B 5LMCA 3QYPA 3IAXA 3HA2A 4NTZA 2VAMA 2VT3A 4WI1A 4EPRA 1AMOA 1CERA 4X3CA 3PXEA 1NNI1 1ECCA 2QOEA 2REBA 4NV3A 4BP3A 2K5UA 1ST2A 3L77A 3R7SA 1HNNA 4Q9NA 3O94A 5SICE 1GKYA 1JEJA 2YDXA 1RLOA 1W1UA 2GZSA 4Y2XA 5HW0A 5JHGB 1JP7A 1Q0SA 2I2BA 1F38A 1XLVA 2CF6A 2EFHB 2PZAA 4E6EA 5B4TA 1XEXB 1LI4A 2VUSA 1PIWA 2BZ0A 1C80A 2H5JA 3F6EX 2BDTA 1QX3A 1N7IA 1N0UA 3KSMA 3NNNA 3QITA 1SCQA 4KXXA 4U5QA 4ASUD 1J0BA 2WLTA 4GI3A 4B71A 4F06A 2JA1A 3BJMA 4QFMA 2IU6A 4QUHA 3W2EA 1XTJA 4X20A 2WIGA 5A9RA 2GPBA 1R0LA 3M70A 2FUKA 3IILA 2A0UA 2LDBA 2VP4A 5DBHX 1QIKA 2F62A 2XYQA 4JI4B 5AOVA 1CEYA 4OXQA 3RS4A 5C5IA 4JOQA 1DINA 1R8JA 4Q47A 1U1FA 3OAAD 4YAFA 2XZPA 3OP1A 3DEKA 4DLBA 1YU6A 4RENA 5ECYA 2ZCVA 1COWD 5GGYA 3WSTA 4URXR 5JDIA 1DQPA 1RWNA 2F2TA 4CKCB 1XMXA 2AMVA 1I8TA 1V2HE 2KBFA 4UC0A 2D5AA 1DT5A 3W0LB 1NV8A 3UK0A 4DUZB 2G67A 1N8SA 2ZG6A 1T8TA 1XA4A 3EWSA 4M7RA 3S8MA 1SOVA 4M99A 3E9YA 1T36A 3RIEA 3CY6A 4RPGA 3ROQA 1UKZA 3H84A 1E7SA 4X91A 2IYYA 3WDSA 3ZW8A 4C7VA 2ODQA 4IH9A 5L4SA 5TIIA 2IIBA 4DR2B 4MS4B 3H0KA 1Y8AA 2PBZA 5DXFA 1ADGA 5DSTA 4BQPA 1VBFA 5TJHA 4OL0A 3FAZA 5IKXA 4M88A 5FD8A 3PL1A 5KNCH 2CLEB 3ER8A 2CMGA 1N2OA 1OQAA 2POCA 4F4DA 3FOEC 5DCLA 5KWSA 3TQTA 1CZNA 3CG0A 4KSBA 3ZH9B 2QKYA 4RPLA 5EPOA 1HOXA 1JHPA 1XJ5A 2P6NA 2YC4C 1OBVA 4N3BA 5LDHA 4OXNA 1I7DA 1EGQA 1GPUA 3EEIA 1QGDA 4D9GA 1C7QA 1PLKA 2IYOA 4YAUA 3E3OA 1E2EA 2VJBA 3CE9A 4PZUA 1FRNA 2IYLD 1LVUA 3BTUA 3LDFA 2C1EA 2IXDA 3CS3A 4Q21A 4WCDA 4WZZA 3X1XA 1XMQB 4N8EA 1TECE 2CDCA 1P4AA 2DHRA 2OLJA 4XFJA 4AU1A 5FWNA 2E55A 4G1BA 4GM1A 1J9ZA 1FJHA 2QQGA 3QPBA 1M66A 4L08A 5TT0A 5IAJA 4D9MA 2Q07A 3GUZA 3LX5A 3FPEA 4ZOBA 4XJXA 5CEEA 1U0SY 3NM5A 4M0EA 1W59A 3M5PA 3ITKA 4IFBA 3UUFA 1PNTA 1X39A 3GP5A 3OTOB 1GCIA 2PGLA 1ORHA 2JANA 3FYHA 1FJ2A 4QGHA 1NBOA 3U62A 3R9KA 1JG1A 4CLOA 1QS0B 1ISHA 4IGIA 1YE5A 4MKGA 4JXKA 4ES6A 4JXXA 2O8DA 2H9IA 1U2TA 3M1LA 1H22A 1G3MA 1XDBA 3K8ZA 4CGYA 3MQ2A 5JDCA 4BNKA 3T1TA 4GLLA 2HDNB 3COSA 1VSUA 1EVLA 4L27A 3M2PA 1KAEA 2X9LA 4ZICA 2VXYA 3ZE9A 1WDWB 4PLGA 1R5JA 3FNQA 1O0SA 2NNLD 4FSHA 1J2UA 1TLLA 2UVPA 4J03A 3CF4G 4HBGA 2WM8A 1KP9A 2Q5JA 2JFGA 2C00A 1OLSB 1SY7A 1IZ9A 3S6JA 3WGLA 2PUCA 3KR1A 1HT1E 2QUBA 4D3DA 3FGZA 2C4TA 4H17A 1A2KC 2XKJE 3R5FA 4ZCTA 1G6Q1 4PG8A 1TK3A 1EP3B 1NG1A 2CXRA 1E2KA 4BQFA 1PQWA 2GZ3A 1VI5A 4DTIA 1KEVA 2ZEJA 2XGSA 4NMMA 4A92A 5JCZA 1R15A 3K0FB 5FPKA 1QM5A 1AZLA 1XT6A 1JWAB 5FTKA 3IMKA 4QYMA 4PXYA 2QSUA 4RWZA 1JZTA 4WZBE 3Q7RA 1VXRA 4KFSA 5IHXA 3K8OE 5EWMA 4ESHA 2H1RA 2MSLA 1RQLA 1Q12A 3JS5A 4PLZA 3QG5A 1Q2XA 2IPOA 4GKVA 1Z4MA 3Q7TA 3AFHA 2FHPA 4FB4A 2QGZA 4WLVA 3DDHA 4OJKA 1JALA 1J22A 2H5IA 1HYBA 4FS3A 2NVUB 2BFCA 1ZN9A 2QNIA 3CZ9A 4D9JA 3VYSB 4ZI3A 4GU5A 4ZAWA 3C6QA 2P65A 2NM0A 3ZV4A 3O31A 2KSQA 4M21A 1X1CA 5H81A 3IV6A 3TE7A 3LJKA 2ON6A 2CW5A 2Q2OA 8ABPA 4Z54A 3E1KA 1PZGA 1UPCA 2O1WA 3OM0A 1Y1PA 2PL3A 4KO8A 3W5IA 3E5RA 3HSKA 1C30A 4BLUA 4WY5A 3ZJVA 2O8EA 1GZ3A 3SMQA 4ZOEA 2A1IA 2JIOA 2QV7A 4AZ3A 3LXXA 3EBOA 3C7AA 2EFEB 5F4ZA 3ZZTA 2FJUA 3MXTA 5AKKA 1SVWA 4Z9YA 5LA6A 2FG5A 1CJUC 3A11A 2P8SA 3GJYA 2QU7A 2AQ8A 2H2FA 2BCEA 2OORC 5DWVA 2ISSD 4P4SA 3N05A 3H11A 4FCTA 5L51A 5IM5A 3IXQA 5T8KC 1PJSA 2AN4A 3HFJA 4PZLA 3A25A 3KQOA 1H0KA 3KXPA 4FFDA 1NJGA 3F47A 3I9V6 3NZEA 3T9FA 3GQBA 2DFTA 1BX3A 4Z3KA 3EQ9A 1CJBA 2WU1A 3JASA 4C2TA 4Z4EA 4LXYA 4QOJA 1XHFA 5FPQA 2GJ4A 2C5HA 1U0RA 1VPTA 3PL5A 4GNKA 3RAPR 1FPQA 4WOCA 2P9ZA 2IZZA 4I55F 3RYFA 3QEMB 4C06A 4F3RA 3CF4A 1W93A 4W1RA 2P4SA 1GNRA 2NTYC 4YLEA 3M89A 3EVEA 4G5XA 4L95C 2I0FA 1Y4UA 1J00A 4NAVA 3L8MA 3R9XA 3BQMB 2QWXA 5KJEA 1X7WA 2PIDA 2PUJA 3R9XB 1LEHA 3NHLA 1FSGA 4M89A 1RQPA 3Q3JB 4QTXA 4EBBA 2Q5OA 1QX4A 4P86A 4J3NA 3W9UA 2F48A 3RYFB 1VP9A 1JDSA 2R7AA 5TXGA 3LCVB 1U4NA 3CN9A 2HR1A 1AKEA 1US8B 2RHGB 4RW0A 1JGTA 4BBPA 5LYJB 2AZXA 1TTHA 2HQ1A 2OHHA 3GZTB 5LBIA 5BNTA 2WTAA 5DM60 4G5YA 3AFOA 3R77A 3A9RA 2D8MA 5FOUA 3HMKA 1XQ9A 3ROPA 4ZXFA 4JT2A 2X4GA 1GTZA 1PJCA 3FOAA 1QQ6A 1VG1A 5A7FA 3UCEA 3DE0X 3DJFA 3IVCA 4JX8A 4L7QA 4MDYA 4WKNA 5K3DA 3TX6A 4Z4HA 1P44A 1G8FA 1MA3A 5KTMA 1G7RA 1K75A 3IVXA 5BSRA 4GOOD 2LD4A 2C99A 3IBGA 4KGDA 4BFWA 1X1TA 5E9WA 3V8RA 2OCAA 1JEEA 2JFVA 2OBYA 2FFQA 3PQCA 2O23A 1V16B 4IIHA 2DECA 4L72A 4UUAA 3CRRA 4Y1FA 5CFQA 3A1TA 4HY3A 4Y7CA 3GLFA 4HEQA 4BC1A 1NUTA 3SR3A 5KYWA 4AJHA 4V0SA 1ODTC 1Y0BA 1HRKA 4MYHA 3IP1A 3RG8A 2EX0A 4MR8A 4O4IB 2E5FA 1GEEA 2XOKD 3IOBA 3DC2A 3W1WA 3FMPB 1ICEA 3KYJB 5FPYA 1L5LA 3LLSA 3P20A 4PYOA 1V3VA 2WE8A 3VPXA 4I9UA 4XYGA 1LW7A 4D0GA 1Y5RA 1FDIA 2AR7A 4C04A 4BFLA 5L3VA 2R0QC 4P80A 4F9GA 4HFNA 3PE4A 4L9AA 1BA3A 2VDRB 4M7PA 3RK4A 3UFBA 4OHKA 1IE3A 4DLLA 4ZV7A 3WS7A 4UU7A 4JCCA 3BMNB 3JQ9A 4H15A 4RXMA 4MRMA 1XLWA 3NBXX 4P33A 3E9MA 2GBIA 3TGWA 2OCGA 4ID3A 1ESEA 1T4MA 4LYHA 4TRJA 4FEYA 1B43A 1QUFA 3RBXA 4ENUA 1K63A 1XWFA 1E99A 4F0JA 5C7LO 3QMPA 3HU5A 1ILEA 3QVSA 5IVKA 4OHXA 4KPEC 5CJ2A 3T3GA 5EN4A 5JEEA 5G0UA 4LX8A 2HA3A 1Z2OX 1KZ9A 1MQ8B 3QLVA 3DKVA 4CM4B 2XCRB 4ZI5A 4HUQB 1EE2A 4CR7A 4UD2A 4V3CA 1T2FA 1MEJA 4G89A 1KEWA 2G8NA 1A50B 2PPVA 5CX1B 2ZJ8A 4BNIA 4EFMA 3C6BA 1A77A 4OOEA 5INTA 1YIOA 1MX5A 3JQEA 1UP6A 5K20A 1PNOA 3OD1A 1V6AA 3TQHA 1EXWA 4XUDA 4M9RA 4F2PA 1W5TA 4M1EA 5AJWA 3WKCA 2X14A 5E3HA 4YT5A 4Q6WA 1RMYA 1C2YA 1T2UA 2DQKA 1P3DA 2RHTA 1W6RA 4IBOA 5HFJA 1UZMA 1CUYA 1N6KA 4UATA 1Y8QB 4TWAA 4KH1A 2EC5A 4AN1A 4C7XA 3EULA 4G0QA 2IY7A 4FHGA 4Q4HA 5CT9A 5KYXA 4UVEA 3IJPA 5D3ZA 1D0IA 3CB2A 5A0VA 3DQPA 4BO3A 3D0KA 4R2JA 3U1BA 3A6LA 2ZT8A 3C8DA 4GXQA 1WW2A 2FEPA 3SI7A 1WD7A 1QQBA 2QM7A 3OT1A 3PIRA 4IDCA 3KUXA 3MIZA 3PXDA 2G8LA 1SD2A 4F4CA 2H31A 3I39X 4ZIRB 1IPEA 4HDNA 1PKEA 3KETA 4F11A 3F6CA 3Q7IA 1E77A 3KDAA 1V41E 4Q3CA 3AV3A 5FFMA 4OBBA 5DM4A 2W2LD 1IQPA 3E9RA 2Y1FA 3S1AB 1MH9A 5EMJA 2ONZA 2Y1GA 1Z4OA 2R96A 4BVGA 1RQXA 2BMFA 3FLEA 2QGNA 3ZY2A 5KPDA 1JFFB 3A4MA 5EWLA 2CLSA 3BCRA 2Q9UA 3L0ZA 2ZFUA 1I94B 1TMGE 1PL8A 1TF2A 1Y89A 3PUHA 1EJ2A 4HQNA 4MYSA 2YWRA 4OIMA 3RU2A 2P2SA 4DYDA 1I7SB 2LUOA 2ZUWA 2B8JA 4PFQA 4Q4JB 4YWHA 5EINA 3VAAA 3ISVA 3LXUX 2QDKA 2FQWA 3OSZA 3ZEIA 2D59A 4EDHA 2BW0A 2Q3JA 2PZLA 1CCWA 3BJZA 3DJYA 4W8HA 2RARA 4HWGA 1X7YA 3TR0A 2DOKA 3JQ8A 4EQ6A 1DKUA 2QUIA 3HY4A 4KFTA 4TLLB 4DLZA 3MELA 4ZU1X 3DP7A 3RTGA 4INPA 1D03A 2BTQA 4FYXA 5K9ZA 4ETMA 5JMWA 2LR0A 1LVGA 2A2ZA 4HQRA 4AROA 1NIPA 1ID8A 1J8MF 1G6KA 5MFPA 3TEMA 1SXGA 4OGLA 2D6FA 2R1UA 4IOLA 4ZT7A 4D9NA 4AJ9A 1DXOA 2V1XA 4G5FA 2YV1A 1Z7GA 2J6BA 2ICAA 5LPNA 4CMIA 1H85A 3LH5A 2J9FB 4JB8A 5B1IA 5FL7A 1TKBA 1PZMA 4TYMA 2F8LA 4JSRA 5IKMA 1NNSA 1SEPA 2XF8A 3OE5A 4PFJA 3QI7A 1YFJA 9MHTA 2HMSA 4R69A 4E94A 1K2WA 2VPYA 3DDNA 3CT6A 4MH0R 4MJ3A 2CNWD 1H0HA 1XK6A 1WQ4A 1U0TA 1YA8A 2EEPA 3COVA 2Y6VA 3DTVA 2DGDA 1RIFA 2XNDA 5ANRB 1ZD5A 4D3SA 2EZ9A 1K5HA 4RY9A 2OHVA 3EZYA 3EIFA 2XNKA 1ZA1A 3DV9A 2FR1A 3E9ZA 3P0JA 4DLVA 1DOZA 1HO3A 4JBXA 4MYRA 5ETJA 2P9EA 5G0TA 1R6XA 4B7ZA 4PGHA 3DTNA 5B5SA 5TARA 4BNYA 2ZITA 1YOVA 2XX3A 1RE1A 2RH4A 5E9QA 4ACBA 5CD1A 1M6EX 4I1IA 1E9EA 4C14A 3DOOA 4UNNA 5HTOA 2FRDC 1Q5PA 5B53A 2CXQA 2R5WA 3IE0A 2IP4A 4EK9A 5COQA 2VPIA 3U4MA 2FPGB 4G26A 3UJ3X 4ENTA 5E95A 1XXLA 2HBZA 4NZYA 2DXIA 2Q5HA 3P26A 2RHCA 5FH9A 5KTRA 2B30A 4RTJA 2G40A 3KWFA 4Z4IA 1E6KA 1E3EA 2B94A 2IK8A 2WM2A 4JJ4A 2POQX 4K1XA 1I33A 3EMBA 4C7MA 2V58A 3OEEA 1MIOA 4HN9A 4QTUB 2FEOA 4ZYWA 1RLMA 3FTCA 4QQ8A 1WF3A 4ZT5A 1NNLA 1UBUS 4XM2A 5CGQB 5CNMA 5C4IA 1RW4A 1E1QD 2P7HA 2JH9A 1ILWA 3RARA 5EZQA 1ZNZA 5EHNA 1T34A 1P7ZA 2XQGA 2PLWA 2QT9A 2G63A 1SXQA 4U2KA 1ZICA 2XE6A 5KYXB 4B80A 2B37A 4DJEC 1P3Y1 3L79A 4P7JA 4ME6A 1LDMA 2Q0SA 4JYCA 1TNDA 3EZ9A 4YXWD 1IAVA 1TM3E 4N1AA 4Q1VA 5JJBA 2VRWA 2YUIA 3L0SA 4RTPA 2XTNA 1HV8A 1XZDA 1G5IA 3OZTA 3TPZA 1YFLA 4AM8A 9ABPA 3L7DA 3AJDA 3PENA 3OJEA 2QE7D 3JQGA 4YCNA 5A9SB 5CG1A 3H1FA 3BXHA 4UFNA 3DXFA 4ZVQA 1PR6A 1YB1A 2OG2A 3ANTA 3M4ZA 3MEQA 4KYTA 3GWZA 1CVIA 4YJ3B 5DSZA 3NUGA 2DZDA 4I9NA 4PG7A 4YCCA 2QTBA 4Y1RA 4YO8A 4H1WA 1O94D 5E6UB 1AXRA 1QIIA 3WLMA 2NIPA 3IT0A 3TI7A 5IJ0B 5TMPA 1PS8A 3EEBA 1DQZA 4CTMA 1M7BA 4FONA 3ZN2A 6PFKA 3ESBA 3VNBA 3QE9Y 4ISBA 3VPDA 1GVHA 1CUFA 5K8IA 4MVJA 3B78A 4NOLA 2OFFA 5CBPA 1PWHA 2IZOA 2NOAA 3O92A 2OBLA 4Q7LA 3DO6A 3DLPX 4QDKA 5FPTA 1CF2O 2I4IA 4GR5A 4F7DA 5A4KA 1B0ZA 1OFHA 3HWX1 4INAA 3OURA 2OGSA 3BTOA 2GHQA 3OECA 2MJLA 3SEZA 5TQVA 5CJPA 5FEMA 1S3FA 4BVFA 2QZ9A 4HRAA 2X3FA 1ZJ4A 4AZ0A 4X65B 3J7AC 3GAMA 2VAVA 4IJVA 2B6HA 2EZ8A 2D7JA 3K0HA 4OA5A 4QE3A 3JQGB 4M0CA 4HDOB 5FLKA 4XX0A 2QUKA 2GLUA 3CLUC 3CZCA 5MN4A 1F12A 5FA6A 1NVUQ 1K6EA 2BLLA 1KGDA 2WJJA 2SKCA 5TQJA 5CLFA 1NLYA 2A5DA 3EUFA 1C7ZA 4GEKA 4B6OA 3QA3E 5EG5A 2R6FA 4FNMA 2JLAA 4Y8VA 1DRKA 9ATCA 3L43A 1F2DA 1KRHA 2O8BB 1FOEB 1ESMA 4IDFA 4OK5A 3UPTA 4G0WA 1WZEA 1BGVA 4CM7A 4GOJA 3IEVA 4BVHA 1ZISA 1NXQA 1LV7A 1NVDA 3LBAA 4ZVPA 3AP3A 4LVOA 1V16A 5FPSA 1W36D 2QRQA 4Y7DA 4R51A 4B6SA 3BIJA 4N6NA 3SDBA 2F1JA 5JNRA 1MIOB 3MJRA 5AUPB 3GW8A 4B48A 1MR3F 3BB3A 1CFJA 1UMCB 1ZLXA 5KNDD 3O47A 1QTNA 2ATIA 3D6HA 2IYAA 3I8XA 1MT0A 3K05A 4PTZA 3W5DA 3FPCA 1NXOA 3FNFA 3CNBA 1OY1A 1CUEA 2GN9A 2PEZA 2E6UX 4RVCA 3Q0TA 1JTFA 1SUBA 1Z4QA 3RM3A 1VLZA 5I6DA 5JPCA 1BH6A 4HKTA 1R8XA 5HUQA 1EGAA 3V2IA 2O7SA 4M1MA 4FMDB 2JLBA 2P41A 3VR0A 2QLFA 3ENNA 1D4AA 4UU0A 5EKUA 3SDZA 1EDEA 2LRHA 2FETA 2O7VA 1KDRA 1ETUA 2VP6A 3EW7A 4FNOA 2YJ6A 4HWRA 2R25B 3U0VA 1VG8A 1WEKA 3UJAA 3UMSA 1AUOA 1I5EA 1Z0IA 4OQEA 2DYKA 5C1BA 3BL6A 3S1LA 2MINA 3K8QA 3EC1A 7MHTA 2D1RA 4UPEA 2XJ9A 2FRXA 1WCIA 2GM5A 2Y1OA 4C4RA 5AVKA 3LZCA 3JV7A 4M1SA 3TQRA 3LO5A 4RMIA 2DR0A 4B6QA 5BQ3A 1UQRA 4DEVA 1H2WA 4F5WA 3IEMA 2BEUB 4ZGBA 2IITA 4Q3KA 1DJQA 2W6JD 4FZ5A 3MCVA 3BA1A 1C4KA 4YGXB 3S2SA 4CKWB 2XMSA 4DXAA 5IP5A 3UMRA 1L5QA 1L7PA 2XSZA 2Z0MA 5IKOA 1RBQA 4NFYA 1V1MA 2L82A 2PS3A 4ZCSA 4UUPA 3DE1X 4I1OA 1EXMA 1SKUA 3OTQA 1CZOA 5ARBA 4N48A 3RJ9A 1X92A 2Q3CA 1DZIA 3W2TA 2JLYA 4B3RB 1TAUA 2Y1DA 3EHEA 2OXIA 2ZTSA 3DAOA 3VHRA 1R50A 5C5DA 4YREA 1N2JA 2V0CA 1CR0A 2WMYA 2XEXA 4LCJA 5HDBB 1GGJA 1JXOA 4QUBA 5FWXB 1TMYA 2FF7A 1VCNA 1IATA 1HZJA 1PUXA 2GEDA 2PRYA 2FPWA 2R8XA 3LY7A 1JVSA 1N4AA 3VR4D 3O75A 4D6XA 3K9LA 3L6EA 2KW5A 3NOXA 3O8QA 2EGGA 4E5DA 1JMKC 3DL2A 1GAEO 1AS0A 1K8RA 1TU3A 1XDWA 2H3EA 1GRVA 2K2QB 2YJNA 3DZDA 3FVVA 3FY4A 3GYGA 4HNQA 4Z0PA 1IEWA 1SIUA 2HNBA 2Q8NA 3D2AA 3DZ8A 3IS3A 4QASA 3TOZA 3UMFA 5J58A 3ZVMA 2VO1A 1MQAA 3KQSA 4QEDA 5EE9A 3TGLA 4XPIA 3JQBA 4A82A 2O8EB 3WMGA 2H17A 2PD4A 1P2GA 1EVZA 4RM3A 3AFMA 4K26A 5AI9A 3UJPA 3ZCVA 3IOYA 4RK6A 1VHTA 2JIDA 5HUJA 1YGPA 1WXEA 2PJDA 1LSJA 2VTVA 1GKIA 5IBCA 2OGWA 1RZUA 2G9QA 1QZZA 3K15A 1A8SA 3ETLA 3ZLJA 1MF7A 3MD0A 1MXHA 3RUCA 1K4MA 3RC1A 3S1AA 1PTKA 1V4NA 1T3GA 4MQBA 5HDQA 3N0WA 2ZT5A 5BMVB 2ZANA 1Y7PA 2ECPA 3K2BA 2VXCA 4QYSA 3L0OA 1PGJA 1TYZA 2WKQA 1U0OC 1EXDA 4ZQCB 2OD2A 1UZNA 2E4WA 1R66A 1QMGA 3LVRE 2AB0A 2Z1NA 5B55A 2EW2A 4EJ6A 5C4MA 5JW6A 4LFBB 2YNMD 4OH7A 1TQDA 3RJ5A 1FYEA 4GKBA 1JG4A 3F3KA 3X2FA 4EYQA 4F4JA 1JHVA 1TM5E 4P5DA 1JEDA 3OZAA 3JCZA 4G56A 4YAJA 1DO0A 1S2GA 2O7RA 3BD6A 5AW1A 4CIYA 2VSXA 5HZHA 1PWXA 3MWDA 2JBHA 3QY0A 3U4CA 4RFSA 4LC9A 2BCJQ 1AD2A 4EUHA 2OOSA 1E3DA 1FX0B 1RIIA 2IUYA 2VVTA 2GYYA 4HNSA 1PJ4A 4RMNA 4DV3B 4FYPA 1N2IA 4BO6A 2DC1A 3EDYA 5DNUA 5MN5A 3PJFA 3AG5A 3M7IA 1GZ6A 3AJ9A 4TLCA 3R5HA 5A9TA 4G4GA 3QMMA 4AUKA 1GIAA 4L5BA 4CLXA 1CDDA 2VKQA 2YY6A 4RYDA 1DX4A 1R8QA 4KKXB 5B30A 3NQ41 4I46A 4JB0A 4IF6A 4A36A 4LJ4A 4YR9A 4B47A 1OIXA 1JF8A 4MIOA 5P8WA 1OGIA 4QXMA 4RFSB 2P0EA 3OETA 4QEZA 3ESQA 3ZV3A 4CT0A 1E2DA 2QTFA 4AMYA 4TWRA 4EZEA 1CR6A 3LZDA 3PRYA 4KR0A 1WTAA 4H9GA 1MIHA 3DE2X 4F9TA 1U1IA 3CWCA 3MOIA 3A1FA 4FBGA 4FLEA 2H06A 4MUIA 4UD6A 1CETA 4ZAGA 3TPFA 1ZH6A 3RLFA 2PTHA 4Z1OA 1SNYA 2CSXA 2HSGA 4RGVA 4WBNA 4DA7A 4A0FA 2GT1A 2QTTA 2EZTA 4QUAA 5C1DA 1H8HD 4DBLE 2SCUA 5CFLA 1R37A 2I54A 1N25A 2AJDA 2WG1A 4R0NA 1Z6PA 3WK8A 3FVTA 3K9NA 3QW2A 1VPEA 4BZXA 1LDYA 1N4DA 4C4PA 1RR6A 2Z6VA 1HYHA 1R8YA 1YUMA 1J9EA 4EUFA 1ZHHA 1FXWA 1ZUD1 2OM2A 1E6WA 1WLSA 3AI7A 3OMWA 3KHUA 4HDCA 4L4YA 3X3HA 1OIWA 1SXIA 1QE5A 2JJ2A 4F1KA 5KWEA 3AEZA 3QYFA 1IBLB 3ZE2B 3EGDA 1JQKA 1DPGA 2AFHB 4PE5B 5DRTA 4ZGGA 1QMPA 5C7IO 2RBKA 5CH8A 3ED5A 1DLJA 1ZXXA 3ONDA 1HH4A 1U98A 2VP2A 3R23A 2I6QA 3GPBA 3LDHA 3OQPA 1OHHD 2GCOA 4YR7A 1AVTA 1YF3A 4YK7A 1X74A 4EHAA 3PZRA 5ITWA 1ZH8A 2B3DA 2QL7A 4MVXA 3IA7A 4M37A 4G0ZA 2E85A 5DI3A 1CB0A 2W2XA 4KXUA 2V7GA 4O2BF 5J59A 3VAZA 3AHFA 4DM4A 2L18A 2CLKB 2NZYA 3G2OA 3LT5A 1RAHA 3TR6A 3U49A 3UH1A 2FLKA 4QGGA 4HAIA 3FA2A 3KWMA 2QT1A 4EY7A 1MX3A 1SZJG 1IEVA 4CJXA 5TPZD 3KR0A 5E1BA 4HQ6A 3O38A 1H0SA 4PSCA 2G70A 4U2DA 2J5QA 1U2RA 5K3FA 2PR7A 1X7ZB 4KUGA 2YFKA 3BWBA 1YJBA 2UV8A 3NHYA 3Q7SA 2RB5A 4K6KA 2RHDA 3HU2A 4X90A 4OHCA 3WK7A 1X1QA 5IAGA 3I5YA 4CKWA 3O6VA 4P31A 1MNAA 5LQSA 2ACKA 1XEXA 2IDJA 4DSOA 4NBTA 3ESZA 4GF5A 1J7KA 3VC7A 3O8RA 1JQDA 3U40A 2OXTA 2AC7A 3ZCUA 2W0MA 3L5OA 5ALGA 1JPVA 2I67A 3L82B 4B3SB 1NVEA 5KOIA 2WWGA 4BY9E 3OE7D 3ACCA 1I1OA 4G1UC 4V0QA 5CM8B 3CX7A 4OLAA 3GPCA 4D5GA 4MV5A 3UOAB 1UQTA 4P3OA 1ODCA 2H1WA 3TLAA 2W70A 5GZ3A 3LYLA 1W19A 1Q84A 4DQLA 1FW8A 2FMXA 2DCMA 1APBA 4EHHA 4ZHSA 1ZVVA 3BXZA 4NPAA 1M6YA 4NR0A 2PDAA 5DH9A 1Y7TA 4IX1A 1A8HA 3KQLA 4CUKA 4HB4A 3BBLA 3TZHA 2ECKA 4MQEB 1U0JA 1WXIA 4KHZA 1FUKA 3RPEA 3RRXA 2ZBDA 5LWHA 1LB1B 1RQNA 1FFEA 1I3CA 1QHIA 2ID8A 3A4IA 3D2LA 4OUKX 1MW8X 4EG3A 4BNDB 1S9HA 3CEMA 3Q3HA 5BSTA 3STHA 2Q0QA 3OLYA 4XIGS 3FTPA 1ZONA 2HHLA 4LXXA 4TMFA 5AM0A 2C2KA 4F46A 3BEOA 2HEGA 3TW0A 4DT1A 4K9QA 4JLJA 2NUPA 2XT9A 4EY8A 4RTNA 1IOZA 1JDVA 2I2CA 1SC1A 2WJ6A 4M0UA 2VOEA 5G40A 3ZIAA 2Q5LA 2QTNA 1RTTA 4KRGA 1I4EB 2WAAA 3GUCA 5AI4A 2XLBA 1LBQA 1U7XA 4K9KA 1SCAA 3ROEA 4DE5A 5KNBH 2V8BA 3Q9UA 3SG0A 3ZDCA 1L7EA 3H83A 3G13A 3Q2OA 1OAAA 2CLFB 2QHXA 1N3LA 1OXKB 4U7TB 1CPYA 2PGOA 4K28A 4U6QA 1E64A 3KSBC 3ZY4A 5JAIA 4RHCA 3FYUB 3PUYA 2G9VA 5FULA 1SMKA 3HZOA 5ICMA 1KZGB 1G5FA 1WXDA 1E58A 2RAPA 2X13A 3I0ZA 4YV2A 4AK9A 2WQ7A 1BROA 1OU0A 4TN1A 4X45A 4QAQA 4XGNA 1DBQA 3COPA 4S1OA 4CFZA 5IASA 1F3LA 3NMUF 4WHMA 2HA0A 2BJWA 3GRUA 5AKGA 1IEXA 4BJHB 1GPNA 3HKCA 2VT6A 4TQGA 2DG2A 4LBYA 4OYRA 5JQGA 3P2OA 2TMGA 1XPJA 3GXOA 4IIXA 4NHEA 4QXOA 4ZZ1A 1OLSA 4ZO4A 5FYDA 2COUA 3WQHA 5FNZA 5FR2A 3LAWA 2Z2XA 3CW8X 4BN4A 5F7OA 5KYVA 2WPDA 2XRYA 5KAMA 1W36C 1JDZA 3D7LA 1T0PA 4X60A 1DRUA 4HEA6 1K27A 1NA5A 1H8HA 3FB4A 4QDXA 1E3MA 2V9ZA 4LQ4A 2RIRA 4FX2A 5HCUA 2AHRA 4JJAA 3HHEA 1TEXA 4DSTA 4GGPA 1N57A 3WWEA 1OBHA 4RH1A 2EJVA 2YZ7A 3A6JA 4JC8A 3PHJA 3ROTA 4CLOB 1PK8A 3FCAA 4Z86A 5BT9A 4GC9A 1Q22A 3ZZUA 3VJMA 3SHTA 3TSAA 3JQCA 5BV8A 3DDUA 4ENQA 1Z73A 5I8ZA 4DV4B 3ONWA 1FTNA 3H4VA 4ZVVA 1OT5A 1P60A 2HXSA 3FMVA 4HN2A 1ESZA 2CNLA 1U1EA 4L9WA 4MGKR 3RSLA 1IHXA 2IU4A 1Q3TA 2HUPA 1FU8A 1ONOA 2E3JA 3DMNA 5CLJA 3BREA 7YASA 2IDMA 4KLNA 1QFYA 3PCRB 2IH2A 5SV2A 2VTBA 4B17A 3H3FA 4HAUA 4AVYA 1Z15A 3PXXA 1M9NA 2DUJA 1E7QA 4H0NA 5U4QA 5ADVA 4U4AA 4B7CA 5BOVA 2Y8EA 1GDHA 2Z3ZA 3JWJA 1XZCA 1Y9DA 3GBVA 4DLUA 2WYHA 4JJ8A 3OQJA 1YQ9A 2JFYA 4YASA 4EKGA 2JLRA 3CLHA 2QBYA 4GOLD 3S2IA 4G4IA 1S89A 4RD0A 1T9GR 3ZS8A 1XD2B 3KOZA 5JISA 5ICFA 3LLUA 3Q9SA 5BUCA 5DNDA 1K97A 2FK7A 2IIQA 3GOHA 3HJUA 2AEEA 4FFRA 3C3XA 2AJBA 3UFXB 4N12A 1A1SA 4LRWA 4U9UA 3BHJA 4PZ9A 1NASA 4MS4A 5JH7B 1QHHA 2CVPA 3FWKA 2V6BA 2V7BA 4F92B 1KETA 2GZHA 1LLUA 3QOWA 1JQAA 4N7BA 1FQJA 1AQIA 3ADPA 1FS5A 4FMPA 4CL8A 2VZ8A 1LPOA 4L22A 4P3PA 5AJHA 1BDHA 1E69A 5HF8A 5IJ9B 1XZGA 1CUZA 3MSCA 1S2OA 3T1YB 2Z5FA 4F85A 2P62A 1RQGA 3AILA 1SCDA 3C87A 4R7GA 2YASA 5ENVA 4H7JA 2KJQA 4QSMA 4R40A 3RABA 4A6PA 4HL6A 5DM70 2PG3A 1KK3A 3PC8C 2PZBA 1SULA 5CFOA 1T9ZA 1XCGB 1E1RD 3KJQA 5FAKA 3AUJB 3QLVC 4FFPA 2XRFA 3UGKA 4HB2A 4OJNA 4DIEA 3GOQA 1UL1X 3IHLA 2GETA 4TX1A 5DF1A 3ROZA 3D0OA 1RSZA 1J20A 1R9MA 3AR7A 3HDTA 4U7JA 4TN5A 4HGOA 4BO5A 2QRZA 4EW3A 1AMNA 3IQWA 1IJEA 3DMGA 1X9GA 3NH6A 3X1DA 2GK7A 4AG3A 4MGHA 4E07A 2Z57A 5CPBA 4OXYA 3INGA 4KQ1A 5AOAA 4DDWA 2G0AA 4L15A 3QPVA 3WNQA 2W2VA 3KV3O 5J1TB 4BTVA 2Z9BA 2I8LA 4BB5A 4Q1BA 4S04A 1RU3A 2J5KA 2XZTA 3G49A 3Q8KA 3STVA 3KJNA 4GM0A 5FTMA 4U0KA 4OHZA 1ISSA 1OFTA 2V7TA 5GPBA 3PHHA 1N36B 3BSYA 1LNQA 2IYXA 2ZAIA 2CB0A 4KEAA 4JI1B 4YRRA 4D96A 2GMWA 2PXAA 2YJ4A 1J2RA 3QFHA 5LBTA 3ZWAA 1OI4A 1GLNA 4S35A 4YJ2A 2UUOA 3D6MA 5EWJB 1NU8A 3SJCA 3O21A 4PZAA 3M5CA 2GSWA 2ORED 5F9MA 5CURA 4YMGA 2DE0X 2DFNA 3E4DA 1ZITA 4UNIA 5JRZA 2A9PA 1OI3A 3RV4A 4U9IS 5L3SB 1E1MA 5J2TB 4A0GA 4FGWA 3CNOA 1Z2PX 4YDRA 1M10A 3MFQA 4JV5B 4XR4A 1ABFA 1RJEA 1SBCA 3A6GA 5J2UF 2ZPAA 3OTHA 4YAIA 4AURA 3PFIA 4QHTA 3PD1A 4G9GA 2XIQA 5J47A 2WUGA 1FU7A 3SM3A 4MPJA 3NHBA 5EUCA 3VR1A 1E1DA 4D3YA 5ADUS 2FRDA 1YT5A 4HVAA 4X7PA 3R0JA 3FWNA 3L1JA 3B2EA 1IEQA 1Z0DA 4L8FA 3VOAA 4D6PA 4D97A 3L7CA 4IQ8A 5EPUA 4DCGA 1EFPB 5LOVA 3C7TA 5D5QA 4DJ5X 4OHRA 2PZ8A 1QFMA 4QOFA 5G41A 1CUWA 1M34E 5I7WA 2O0MA 4CKZA 2Q49A 1N77A 3Q41A 3ESCA 4I4TB 3O8DA 5IMBA 3T3EA 4TXJA 3WA6A 4ZOLF 1M75A 1Y3IA 4KPFC 7ABPA 3UAOA 3BTVA 1KKMA 2XV1A 5EZ6B 1H6BA 3RK0A 3TKYA 2QS9A 5IUKC 5AM5A 2PLFA 2RHLA 5CYFA 5AW7A 2HOQA 4GBJA 3E58A 2QYHA 3IHWA 3FOBA 4M76B 5CDFA 5C8YF 1VKNA 3RSFA 1XDUA 2YZGA 3FPHA 3ZZNA 3QHQA 4Q4AA 3V8BA 2JGIA 3VTKA 4G0PA 3SIPA 5NULA 1EUDA 1I6KA 3MF4A 3OBBA 4FPXA 2XVMA 5EJIA 3LDGA 2NU9A 1NATA 2BGJA 2EL7A 4HZUB 2QSYA 5F7ZA 3O9ZA 4U39A 1OXTA 4FHZA 1ZK1A 5E4FA 2GFQA 1M2VA 1Z0JA 3T3HA 3AINA 1X7HA 1FMFA 2RHJA 1FP4B 5CVTA 4ZO9A 2QSZA 1A8PA 3TECE 1YQDA 2WINI 2VK1A 3L7IA 4U0JA 2HWYA 2LIVA 3T12A 4JGGA 1PZHA 4PSAA 5JAQA 3ZWNA 4KIJA 1F2UB 1X1EA 3SZMA 1AQYA 2YS7A 3WIDA 3UWOA 4BFSA 3TM4A 4F45A 4KOAA 2IXFA 1RZRA 3MJSA 1EP9A 5CVUA 4DSAA 5ARCA 2JHGA 4UARA 4REQB 4BTEA 1SQSA 4MROA 4TVKA 1PNQA 1VYUA 3HS3A 4CMKA 3GJXC 4JI5B 2GVNA 3A6PC 1HDGO 4O4IA 2BF4A 4HLUA 3RVBA 1BOOA 4PX5A 3B89A 4FE7A 4XSVA 4J4TA 2ERYA 4K3VA 1QAOA 3LCJA 1P61B 4NZNA 4BU0A 1HNXB 4XCXA 3GLFB 2C42A 1JEYB 1GCOA 4ZJUA 1T4BA 1DHTA 4M8LA 2OQ2A 1U9YA 4BTLA 1Z0FA 1Z8NA 2CJWA 1F6DA 3FJ1A 2XCOA 3W1VA 1WJGA 3TLMA 1E60A 4N76A 1HFKA 4EA6A 1PU2A 4C2BA 1MJHA 1PHRA 2HPVA 4MUGA 1OD6A 2YXBA 4GWGA 3T7EA 3WWDA 1S2DA 4BXOA 2GERA 1U8AA 3CX8A 3JWPA 3PT9A 4N41A 3P27A 3VTAA 3M6AA 4XXHA 2OXRA 4JAVC 5ALJA 4ZT4A 2Q28A 1OTXA 3ZY3A 3ZHTA 4B6JA 1VMDA 1ULAA 1P1CA 2G7ZA 2CUZA 3JR7A 2H0AA 3LKDA 3QUTA 2YWXA 4FEGA 1T13A 1YB7A 3N0XA 3RRNA 3STWA 3HDGA 2H9AA 4L5CA 3TZ6A 4TZKA 3N8IA 3ADCA 4ROTA 2J9RA 1E63A 3F98A 1IIRA 4J29A 3WHIA 3MCAA 3QPUA 4P3KA 2ENWA 2XR1A 4MRVA 3D6UA 3NHRA 3EK2A 5EQDA 2FW1A 2LCFA 4O2AA 5ALDA 3V2GA 3LIPA 5KUTA 1RAEA 4Q03A 2EBHX 2Y76A 4IWYA 4M8SA 5ESRA 3NXKA 3NVDA 2RCNA 1GV1A 4KO2S 4IDDA 1SCUB 1BOFA 5CDTA 2FDXA 3IIJA 4D2IA 1WUTA 3P45A 4KQ2A 3OKCA 4ENSA 3QZUA 4YAGA 1TGYA 1YRHA 3R3VA 1Y82A 4XGKA 2A88A 5FBKA 4MICA 3DEIA 3D5EA 6GPBA 1NZFA 1V11A 3DT9A 1OX4B 3W04A 5HKKA 1TA9A 4WZAA 4FGZA 3M4NA 3L1VA 2Q6OA 3ZNQA 5LKAA 2YWCA 1ZBDA 2EEZA 1WHSA 4R4JA 3HV2A 5B58T 3P9YA 4COKA 4W9MC 1MG5A 4NZZA 4DNPA 2VJLA 3FOCA 3BX1A 5B4UA 2WJYA 3OG9A 3F7TA 3N74A 3LQYA 2ERXA 4F2HA 5JAUA 7ADHA 1KJ9A 3ANSA 3GHYA 4JLBA 3VH1A 4KGVA 4PNZA 3Q98A 4GSLA 1E9AA 4DWOA 2ZVPX 4N3NA 4B73A 3DPSA 2WD9A 3QEAZ 4Q9IA 5AVRA 1WW8A 4ZGWA 2FN9A 3CINA 1R9GA 2UAGA 4MW0A 5LD2B 4N8DA 4DC1A 4E51A 3UJBA 5EE0A 1UC4B 2R85A 1BDMA 2E49A 4KBFA 4BRWA 3WWPA 1NXPA 5IYZA 3NPMA 2W48A 1MVOA 1I80A 3U7HB 3CR7A 4GZ6A 1E92A 5LLSA 3QXSA 2WHPA 3BE8A 3DDCA 4IH4A 2VF5X 3OZSA 4PRKA 1C2TA 1IHOA 3DUWA 4URVR 1JH8A 3WMRA 2B1RA 5KHOC 1CX9B 1F6BA 2FR8C 3MTBA 4YMUA 5F9HA 3GIDA 3U6BA 5TGZA 3PE3A 2WSMA 4FLMA 4KG7A 5G1PA 5HJEA 4KBGA 4YP1A 5L7TA 1A4RA 1X0VA 1AS2A 1P17A 5FUWA 4YRIA 4Z0NA 2JIPA 2GYUA 4GQIA 4EM6A 3WDKA 1U8ZA 1Y42X 5ALKA 4BMVA 8ATCA 4MJ7A 2CC2A 3GXBA 3C16C 3AYZB 1O5IA 3KB2A 2Q5EA 3NPAA 1OGYA 3DBRB 5IN4A 2BGGA 5HIAA 3K71B 1CJKC 4DR5B 1JDPA 1AGXA 3DLTA 4O5AA 1Y9AA 2HLDD 4QELA 1XTBA 3GGSA 4ITRC 3RYCB 4Q37A 4WGFA 1VSBA 2ZUFA 2W9XA 1F9EA 5DT2A 5FHQA 3OCCA 4OREX 2QENA 3WRWA 1WULS 3FWPA 4Y0NA 3EBLA 3ITNA 4AKGA 2UVPB 1OJ7A 2ODTX 2O2HA 2VAWA 3H2BA 3N2EA 4MVWA 1VLQA 1D2CA 1ISPA 3GRVA 1VLLA 3AZPA 4JJEA 4UCFA 3QYJA 5JECA 5LQNA 3DDWA 1H5UA 2X2FA 4II7A 1I3OA 3TYXA 2C2XA 3D8BA 1OIVA 4W8GA 5A3VA 4CL0A 4IF4A 5ECWA 4RO0A 5K6AA 4DZTA 4FSXA 9GPBA 3OIYA 1Y6FA 1J24A 4TM7A 2XF2A 1V35A 2O8DB 3ND7A 2RGWA 5KYUA 3KKLA 3LLVA 4HXFB 2JJ1D 4Q7EA 5BNFA 1K3UB 1LFDB 3VC3A 5CT5A 3VKFA 5EP2A 3ND5A 2DJIA 4M8IA 3V4PB 4U2BA 3CH4B 1DOHA 1XTQA 3L2OB 5SYAA 2WHYA 2ODWA 5AXBA 3SBEA 1GL6A 4BQEA 3I04M 1EI9A 1AKUA 2JFZA 2Z9DA 4KUHA 1T0JB 1M1NB 1LJ8A 1TYAE 1YQTA 4IEFB 5F2OA 3R7AA 1VPVA 5THKA 4RKYA 1HE1C 3HFSA 1U8UA 3PVZA 4OMCA 4RVGA 4E88A 3OZWA 4WFIA 1GYPA 3H2SA 5DBEX 3C6ZA 1GGHA 1WCWA 2MR6A 2UVQA 3E2IA 2G1KA 4CMGA 4HSEA 1G20E 2WTEA 3UK1A 1O6CA 2XQKA 4KVFA 4GDFA 5JSZB 4KR2A 4FR2A 5AW6A 3EGXB 4Y2RA 4KNWA 3CX3A 3WLSA 3OOSA 4UTRA 2ZRCA 2NP7A 1UBSB 3ASVA 3CCCA 1N2CE 3B3GA 2X8BA 4Q1EA 3V4RA 2JIZA 3QUSA 4FZJA 3PNLA 2Q3HA 2XUOA 3NC0C 3MT7A 4LWPA 1T4CB 1KIAA 4UBMA 1XN4A 2REOA 4MRAA 2CJXA 2Y1CA 4LDRA 4JQOA 3U48A 1VGRA 1VLJA 5COBA 5TGDA 4ACAA 1TUBB 2PE5A 1M1UA 2O8VA 1YR3A 3PGJA 2IX9A 1R18A 3H5NA 3IB6A 4HDRA 3WLRA 2REXB 1BXRA 5I7EA 1MW9X 2WWXA 4M1TA 5IANA 4US1R 5DWDA 3FYUC 4TPKA 4MWBA 2DBVO 1VFPA 2BFOA 1H65A 1VL2A 2HK9A 5IM4A 5C81A 1EXVA 3M33A 3ONFA 1RWKA 4G2TA 1QH1A 4DRYA 4EO9A 1JAYA 5KU7A 1LTHR 1UKBA 2B8EA 2PUTA 3TDKA 1JFRA 1ZMRA 2PRKA 1KDZA 3ZC3A 1UP7A 3JTMA 4B6RA 3N2ZB 2E4YA 5JYCA 2FPPB 3DFMA 3ID6C 4HB0A 4PG4A 3FETA 2W6MA 5H0IA 4EY5A 1CRLA 2I66A 1VL5A 3LA6A 2I3DA 4TMTA 3CURA 4L02A 3FYTA 5K03A 4PIVA 2FZGA 1V8ZA 5IAKA 3W5AA 2CDBA 4L4SA 2IEAA 4YV7A 3G02A 1WU7A 3WRYA 3T5PA 2ET6A 3FWYA 2FWIA 1OXSC 1DBWA 2VC2B 1TO1E 3S2GA 4AQ7A 2R6ZA 1P9OA 3MOSA 5JEDA 3AY7A 5JXIA 1OB5A 3AEUA 2CLDX 4ND1A 4BO8A 1UPXA 2HSJA 3A37A 1AXEA 4ZVMA 3FG9A 3PUKA 4KQKA 4CT5A 5JCXA 1XBTA 1Z7YA 4AYXA 1X8KA 4ITUA 3U19A 3GLGE 1IM5A 1G7CA 3U7GA 2XKBA 2VJMB 3ZJYA 3T1QA 3ROFA 4BATA 4JODA 1E3WA 4QU0A 4V39A 5KQMA 3DE6X 3DZGA 1J1ZA 5GONB 1G4UR 4G0OA 2XTZA 2IHBA 1TUIA 3TNDA 1JXMA 1NPYA 1YNSA 4MS3A 1ZD8A 4MTLA 4U3JB 1JLMA 4HNVA 3MJFA 5KSWB 3SVZA 3GV0A 1Z37A 3HVJA 5CR9A 3A1NA 3WNBA 5C53B 5CBKA 3VDQA 3PIDA 3QX8A 4JU8A 4TT3A 5DW0A 4Y6SA 3E22A 4R01A 2MMCA 2WSBA 4N82A 3TXXA 5LZ9A 4XI9A 4CQLB 4MMYB 4TKVB 1RAAA 2Q5FA 1BCRA 1X80A 3ZHZA 4CCYB 1W4RA 1WLYA 4X63A 2CHGA 5EHQA 1DCKA 3P0HA 4D7AA 1EWQA 2G77B 4X6YA 4PR3A 2CBXA 1PLLA 3I1JA 1HORA 1NOKA 2XBLA 3E84A 4PZYA 5A5EA 3S70A 1D2GA 1E61A 1ODSA 1KXZA 1ACLA 1ZI6A 3PSAA 4BECA 4Q4CA 2VIIA 3EAFA 1SHTX 2EJCA 2X6TA 4MGIR 4QULA 1RC1A 4ER5A 4C6RA 2CUNA 1LDGA 1GNSA 2Y66A 3VO8A 2HO4A 1SBZA 5GV8A 2ZRIA 4TKLA 4O4HF 3K7EA 3VV3A 4A1OA 1EUZA 3I9OA 3K96A 2B5OA 3B70A 4J16A 3AERB 1JJAA 3DFZA 1X3LA 3DBHB 4ERXA 3IMFA 1ZGAA 3SHOA 4Y2YA 1Q21A 3F90A 3OWHA 2QRLA 4Y9TA 5HCNA 1GL9B 1LUAA 2BKUA 3BMQB 1ZSVA 1BCRB 1JW9B 1X80B 2WF6A 2NN3C 3FVQA 3LSTA 1YB5A 4A26A 5TF0A 2GJSA 2JLQA 3G17A 3P2IA 4TKVA 3J81A 4YUVA 3NTXA 4E70A 1P6XA 3IO3A 4J75A 1T3TA 3FUUA 1Y4ZA 1G3RA 3TRHA 2PL1A 4X93A 4C4OA 3REGA 1SUSA 1XEAA 3CJTA 4MV0A 4KXLA 4OFBA 5IBRA 1FTSA 2H4FA 5CMLA 5JNLA 1PFUA 4FHEA 1M7HA 1PZXA 2D2XA 4RSGA 5L7WA 1CRQA 1I2MA 2O6HA 5GONA 1I24A 3GT4A 4KIFA 1AB5A 4R2MA 5DOZA 4EVQA 3HKBA 3UAGA 5JPDA 5F12A 3HCPA 2Y0PA 3B38A 2MYTA 1OWPA 3QBEA 4N39A 4O4JF 4M60A 1LW6E 2C59A 3G5UA 1B2RA 1F7VA 4BS9A 2AN3A 4RJ2A 2IYWA 4EKEA 4YMVA 4B2PA 1FMJA 3RFTA 1T1IA 5JVDB 1GAJA 4XD2A 2ODNA 3UJHA 2E5LB 1P45A 3FPJA 3OCVA 2JJ8A 1WMSA 3DNPA 4R1UA 3PGVA 2GNOA 4IFEA 5K0FA 1CULC 1QAMA 3DMHA 2H16A 3DLHA 5DN6A 5FLYA 4FKBA 1OFUA 1DKRA 3DDZX 3KJHA 1Z5GA 2I1QA 4I50A 2VP0A 4FI3C 1JHZA 2HRDA 3KOXA 4NVRA 2FMFA 1XJ0A 1REQB 1N9KA 4WXRA 1ZJ5A 3FMGA 1JLHA 5I4BA 3ZVKA 3H2IA 3KOOA 4RA9B 4HDMA 4Q7MB 2QW0X 1HBJA 4L5YA 3QLEA 4QVKA 4C3UA 5BWOA 2OFPA 4DCOA 1FNSA 4EPYA 1TW2A 3EOBI 3JVIA 3STTA 3KFVA 1IXRC 2OPHA 5FHRA 3GA0A 3HBNA 3H5OA 3PT5A 3RHFA 4BJ1A 2YXEA 5KNCA 1UBGA 2ZE5A 3G6KA 3HHPA 3I28A 3NBKA 3C6MA 2YYZA 1WDTA 1I5OA 4H60A 1ELOA 4LY6A 5EXSA 1MVNA 3WTBA 3S40A 3ZGLA 5E8RA 2ZYDA 4C0XA 1SPXA 5I7VA 1DKLA 3D6AA 3IAUA 4IIEA 4UCWA 1KS9A 2IWRA 4BQIA 2C2YA 2IWHA 3IPYA 4D9EA 1VJGA 3KZ1E 1N2CB 3JU3A 1XSEA 2FMTA 3JALB 3CO5A 1NF2A 2RG1A 3ZWPA 4LOLA 5JPIA 4XLZA 4PX2A 4YWJA 1ISJA 4FJ2A 2CHVA 4QA9A 3WKEA 5TMEA 3MN1A 1HKHA 2YVKA 3D4PA 3IKLA 4D8UA 3G7SA 2VP9A 4FI3F 2XXJA 4WD3A 3LUCA 5LP6A 2VRNA 4ARZA 4UOQA 3ELWA 3TW8B 4GI7A 3UKJA 2WWWA 1FFXB 1M5UA 2XD9A 4RKQA 2RSLA 1BRTA 2AOXA 4YH1A 4E15A 2RGCA 2I80A 5LYJF 1XZQA 1CJVC 1RQRA 2ZLBA 1PP4A 1LK7A 1I9GA 4EG6A 3DLIA 3I30X 2OSBA 5BVHA 1XZFA 3A2NA 1QIJA 3VU8A 5I45A 1YHNA 1ZBQA 1NX6A 2X58A 1OUMA 3F5SA 3LOUA 3CNHA 4GRDA 4KSCA 3RVSA 4ZK6A 2F6RA 1Z39A 5GY7A 3ZDDA 2C4UA 3U2QA 4DUGD 5LB4A 4L51A 1VBMA 1PZEA 2NW6A 3M82A 5KDDA 1FX1A 5ES3A 5AW8A 1DPFA 3TL6A 1UFOA 5G02A 4BVKA 1RT9A 1VIDA 1QHFA 2IHKA 2WWTA 2YWHA 3BB4A 4WA7A 4UFOA 4DNFA 4F60A 5FOQA 2AEFA 2KWIA 1KFBB 3GROA 3HMQA 4Q3NA 5F4BA 3ZCRA 1YS6A 1FDOA 1Q1AA 5A6VA 3BM5A 1M1NA 3D6VA 3AP1A 1DQSA 5BN3A 1DJNA 1L3BA 4MPPA 1ZVKA 4MZDA 3V3KA 2VWGA 4L73A 4J0JA 4A7PA 5KX5A 1TJPB 4RVDA 4NU0A 2L69A 2IZ6A 5L7YA 1XCJA 4UTXA 2O5CA 2ZTHA 3H17A 2EZUA 4JT8A 5JXWA 5DISB 1O9HA 3L0CA 3UJCA 4DBZA 4EENA 3NBMA 3R5SA 3ZU2A 2DM6A 2JI8A 1PWZA 1EFDN 2OV1A 3P9SA 1U8YA 1MC5A 5G1OA 3ZHCA 2DUMA 2WWIA 2P77A 1MFPA 1A5BB 2GS9A 1V37A 3GT7A 4YBRA 1AHHA 1QU3A 2FFAA 1QPBA 2AUNA 3Q7PA 1AHIA 1BYIA 1XL0A 3NEJA 2GJKA 3B9BA 2YMPA 3PYLA 3ZQKA 1AQJA 2IBMA 1GFSA 4UHKA 3EZLA 4JI8B 1IXSB 5C51B 5HJ5A 4LGMA 3ZCPA 5G1NA 5H68A 2MCFA 3UV7A 3CV3A 3HEAA 1K5GA 4QX6A 1OYOA 2FPXA 3CMCO 4LZWA 3IOEA 5BYJA 4C5AA 4JC5A 3L18A 5C3UA 2V7WA 3D8TA 3SIRA 2XHEA 3OU2A 4QUGA 1KMMA 2VHXA 2DFPA 1IXKA 2W6NA 2D54A 2WZQA 2R79A 1P0QA 3G2HA 3NWOA 5BN4B 4B81A 3T3NA 2BUBA 4RVNA 2R1TB 2XMDA 3FFAA 3LUDA 1Z6TA 1KNQA 2EJWA 4Y67A 1E66A 4NU8X 4EPVA 3DTVD 3NP9A 3H4MA 1IY2A 3W5BA 1KK0A 4G81A 4JWTA 2XCSB 2YFYA 1D1PA 3PX7A 1RKQA 3HXTA 1DC7A 3CUTA 1GNVA 4KVZA 1G2QA 4V38A 3E81A 1EUQA 2XKAA 3C5CA 5HBGA 1XCBA 3JPWA 4TTPA 1UXJA 3I3SR 1YZ3A 2Z98A 3OJ0A 5K3OA 4IGFA 1L7QA 4WN9B 2BBWA 1E6UA 1RXCA 2LWIA 2YJGA 1S6YA 2Z4TA 3KLBA 3KR9A 4JL8A 4RHUA 2ZS8A 1PGOA 2GFIA 3OQVA 2VRCA 4I4NA 4Q1FA 2X0EA 4H7KA 3ZLBA 1VKZA 5KX5B 4RSRA 2DKOA 4I5GA 4J7CA 3HRKA 3TOCA 4M87A 3UICA 4YYZA 5HOQA 1WAMA 2CXSA 1KTVA 1G9TA 3BAFA 4IR7A 3V6LA 4CNQA 5JXJA 1P91A 4G65A 3S55A 4BKRA 3CVJA 4HMQA 2WZBA 3DH0A 2JLSA 5AK5A 3HE3A 3GA5A 3SCZA 1HL7A 2A9JA 5AVZA 1U80A 4FOSA 2PMWB 4M1KA 2BMAA 4BNMA 1FRZA 1SVNA 3L07A 1DC8A 1DJPA 4K6OA 3O4RA 2BD0A 2DWCA 2BEVB 1XDGA 1BHSA 1ZESA 1M2JA 2CCKA 2P1ZA 1PR0A 3L9XA 3RUHA 3FJOA 3UXMA 4IHAA 3L0IB 3KELA 5EEGA 2C92A 4XX1A 2A9FA 1QG6A 2GI4A 4TTAA 4NOKA 1HOTA 5BVHB 2IH4A 3U4IA 1TCVA 1R5NA 2Z2IA 5G3ZA 2IF2A 3OA2A 2BHNA 4MI3A 4FUQA 5C9ZA 4LSZA 4MQFB 1ZSYA 1ZU5A 3QVVA 5ICSA 4LSMA 3IKTA 1BD4A 1IC6A 3T7TA 3UXYA 1AKTA 3LCRA 4MGEA 3GVXA 4RVOA 1WA5A 4DIOA 3FCEA 4XQGA 3VH4A 4F2DA 4Z7NB 2XMQA 4QXRA 2P2YA 4DCNA 2C3UA 5DP2A 2C94A 3WOHA 2YV3A 1Z35A 2DBQA 1P4RA 3ZGOA 4C9BA 5CCEA 5A04A 5IJZA 4MQMA 3JZAA 2KPOA 1W75A 2RDMA 3GN2A 1YK1A 4O8ZA 5C31A 5A4JA 3WGVA 4OPMA 1DWUA 2I6SA 3PRJA 1YR1A 5KX5F 4JD5A 2JIZD 2VZEA 3A14A 1R1DA 1L1EA 1JQ5A 2CNDA 2AOTA 4RA6A 5FI1B 1PEAA 1J33A 1MMFB 1X9IA 3H8JA 3VDMA 4BNWA 4DLTA 4DG8A 1I10A 1ZW6A 2GWHA 3KYDB 1J2YA 5DLPA 5CT6A 5DHAA 3KD3A 1K7CA 4Z5XA 5D87A 3ZVRA 5TB5A 2PRJA 3WFJA 4Z49A 2C20A 4XYBA 1H2YA 1A97A 3UANA 4ZJYA 5K8JB 3PG5A 1XP5A 1GD1O 1HDYA 2V5UA 3CH5A 1JL3A 3O7WA 4GOMD 4P4LA 4E30A 2ZB4A 2CUTA 2PUHA 1WU8A 3SC2A 1QO9A 1REQA 4PF1A 1NXWA 4AT1A 4DZRA 1P9RA 1NZJA 1E2GA 1VJTA 2CFOA 5ED0A 4AO8A 1Y8RA 2WY2D 2FWBA 4HAVA 3CLUD 3AXTA 2JI9A 2GYWA 3D6NB 4JNKA 2WUVA 3WRXC 2ZBUA 5DLQC 1FRFS 2OGTA 3MTDA 3LXMA 4UNQA 2FVXA 1TCAA 1NJSA 4MI9A 4YRZA 2QRHA 1DEKA 1E1KA 2WJZB 5I5GA 4FR0A 3IPAA 4M9CA 1W5BA 1S5PA 3HJHA 4NBUA 3L93A 1QE3A 4FR5A 4OYLA 5G4KB 1E2PA 3DONA 4UNSA 2QF7A 4CKEB 3MMZA 3ZS9A 5JWRA 3JAWA 4FINA 3DBLB 1SBNE 1ZJJA 2PKEA 4LC1A 4X3PA 3S7ZA 1ZI9A 3OMLA 4JQZA 2GPJA 3B6IA 3IQIX 1IHYA 3BH6A 3O95A 4EWLA 4ZYTA 5LQMA 3KFLA 4G8BA 1L5RA 3I5MA 4XJVA 3GRFA 5H4GA 5EUQB 1ZZEA 5BR7A 3EXFA 2YIJA 1OZ0A 2GN2A 2COEA 1L5YA 4PLWA 4RAOA 2O8CA 2R2GA 3UK2A 3SX2A 3I01A 5L9AA 1NQAO 2DFDA 3RBVA 1OV4A 3BGVA 2DBZA 4KFRA 2O2IA 4UEWA 4QFBA 4CN8A 4E46A 1YKFA 5CAEA 1TGVA 2MHCA 1NY5A 2OCYC 2QL6A 2QP4A 3A6KA 1G5RA 2WYIA 3GNSA 1K8QA 3L41A 3Q85A 4N6OA 2YWFA 3A9CA 1P81A 3EGOA 4GE0A 1V25A 2ADFA 1VP3A 2GBGA 1LF0A 3PXCX 2QTVA 1JQ3A 2CBGA 2JCSA 1SC9A 4MYDA 3E9NA 1MX9A 1NVVR 4GW3A 4I50F 3TB4A 1Y80A 1IN6A 1PEKE 2VL7A 4EB0A 3ORRA 2ZUCA 1WB5A 3K70B 2MSDB 4Z0TA 2BYTA 2O1XA 2PQ0A 3QIAA 4A5OA 1L8AA 3IIEA 1L1FA 4FYVA 4J2TA 5AXCA 1FNCA 5IXYA 5GMOA 3E82A 5K3EA 4W7IA 3BDAA 4EG1A 3K0AA 1J8FA 1T3ZA 2HIMA 5CYPA 2PX5A 4RORA 1ZD4A 4WDRA 3TDMA 3TTVA 3X0DA 1TRHA 3AUUA 4XDZA 1H9CA 4G8CA 2P9CA 3L92A 2EATA 5T7BA 2JLVA 3JRWA 3W7AA 4BEBA 4DMMA 2A6PA 2A57A 2WK1A 3D8SA 4OHPA 4E5NA 4G24A 2B2NA 3MUNA 3E22B 5DPMA 5KSYA 3KPUA 1Q0LA 2XUZA 1UM9B 3CWZA 3RVMA 2JZCA 4CQJA 3HNOA 4H59A 4HGRA 1PQPA 2GD0A 1B73A 2XPCA 2HL6A 3DGEC 3LLCA 4Q3EA 1E2FA 3EAGA 4XARA 3WP0A 2HWUA 4Q02A 3EXHC 5AI0A 3QJ5A 4M0PA 1HTWA 2JGFA 5FWYB 1P9WA 1WMEA 1C3VA 1Z33A 2G76A 2GRJA 2J3LA 2W2KB 4G8JA 1JFLA 4TL8A 4MB6A 4JJFA 1NWHA 4UMFA 1NXVA 3H9GA 1O6GA 2E87A 2GCEA 4UEOA 1E9FA 3C5EA 2FK8A 1PRYA 3K31A 3LCUA 2C7QA 2R751 3EYWA 3KZOA 2DEUA 4KJXA 3VKHA 2OCBA 3IUBA 2QTAA 2O05A 3TEFA 4G5QA 4BMDA 3ZWVA 4YIHA 5TSDA 3UOWA 1ZHFA 3BYZA 1SFRA 4NHOA 1RYBA 3GVCA 2QIOA 1YB2A 1YV9A 4BJ5A 3VHLB 3EFOA 3LBNA 3MWJA 5CK5A 3ZBUA 3CVVA 4O6VA 3UPUA 4MCJA 4NONA 4QYWA 4V0LA 1KKLA 2IP1A 2GD6A 1MB3A 2PX6A 2YRFA 4EX6A 1P19A 2XGOA 3THXA 1GA6A 4YY3B 3JWEA 5ERYA 1FF9A 4A23A 3I53A 4ZPXA 1OLUB 1FFBA 1N7HA 3O8NA 4QD3A 2P2DA 4HB3A 1AV7A 4MHOA 3QU9A 4MCHA 5B2ZA 1UFKA 2Z6UA 5E7IA 1CFZA 4LZJA 3E03A 5B1EA 1Z45A 2B99A 2ZR8A 3R9WA 2AN5A 2E89A 2J3DA 5F76A 1BGXT 1E0DA 3LX6A 4YDHB 4JMPA 3QVJA 1BXGB 3B2NA 3GPDG 3QVLA 1CTQA 3PDIA 4JN6B 4Y1EA 5JFTA 3FI0A 1T43A 1VPWA 3M6VA 3N8NA 1MOZA 4IS3A 1K08A 4MR7A 4MR7B 5FXMA 3I2KA 2DPGA 3OPYI 3MT0A 1B8UA 1WB9A 3CJRA 1EQ2A 2FLWA 3TIIA 4WINA 3EXIA 3BN3A 4ZARA 4G09A 4YJFA 4L07A 4CIDA 4CEJA 1NFQA 4YRGA 4MSUA 1YL6A 2FDRA 3LWZA 3RAGA 1OA0A 1XVAA 3HCD