1BHQ1

Mac-1 i domain cadmium complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
SDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cation binding to the integrin CD11b I domain and activation model assessment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords CD11B
total genus 66
structure length 189
sequence length 189
chains with identical sequence 2
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1bhq100
3HXQA 3BN3A 2ADFA 3PPYA 2VDKB 1M2VA 1T6BY 1T0PA 3EGDA 5KYNA 4XW2A 3ZDXB 4O02B 3EGXA 2IUEA 4BJ3A 4MMZB 4JDUA 3RAGA 1M2OA 4NENA 2M32A 1NA5A 1MQ8B 2VDOB 4CN9A 1M1UA 5KYWB 4WK4B 2ICAA 3EOBI 2VDPB 1V7PC 1AUQA 3N2NA 1N9ZA 4WK0B 3HXOA 5E6UB 1JLMA 1RS0A 3QA3E 3PPXA 1U0NA 4DMUB 5ES4B 3EFOB 3M6FA 2VC2B 3K6SA 2ODQA 1RTKA 1N3YA 4IHKA 1ZONA 3ZQKA 1JEQA 3NIFB 3V4VB 2XGGA 1M10A 3E2MA 5KYWA 4HQLA 1U0OC 3TW0A 5KYYA 1RRKA 2VDLB 4UM8B 2NUTA 2QTVA 4G1EB 4WJKB 1ZOOA 4UM9B 1ATZA 3IBSA 3EFOA 3EOAI 4FX5A 5KYUA 3NIDB 3T3PB 3FCUB 1M2VB 3ZDZB 3TXAA 5E6SA 4F1JA 1YVPA 1XUOA 4CN8A 3T3MB 1ZOPA 3K72B 5HJ2A 1UEXC 2NUTB 3FCSB 1M1XB 3Q3GE 1IJKA 3EG9A 3BQMB 1PD0A 5E6UA 4F1KA 5KYUB 3K71B 5E6SB 4HQFA 1QC5B 1MQAA 2VDNB 4A0QA 1L5GB 4UM9D 3NIGB 1MHPA 1FNSA 1PT6A 3PPVA 4Z7NB 2NUPB 4MMYB 5BV8A 1DZIA 2XWJI 1JEYB 1BHQ1 3ZE0B 1SHUX 1IJBA 3GXBA 5KYYB 3EG9B 4WK2B 3IJEB 4IGIA 1PD1A 1U8CB 3ZE1B 3TCXB 2XWBF 1JV2B 1QCYA 1QC5A 4G1MB 1FE8A 1MJNA 4WFQA 1YVRA 1SQ0A 1AOXA 2I6QA 2NUPA 2WINI 1JEYA 1BHO1 4MMXB 4IXDA 3F78A 2O7NA 1AO3A 3VI3B 5E6RA 2B2XA 2WW8A 5HGJA 1DGQA 1IDOA 4C2BA 1XDDA 3TVYA 5HDBB 4NEHB 2NVOA 2VDMB 4Z7QB 5KYXB 2VDRB 1MF7A 5LN1A 3ZE2B 1TYEB 4HQKA 4HQNA 4M76B 3K6SB 3BQNB 3EGDB 1LFAA 3EGXB 1JEQB 4C29A 1CK4A 3EH2A 4C2AA 1XDGA 5E6RB 2I6SA 3PPWA 4HQOA 3V4PB 3ZDYB 4NENB 1RD4A 2VDQB 3F74A 4CNBA 3VI4B 1Q0PA 1SHTX 3HI6A 2ODPA 1MQ9A 1IDN1 1CQPA 4PN7A 4Z7OB 5KYXA 2I91A 1PCXA 2X5NA 3EH1A 1OAKA
chains in the Genus database with same CATH superfamily
4OQLA 4YP9A 1M2VA 2FWAA 3A9TA 4G5RA 3TH5A 1V37A 3CG0A 3HADA 1L4YA 3OZBA 2Y2UA 2CLDX 1XJCA 3WBKA 2OESA 1ODCA 2ZAMA 3I3SR 3HDQA 1L7OA 3QY9A 4X95A 1RQGA 5KAMA 5FORA 4L08A 4WESB 1G3RA 4CQMB 2HNAA 4OI4A 4QX6A 4ZCSA 3G5TA 2YVUA 1R50A 1P0CA 1RP7A 2P9YA 4S1TA 3ZCVA 3OEHD 4QATA 4F56A 3RSFA 3NBMA 3CNQS 2I6UA 3THOA 4FUQA 5LOVA 3JWIA 4GOOD 3AUAA 3RNOA 3UUEA 3N8HA 1XRJA 3OP1A 4IDCA 4CV3A 4LWOA 5I01A 3L05A 3NONA 3DT9A 3U3OA 2AI2A 1ICIA 2GR9A 3VO8A 5L6MB 2AHRA 4Q93A 5IUKC 4PLVA 1VIVA 1NVFA 5K01A 3CMMA 1QNLA 2Q4TA 4TMZA 1E99A 4YAGA 5DBOA 1QK4A 4QA9A 3ZLBA 5JWRA 1JHDA 5DOVA 4X85A 2XNDA 4OFZA 3T1YB 3IAHA 1VRVA 3T8YA 2IF2A 4FKZA 3K0AB 1GYPA 4XQ0A 3OETA 5J9FA 3KDSE 2W2KB 4ZOLA 4YN3A 1UBLS 4WLUA 1A4XA 3HVHA 5BQ5A 2QP3A 2W5UA 3E3NA 3RJMA 3QX9A 2R5WA 4MWTA 1CY0A 2VYND 3KP1A 4YMTA 5T7BA 1IOVA 2FXVA 3TRKA 2KSQA 1Y6FA 1TL7C 1YOVB 2G8LA 4G5XA 3U62A 1BRTA 3WLJA 1UDAA 3UKJA 1T8TA 4OLFA 4BC0A 1KOFA 3CO5A 1WJGA 1I3CA 2MYUA 3HA5A 1Q57A 3IEUA 2WNIA 1SO8A 3BZUA 3I52A 1FRVA 2O19A 3COSA 3BJMA 3KUDA 3ZOKA 1FP7A 4XVUA 5CH5A 4GR5A 4FONA 4DDHA 1P80A 4KMRA 2C0PA 5CIWA 3CU5A 4IVRA 3PD1A 3RV3A 1NZJA 5DNEA 2IYSA 3IJEB 2VWGA 3OOEA 4NE9A 4I46A 1DSSG 3FUXA 1KVSA 4C0HA 2UYGA 2CHGA 2ZRCA 3O3OB 4MKGA 1DEHA 3H9UA 3UAYA 2Y3IA 3D8SA 3W04A 2O3UA 4NBRA 3VDMA 5JNRA 4M1EA 4AULA 3EASA 1SH7A 1ZIXA 2RI6A 3V8NA 2Q3LA 5CLGA 4ZAFA 4OLAA 1T9CA 2FDXA 2NGRA 1RZRD 5HIIA 3RRJA 3SLKA 2C8JA 3ES9A 3IOMA 3C41J 4OXYA 5L8VA 4B8ZA 3NWJA 1XZGA 2PMCA 1SRQA 2Y1EA 4WNYA 4XGQA 4EJ2A 1HDXA 2QRGA 2NU7B 4UHFA 3IAXA 4WUTA 3BWVA 4J1TA 2PZBA 1Z22A 2NYRA 1XA4A 1XTIA 1P9LA 1YKFA 1YIAA 3C4JA 3RYHB 3KIPA 1ZOLA 4G5YA 3ER6A 4OX9B 2QTZA 4BP8A 4IOLA 2ZCUA 1OV6A 2J5XA 1LK7A 1XPOA 5LWHA 3ZKAA 5C1OA 1AA9A 4KX3A 4Z99A 3QWIA 3MOIA 1X38A 4QDXA 2E1PA 2JF0A 3HJNA 4ZA2A 2W37A 3R6LA 1C14A 2YV1A 4L16A 1U1GA 3AUUA 3DTVB 2OXIA 3ZDXB 4DLLA 3ZE8A 2H52A 1JT2A 4IUBS 5K3FA 2QG4A 5A3RA 3KKQA 1PW7A 2BHNA 3NC0C 1YCHA 2XHZA 4A82A 4CMEC 2FX5A 2ONJA 4CLHA 2VP5A 3AEKA 3W6UA 3FYCA 3OKFA 3CVJA 4Q1EA 2H48A 3H1FA 3RR2A 5A5VA 3AVWA 2W6CX 3E70C 4DYHA 3OU2A 2H1RA 5J47A 5JCJD 4NZZA 5BN3A 1FXWA 3ILXA 3QLVC 1HK7A 2ACWA 1NM5A 1HORA 1XZIA 2QW0X 3U4DA 4Z53A 4QM6A 2IYUA 1Z06A 2VUSA 1U5CA 3KLOA 4P53A 5HYVA 3ZGXA 4J75A 1FMTA 2XW6A 2WD7B 3DAPA 3HU5A 4CUZA 1VP3A 2P3LA 2NSHA 3ODPA 3JPWA 3SZ3A 2C0CA 1IY0A 3THRA 4EFKA 4HADA 1CQXA 3PA8A 5CFRA 5EJ6A 5JZSA 3UK1A 2DQZA 4LZOA 3K7EA 4NYIQ 3B3QA 3RU7A 1GCUA 4BLQA 2EZTA 2XUGA 4RVUA 1P3DA 4G07A 4FYHA 3EBLA 3ADBA 3U5ZB 2QRZA 3DO6A 3HKDA 1PTJC 1UKYA 3HCNA 5BWNA 1TIKA 4A1OA 1OU0A 2H3HA 4XB1A 4F5DA 4JI6B 1K0UA 4KQCA 1AKVA 5FUQA 1KK1A 2F43B 2NPOA 4QUIA 3NRBA 3I8SA 3SE7A 3IDFA 1WCIB 1ZK0A 3MMPA 1RYNA 3F6YA 3K9CA 3TZLA 1P7PA 4C3UA 1OGIA 4YCDA 4YWHA 1G60A 3PUWA 4CT0A 3C6KA 4AYWA 4YMGA 2D1QA 2PS1A 5J58A 2CKDA 5JG7A 2W98A 2YXEA 4EH1A 2LXNA 3EZXA 1NYLA 1YUNA 1PFVA 3AQIA 3EW7A 1G18A 3OX3A 3R9XB 1T9KA 2FEKA 2NMVA 4RVCA 1B6TA 3DEFA 5LA6B 3WKAA 4EEZA 1RMTA 1W7AA 3WYBA 1LCIA 2D2IA 4TVSA 1O0SA 3LY5A 4IKEA 1JFRA 5DTEA 1KJZA 3KB1A 2VHWA 5AKZA 2HZ7A 2ZRLA 1QX4A 3RKUA 1X80A 4I4TB 4UTRA 4F91B 4U2FA 5ERYA 3LDFA 4AT1A 3DLCA 3W05A 3COJA 2MYTA 2QP9X 2ONCA 2P2DA 4IIFA 2O7NA 2IOFA 1JFLA 3JR7A 1ESNA 4PFJA 5EMMA 3FUWA 5IVDA 4O8ZA 3TFOA 3SDZA 5ALNA 3K0BA 2ZULA 3ZVRA 2OG2A 1NX6A 2J0EA 3WG9A 2X9VA 5DVZA 1R8XA 3VV2A 1VHWA 2EDCA 2NTNA 2OM6A 5ARBA 1RHJA 3QTBA 4WOPA 5DXFA 3RBAA 5E9WA 4QO7A 2RHWA 3IL2A 1XRQA 4JVSB 4KQFA 4OV6B 3K0HA 1I4OA 4XCQA 4EVQA 3CH4B 3IB3A 3WYAA 2PNFA 2PZFA 4K9QA 4Q3CA 1DJMA 5IT4A 3NOXA 3TSCA 2B34A 2HF2A 3REGA 1UBEA 1EINA 4J7UA 4HYEA 3I2JA 1SCIA 1P1KA 5LQKA 2NQ8A 1AMOA 1EXDA 4QU9A 1Y1QA 3A4YA 3M4ZA 3NW9A 3R7WB 3I8OA 3GUCA 3PC3A 3LPLA 2A0YA 5A1TA 3F3YA 2R7AA 3GRCA 4LFBB 4R2WA 5F2OA 2Z8XA 3LBHA 2PUWA 1N2CA 1SHZA 4K9PA 1S2DA 2HQOA 2YXLA 4TM7A 1JQ5A 3RAGA 1AA6A 3MJRA 1D2EA 4NMHA 3FE2A 4R2LA 1PZHA 2CWWA 4ZCIA 4HTFB 4OOEA 3DDWA 4IUYA 1GFWA 4BGVA 2KB0A 2IGBA 2PQMA 3CH7A 4ZIRB 3D6JA 5EFOA 1E6CA 3VAAA 1M8FA 2G07A 2O1XA 3R0ZA 1QP4A 1TYCA 4KR2A 4BZZA 1E1MA 3R0QA 4MYCA 1U1EA 1YRYE 1TECE 2FUG1 4U5XA 2QKYA 1N3YA 4PYLA 2B25A 4IHJF 3I0ZA 3CUVA 3G9XA 2CE2X 3WNZA 4CM7A 1T9HA 1H23A 1SVLA 1JU3A 1MVNA 2NXJA 2P69A 3OIYA 4MGIR 3PUJA 4H7FA 1RYYA 1CV2A 1BQ3A 2BUCA 5D3MB 1KO4A 3PT9A 2HQRA 2YV4A 5AHKA 1OREA 2RHDA 3WQRA 3D0OA 1L4UA 4YAFA 2EU8A 3SIWA 2W9XA 5LXTF 2IXGA 1I3OA 2D8AA 3FFBA 1YI0A 1TZCA 4JIGA 4MR8A 5AJXA 4RENA 4DPKA 3RH0A 4JI0B 4B3JA 3K6KA 2PZAA 3A9VA 3QMMA 2AUTA 4JITA 1O6BA 1REQA 2EWWA 2Z5LA 2GAOA 2VPTA 3IKTA 4AZ3A 3JZFA 4JVLA 2VF4X 3FNFA 4RH0A 3CZQA 2RK3A 4FEYA 5ENDA 5M04A 1T5IA 3SSNA 2O8CB 1CEEA 2JRCA 1BFDA 4OHRA 4P1ZA 4ND7A 3E48A 2RKBA 1EB9A 1H93A 1QONA 1ZL2A 3FJ1A 5IYZA 2XYQA 4LYAA 4KWTA 3KZCA 5C18A 4L8WB 1WBDA 2F1KA 2HJVA 5F7XA 3JQBC 3Q7EA 2G6BA 2WHPA 4CNQA 3FBWA 1E69A 4RADA 3IQIX 4CEIA 2JBHA 3A26A 4D79A 3QJGA 2WYUA 1QSGA 2AHOA 1XJ5A 1EG7A 1BU8A 2IZ1A 2W2QA 3GXOA 3NDJA 4Z9FA 3EA0A 5TVKA 4XWGA 3ABSB 2X8BA 4J6EA 2FF7A 3ZN2A 3T7RA 1KVUA 4GQAA 3M6VA 3RGWS 4PGGA 3NMUF 4I4IA 1JECA 1IQ0A 3SYRA 2XGOA 3BHMA 3LCJA 5GJVC 4DNOA 3DBRB 4YT2A 4Y2JA 3H8VA 3VR6H 1SZCA 5BR7A 5L51A 1SBZA 2BGLA 5JI2E 4YYZA 1QZTA 1Z6PA 5CYOA 1R8QA 2Z9DA 4DMHA 4F6RA 4ZT2A 4WZBE 5AD1A 1U6JA 2XJ4A 4ITVA 2KBFA 5IJWA 1NUQA 2E55A 3V7UA 5C81A 1RLIA 5KYTA 3LHDA 2OCPA 3F3MA 2ZU6A 4PG5A 5JMWA 1R0XA 1K4YA 3GJ6A 3OPQA 2KBEA 5A5GA 5F2NA 4ARAA 1R6BX 4Z5XA 3HMQA 3L7AA 3EGVA 1T3ZA 2R1ZA 2P7HA 1NW3A 2CLCX 3CNHA 3KT8A 3QF7A 4OHUA 4PO1A 1O0CA 1AO0A 5KQRA 5JS6A 3E0XA 1G8HA 2F2TA 3RNLA 2JAQA 3V5NA 4AURA 4EHIA 4EY3A 2H4WA 1IQPA 2Y93A 5EKXA 3TR6A 2YWXA 4RULA 3UV3A 1NN1A 2IPLA 4Q9JA 5L4SA 5J2UA 1VKRA 1VL6A 3E9DA 1AZWA 1W581 3DR3A 4P93A 3K3PA 4MO2A 3RM3A 3GRUA 2FN3A 1IHPA 5DM1A 2HWXA 3TPFA 2J6CA 4WK4B 3TQOA 3UMGA 3GPBA 1JDTA 2A0XA 1RPZA 2JASA 4ZEOA 5B4UA 1USGA 1VE3A 3UK2A 4HDAA 2WKRA 4FFNA 2B9EA 2B8JA 2QUIA 2GBGA 3T7KA 3W2EA 1BW9B 2CB9A 2HA7A 5EUBA 1QOPB 1KYTA 2J07A 2PMWB 3EMKA 3KVRA 2Y1KA 1U2GC 1YHYA 3ILVA 2FG6C 2PWYA 1RCTE 1P1IA 2QORA 2ZZNA 2L18A 2PVSA 4HB2A 4OUKX 4P36A 1WIWA 3GELA 4HAYA 1K3FA 3RU3A 1UCFA 2AMLA 4DVGA 1X86B 2EBUA 3UQZA 1IOLA 4O2RA 4XSVA 4IYRA 3AWDA 1EH5A 2C2MA 1SD2A 3OY2A 5IJXA 1XB2A 5KWSA 1E8NA 2Q1SA 3MOSA 4G81A 3UFXB 3LLMA 2R8OA 1HZJA 2HT6A 3AX6A 3T3MB 3U2QA 1M6VA 3KXKA 1G9SA 4EF5A 2OLJA 2PBFA 5HJ2A 3EX7C 3TRHA 1W29A 2XDWA 4PLYA 1V2GA 2FOIA 2HDWA 3KQVA 3UWSA 4LJRA 5HZGA 2EEPA 1M2EA 1JZSA 2FFBA 2VNAA 3EG9A 2EX1A 4LRUA 4COOA 1I3NA 5KYUB 3R9WA 2NADA 4MHTA 3MWKA 2WZBA 1SIBE 1JI0A 1ZPDA 3LX6A 2P75A 3FTPA 4K2HA 1D2MA 3PWSA 5ARDA 4P3KA 3PPVA 1CG6A 4MUFA 4E21A 5CA0A 3RK1A 2NXNA 3HVUA 2B35A 3KYJB 3I6ZA 2JAUA 3WOHA 1IJBA 3P4YA 1JG7A 4JX9A 1K98A 1X0VA 2YJGA 1XOIA 3RHZA 5K3OA 3MHTA 1ENYA 1HQDA 4ZJUA 1D0SA 3KJXA 1N2ZA 2XNKA 1QQ7A 4D0GA 2JJ1A 3AF1A 4DWJA 5JUWA 2FG5A 3HY4A 2JCVA 4TPKA 1NQXA 4LDAA 4FJ1A 1ZCJA 3BTSA 1D2NA 1SOWA 3QOFA 4YCAA 4FHGA 2V97A 1JKMA 4KMMA 1DT5A 5BWLA 4MLZA 4D4JA 1TLTA 1OLXA 1ZRMA 2Q3JA 3VU0A 4UFPA 3NI2A 4FOSA 2FMIA 2CF5A 4HUJA 2AX3A 3K92A 4KKVA 4OJKA 3KHTA 3SD7A 3GT0A 3INTA 1XI2A 4N8SA 5TX7A 4JBYA 1H1DA 1O6GA 4XWYA 4MRVA 4RTOA 1Q2XA 1JQLB 3DL0A 1ZD3A 5ES3A 1SKMA 1BS9A 4FHZA 3CLTC 4GMDA 3V7FA 1KK0A 2WK1A 1UFVA 1TTQB 1V6AA 2I54A 4F97A 1Z33A 2WT9A 3N2YA 2JFFA 2O5CA 2V8OA 4UHHA 4ENSA 4IUCS 2BEWB 1QP7A 1ODLA 2SCUA 4N76A 1RWKA 1E3JA 1MRSA 1QRDA 1RIFA 1UUFA 2RGXA 1UF9A 1ZP6A 2VRBA 2X2FA 3DPIA 2C2KA 5KCMA 1PF7E 1CY2A 1UWLA 1K66A 2RB4A 1OXTA 4O1HA 4WNCA 3S5UA 4EELA 5EE0A 4MV0A 1M7HA 2A9JA 3CYFA 5SV2A 4QOEA 5EIBD 2C8KA 1Y3AA 3PEUA 2XXJA 2OA0A 1EVQA 3AR6A 3L5OA 1Q7RA 3HKDB 1R1DA 1HRKA 1LSSA 3ILHA 1RI2A 4HCJA 4KAAA 5IC5A 3UJ9A 2EGUA 2TYSB 5IC4A 2DZDA 3AM4A 621PA 1XDSA 2YZGA 4ZTUB 3JVIA 3UMBA 3SAJA 5TF0A 3O9ZA 2ZJOA 5AWFC 3LM8A 5LMZA 3J81A 3BSWA 2RMKA 1M34A 5DF1A 2V5UA 4JSTA 2B0JA 2GZDA 3S68A 4PZAA 2F9FA 3PE4A 2PLNA 2R7MA 3EVBA 4TT3A 4KV7A 3TGWA 1ARZA 1NXOA 2XOEA 1DXHA 1PX0A 2FV8A 2QT9A 3C1TA 4L6CA 5IW8A 4A2CA 5BXQC 5MN5A 3PUXA 3G9TA 3Q5EA 4FNOA 1OD6A 4ZN6A 3A0RB 1T3TA 3IERA 4N5DA 5C8XA 2JK1A 5G0SA 3KB8A 2D8MA 2E37A 4X6YA 3NX4A 5AVSA 1SMKA 4LE0A 1DRVA 1Q7EA 2QWXA 5AVXA 4QUAA 1PG0A 1ORHA 2RJOA 1Z2NX 3MN1A 4NOMA 5DNYB 5DULA 3K20A 4RTMA 1A77A 1Y4DE 4KXNA 4NZNA 3AM5A 2KM1A 4O4LA 2BDUA 3IUSA 2QMHA 4MS1A 2HPAA 3UQYS 5HIMA 3USZA 3W77A 1SB9A 4GOMD 1V4NA 2HBQA 4MUXA 4Q16A 3PEWA 3N2KB 5CW1A 4YI5A 2QLTA 4Y67A 3HP4A 2AW3A 1H5QA 3RODA 2DPGA 4DV7B 4Y9SA 1IHUA 1E0JA 1VI6A 2FSFA 4BP9A 2DMRA 3OLZA 1CS0B 4B09A 4UM9D 4R8MA 4RZXA 1M6WA 3D0KA 5JBIA 2P9EA 4RY8A 4IOMA 4RAQA 5BSFA 2PFKA 4EG0A 5ALQA 3N3BC 3ANTA 3N8NA 5CDFA 4CKCA 3QF4B 5K5EA 1RACA 4MPJA 1RM5A 4N40A 2A33A 3OQNA 2GM4A 2J9XB 3GGOA 4LX0A 4YJHA 3A6PC 1PJAA 1VLVA 4J94A 4Q9AA 4WK2B 5A9SB 1GKKA 3KOUA 1G2OA 3L4EA 3I4CA 3BS4A 3I05A 4BNXA 3U0VA 5C5CA 3MMZA 3W5CA 1KFKB 3A58B 3AEYA 4BUJA 1PV1A 3HP7A 3HPQA 2C5BA 4IVPA 4MWSA 1M74A 3JASA 4GL2A 2UZ0A 1XPJA 3O1JC 1F0NA 3NEPX 4X0EA 1ITZA 3LBYA 2GRJA 2OMKA 1Y5RA 3FBTA 3VQTA 1WZ2A 4R01A 2Q5LA 3PLAE 5TMPA 4KZKA 2R4TA 4KKXB 1JHRA 1N9GA 4XIYA 4BNKA 1L1EA 3NEAA 3HVJA 1B4DA 4V3CA 5EJIA 3TXXA 4CLRB 4EY7A 3S81A 1XTQA 3JWPA 3GF4A 3NBUA 1V3VA 4F8EA 1S2IA 4OX9Y 2GCEA 2I7TA 3E7PA 4GGPA 1I3LA 3L0YA 3Q9UA 4DSZA 5JSFA 5U9CA 4OY3A 2VAVA 3JWJA 4E2ZA 3A6LA 4K1LA 3EH1A 4ZAZA 8AT1A 4PAWA 3EF3A 5AK3A 3CUSA 2V6FA 3EEQA 4UE6A 4ZI7F 4I3FA 2EHJA 2I33A 2Q2WA 2YY7A 3AEQA 2VG8A 2WAAA 4FFVA 4P3OA 5FI5A 4DABA 1ZMOA 2JHGA 5LDHA 3WKDA 3WA7A 1H0HA 4KR0A 4DQDA 3NIWA 4US2R 2OXFA 3GA7A 5H5JA 4EVIA 4Y6RA 2FLVA 4B1FA 3GLGA 1ZHFA 3QWAA 4EKGA 1WW8A 4CEJB 2ID8A 1GL3A 4AIIA 3DEHA 2QY9A 1SR8A 3SYNA 3QMPA 4XRGA 4GRDA 2YYZA 1N9KA 3CB4A 5HZKA 2HC9A 1XTKA 4MJXA 3W4IA 1AVTA 2PD3A 4EKIA 2E89A 3FFXA 5L45A 2XE4A 4J7AA 2VF8A 2QEQA 4FOLA 3DLIA 1IBCA 3FRJA 3VNUA 2WJIA 4NMWA 4M1KA 3CN7A 1KK3A 5LZ8A 1VMIA 1Y4ZA 1HO3A 4LJLA 1XDZA 3KWMA 3MWYW 5H70A 3B36A 1PJ4A 2QGNA 1E6UA 2I22A 1G2PA 2RAPA 1P7CA 2BLNA 2Q2OA 3FHCB 4TSRA 2BFWA 2H8KA 1KU0A 2WYIA 4BL5A 1AZSC 1CT9A 1Z7GA 1B41A 4HEA6 1FUIA 4E31A 1E2GA 4YLYA 1IAQA 1U3TA 4RXTA 5HRCA 4V24A 2R86A 4XVQA 1VJDA 5LIRA 1CULC 3DE4X 3I73A 4KFRA 5K6RA 2EG5A 2NW6A 3EG5A 3A1DA 4PE5B 3RAJA 2D5IA 3R7AA 3BIJA 4OHCA 3GR6A 3LUHA 1O1YA 1U7PA 2WJJA 3PLNA 4AJKA 3U1TA 3CLRC 2I78A 2NVWA 3KYCB 3RYIA 5KOJA 5D5QA 3AEXA 3B8EA 4IOKA 4Z0PA 3X0DA 3RREA 2YZ7A 4DCTA 4L3OA 4R7GA 1R0CA 4YCMA 3DVAB 5BNZA 1RBZA 5EUQB 4Q4HA 3FUTA 1H6AA 2QD4A 1VPLA 2ONKA 1BQ4A 1JTVA 1SUPA 2X14A 4NBUA 3VU1A 5IDWA 2OK8A 3OT1B 4XPIB 4B0PA 1F20A 4RZQA 1YTLA 5JADA 4EW6A 4DR3B 3W9YA 3HJHA 4H6XA 5ALOA 3RS9A 4A6PA 5IX8A 5C34B 4ZHQB 5F73A 4BO6A 1LLUA 1M67A 5TLSA 3KSMA 4BBPA 4ARZB 1M76A 4BRWA 2G25A 4Q3KA 4GRAA 4MAAA 4X71A 1PVVA 1ND6A 2Y71A 4P7KA 5CCEA 1CS4C 3DV9A 5E4JA 1LY1A 1R6AA 2B1IA 4ZT6A 3R7FA 3TOXA 4Q4CA 2UUCB 4QHYA 1R10A 3CKYA 4XWKA 4YJHB 1Y1KE 2OBNA 1YF3A 3DCJA 2Y9MB 4URZR 3CIFA 4EFNA 4ABYA 5A7FA 3D1LA 2A58A 4QFBA 2OGWA 4G5FA 4MGEA 1P77A 5CB4B 3B7PA 3DEJA 4L2IB 3ITKA 3W8NA 2I4LA 5G1OA 3WB2A 1NHGA 4WT7A 4EY5A 2FSSA 1H66A 2EBWA 2L69A 2NZUG 4B3BA 1N6RA 3O82A 2D6FA 3B1XA 1JDBB 3AONB 2X0JA 4MWEA 3PDCA 1T3LA 1JVNA 5IDXA 4QICA 3T0GA 1TCVA 3TLAA 1CRLA 4CG2A 2QNIA 3IKLA 1D2HA 1EVKA 2JCBA 3IT1A 1LLFA 4BE4A 4OI0A 4OMFG 4G4IA 4B4WA 4CMAA 2R47A 3AI1A 1YZYA 1X39A 2DUNA 1QRSA 4RNDB 1GAEO 3TOCA 3WY9A 1L7RA 1QG0A 2FSGA 2R1VA 4CN9A 3I1JA 4E4RA 4QTYA 2V7BA 3T9CA 4D9IA 1PLLA 3I6BA 4K40A 3VTAA 5K4HA 5IBQA 4GG1A 3PL1A 4HMPA 4IHQA 2PIDA 1U2GA 1NC3A 1D7AA 221PA 1DO8A 2PMFA 2FWBA 5HKKD 4M22A 2ODQA 4L8FA 3R7BA 4AC9A 2ATCA 2PR2A 3EEIA 1XROA 3I23A 4LHXA 5GPBA 1DBPA 1ZU5A 3D2CA 4FNAA 3A14A 2YN2A 3MINB 4H7IA 1TF7A 4QUGA 2V8BA 4JGBA 1I4TD 1H4QA 2KHZA 1BXZA 1A9RA 3HCBA 3HL4A 2JZCA 2QA5A 1TEHA 5CMLA 5IYZF 4DSTA 1LB1B 2NACA 4GRIA 2WKQA 3SJZA 4KAFA 3DKKA 2BFCB 3QU9A 4MJ3A 1DTWB 1QQTA 1ECLA 3SX2A 5DSXA 4ZICA 3RAPR 1KR2A 1NXTA 2CFOA 2ZRHA 1BMTA 1YAHA 3Q8XB 4FZVA 4MEJA 4NAVA 1PL6A 3VPHA 4GBED 3LYAA 4ZOEA 3LPAA 4ZQIA 1DAOA 4GOLD 4YR9A 1X9GA 2AD5A 5J1TB 4EPTA 4I50A 1LI7A 3NH9A 4ZAXA 1TZKA 3WR5A 1KAMA 1STOA 1DO0A 4TUYF 4UU0A 1WM1A 3CISA 3ZDRA 5LU8A 3RVBA 2IK8A 3PRKE 1MTOA 3QFHA 4P4SB 1AQNA 3CC8A 3DV0A 3DNFA 2VJMA 3FF1A 4DPMA 5JPIA 3OMXA 1GP2A 4G36A 3LSTA 4M49A 3GT3A 1JHAA 2WHEA 1IAVA 1L8AA 5CIQA 4B0OA 2VZEA 3PE3A 1XALA 3OX4A 4BVHA 5KJCA 2RG1A 2PJUA 4WJZA 1BN7A 1T34A 2NTYC 4EPWA 1IVSA 2WB2A 2VPWA 3O95A 4WX2B 1UBGA 1X3SA 3L6CA 3FTDA 4H16A 3DB2A 3EDCA 3PJGA 4HYYA 3RRMA 1FE8A 1WSWA 1YE5A 1CZNA 4YUVA 2I2AA 1QLWA 4AUKA 3G8YA 1KEPA 5HK9A 1U3DA 3RS4A 4AD8A 4F4CA 5KNDH 4MUNA 4MDEA 2I65A 3OT1A 5HQJA 3U4IA 3UKDA 3WRXC 3BSFA 3EEBA 5E6RA 3UAVA 2HDOA 3EVGA 1C8VB 2W8ZA 1ZSYA 2RI0A 4E2XA 5ECDA 5TXGA 4BGEA 2X8JA 3KLNA 5KYXB 4J0CA 4ZANA 3PRYA 4IWXA 4KH1A 4D8YA 1FTYA 1M34B 2XEDA 1Z4MA 2IYQA 2VN8A 4CMIB 1X13A 3Q7QA 1D5WA 4RK6A 5C8YF 2DFNA 4DWWA 3WMEA 5ANRB 5BRNA 3WAKA 4FEGA 2HJ9A 1FSFA 1EXVA 5FYDA 1S01A 2X22A 3ZI7A 2HFKA 4IVQA 5GINE 1T1EA 2H7VA 3GH3A 1LNQA 1NTOA 2CNLA 5EPEA 5C53B 2B4RO 4ZGWA 1ID8A 1P39A 3B6EA 5AH0A 1UAAA 1AIPA 5JD4A 4FYYA 2DAPA 2CMGA 3CLHA 3Q0IA 2VJLA 4MS4A 2GBLC 2FWPA 2V6IA 1G7RA 2FP4B 3NDPA 1CRWG 1H2XA 1USVA 1EK2A 1QYRA 2GJ4A 2YV3A 3W3AH 4RESA 4KR9A 2JKZA 2QRQA 2HN9A 1JDUA 1N2IA 3F7MA 1RYEA 3GJ7A 3IODA 1TA9A 3ND6A 2RHJA 1HE3A 3F96A 1FTQA 1LQTA 3JZDA 3CGGA 4BVFA 4O3MA 1DQNA 1J5XA 4GMFA 4ONEA 1MXHA 3DVLA 3IE1A 2XZTA 1KI7A 1JDVA 5E6UB 3G5UA 4UCQA 5ENVA 1KGSA 3I53A 4KRGA 4PONA 3CF4A 1FYDA 3PPXA 3ZBUA 1VG0B 4XLLA 1NR5A 3UMFA 1OXUA 3AESA 3NTOA 5AHRA 3V4FA 1EJ6A 4D0NA 5B6PA 1K63A 5IJ0B 3NHMA 1D4AA 2G0NA 1ZHOA 5EKTA 1C0EA 4BAGA 2OHOA 1E2JA 1J0EA 1Z0SA 3AYZB 1NQVA 4G37A 2H07A 4I99A 1JQBA 4ES6A 1XXHB 4RV5A 5KNCA 3QIAA 4NBLA 3ROZA 4EKNB 2NP7A 1PFQA 2H08A 1AB6A 2G70A 1YZUA 2IIBA 2VTDA 2ZRIA 3OECA 1GPNA 2E5LB 3K9BA 3H0KA 4I0WB 4ENVA 1N75A 3EIXA 3K8YA 2GPWA 4IR7A 3B1FA 3T3PB 2QT0A 1QLJA 5TGZA 5BNTA 2EKLA 1AKNA 1E3WA 2RHRA 3CM0A 3C45A 1RWNA 4CKWA 3AUSA 4AY2A 4UAJA 2SNIE 3WGUA 1G3QA 2L42A 2R8YA 3A4TA 4KUGA 4RWEA 3VHXA 4MVJI 4PYRA 4QDKA 3NPAA 1W75A 1UQTA 2J5BA 4P9NA 3MNFA 2OQIA 4Q00A 3SZRA 2V6MA 1KMCA 2WSIA 2IU0A 2GKOA 1X7XB 4ND3A 1L4FA 4S2UA 4EYEA 5BWCA 2AG0A 4U7DA 1X74A 1PKEA 2QT1A 3B70A 4BRZA 3TNDA 5CA1F 4CLRA 2DULA 4UCWA 3NDRA 1Z2CA 2I29A 2BTQA 1H6CA 1R0RE 4YRGA 4PNPA 3TLBA 4GI2A 3EVFA 4AS2A 5JYCA 5BVGB 2OCIA 3CA8A 4XWOA 2BCGY 2P65A 2WICA 3BF8A 1U0EA 1BEUB 4QNNA 1K8QA 2GZRA 4YAOA 1GCAA 2C9MA 1UMBA 2ZJZA 1SVUA 2GCOB 4R05A 4NU0A 2MSDB 5E7MA 3O83A 1VKOA 3WGVA 1X8LA 5JOQA 3SU8A 2KW5A 4JUBA 3UCFA 5BW5A 1ZIYA 1G9TA 1N5KA 2AUMA 2VJBA 2XE8A 2FVXA 3WK7A 2YXBA 3PFGA 1BCRA 3G0GA 4XSGA 3KQQA 4WECA 1P45A 2I2WA 3U39A 2XQKA 3WJ1A 2O5VA 1PDVA 2GKSA 2QN3A 1GA6A 2ZIGA 3CBGA 3U7EB 2N1MA 5F21A 4ZCMA 3PDHA 2PGDA 3C4QA 3WP1B 2N0SA 3DEZA 3WYNA 1LI5A 2CD7A 5DK6A 1KEEA 4IJ5A 2IXEA 5E6RB 2I3ZA 2LDBA 4NENB 2G9ZA 3L7YA 2M6KA 3JWGA 4B6PA 4AF8A 2PGAA 1WD7A 3G8AA 1ZSVA 3IP6A 4FI3C 1WLYA 4BO9A 4U7FA 3CN9A 4RDXA 3M6LA 3LBIA 2G3YA 1NF2A 2HY7A 4WOJA 1N6PA 3EXIB 2I80A 3JD1A 2A9KA 2O8NA 1DRUA 4PINA 3RYHA 3OSUA 1U28A 4MZXA 5JDIA 1VSBA 1ODTC 4JVMA 2NN3C 3H9CA 4I8IA 3UJ7A 3TRDA 2C7RA 3WC4A 3VR6A 3LC2O 1XWWA 2V58A 4BNFA 1WSBA 3MZ0A 2WUVA 1FMCA 3OE1A 1E64A 5LYJB 2XB2A 4KGZA 1HL3A 3QEAZ 4I4CA 4C0QC 3BH7A 4L5YA 4NRDA 4RZ2A 1QFJA 1JB1A 4A26A 3MT8A 2BEUB 3BDIA 4IEEA 1MB9A 4CTNA 4IG9A 4LXYA 1IEVA 3KZKA 3Q1KA 4ND2A 4H08A 1EVLA 4ER5A 4EJMA 2DEUA 1WSDA 1WUTA 2F4NA 4O2BB 3PGKA 3ZXYA 2G06A 3IMGA 1G3MA 1T5SA 3HP1A 4MUYA 4HLUC 4CHTA 1E59A 3FTFA 2I6GA 3M6MD 4KQHA 3V3KA 4URHA 5DLQC 2WSLA 2A7QA 3PVZA 1MGOA 1DKLA 4PX2A 3DE3X 5G2OA 1O5IA 2O0HA 3EGOA 1ULTA 3TW0A 1KBZA 1CCWA 2H92A 1C9MA 1E4OA 2ZS9A 4QBFA 3GLFA 1BE1A 3U44B 2CN1A 4R1MA 3GJ5A 2WFZA 1A8UA 1I80A 3UJ3X 4ARZA 5DLYA 4N49A 5GAJA 1UXHA 3AESB 3CRMA 4N3CA 2B82A 2W42A 3P9KA 2G40A 2UZ1B 1IVYA 4OSOA 1HMPA 4LOJA 4RTNA 3NYRA 2FK8A 3OT5A 4MQ6A 2PKQO 2XB6A 1HT0A 5DI3A 5LC1A 4JLNA 3NBYC 5DU2A 1JLLA 2UVDA 4BFSA 4B87A 2QXYA 2MT9A 1O77A 4X1KB 5E1MA 5IVKA 2VZLA 5DGHA 1QRUA 3LI2A 2LBPA 3A28A 1PQWA 2AMVA 4ZDWA 4RSGA 4TXMA 4L9AA 3KNZA 4ISCA 2I1WA 5GVRA 2J32A 3T7JA 4C4TA 1MO3A 2CEAA 1ZGHA 3DMRA 4LOLA 5BN3B 1W46A 1K7SN 1N2CE 1E3WB 2VJDA 4FW9A 4XE5A 3U60B 1PI3A 3GYGA 1CEYA 3H05A 4R31A 4CM9A 5JI3E 4JI5B 5FLEX 4WKGA 1Z37A 4Q9LA 4MXDA 2DLNA 4LY9A 1G6Q1 5B12A 5B1YA 4I08A 3QVVA 1LU9A 2GXQA 2FPKA 3I9OA 2ANCA 3SM9A 1H2FA 4RCYA 5AUOB 3NTRA 3EZGA 3SR0A 4L8VA 4M1QA 1W48A 4JVNA 3V7WA 5JS7A 1IC6A 4C01A 4ESVA 2IT1A 4AO7A 4TWIA 3IOEA 4LSGA 1TC1A 1L5OA 2IOQA 4OP1A 4UDYX 1MAHA 3QYJA 3RUAA 3U9SA 1M5RA 1W36B 4OBEA 3FFWA 4ZXPA 1ZC4A 1XAGA 2P91A 4KLCA 3BTVA 2I2CA 2ZTUA 1RC8A 4YVFA 1SVWA 3OOSA 3BRQA 3JXEA 3U31A 2RH9B 3WIBA 4JL6A 1PNQA 2PUTA 2W6NA 2ZVDA 2W2TA 2DKFA 3BXPA 2IPAB 3MMXA 4CBVA 4BYGA 3ETHA 2IU4A 2HSEA 4ZKEA 3V97A 3QSGA 4UTPA 3NHUA 4NCIA 5ARCA 3AUJB 4B3HA 5CH8A 2P41A 4XX1A 4BNHA 3OMLA 5BSKA 1SGWA 2VLBA 4IO1A 1HZZC 4U7JA 1G8JA 2O8DA 3UJCA 4ZEXA 4UPDA 5JWOA 3IUMA 4MKFA 2MSNA 4UVIA 1QTIA 3A8TA 4OUDB 3MPUA 1OIXA 2VA9A 1ZK2A 1GV1A 3EC1A 2WUDA 4PZEA 3S29A 1AXGA 1XMIA 2BGKA 2Q5HA 3H4IA 3LGXA 2J6BA 1MPTA 2MSCB 4RHTA 3BJRA 1P62B 1V41E 1ZVQA 4KXXA 2HCTA 2YIJA 4UBNA 3QWBA 3W3ZB 4AG6A 4NENA 2D59A 3PSHA 1P0PA 1LSJA 1WA5A 1F2VA 1Y34E 2H2FA 3AUKA 3KZNA 1K7EB 5AK0A 1I3KA 5I9IA 3FOZA 3PP8A 3K8OE 5AJTA 4DMUB 5IT5A 2CL0X 3QELA 1K4MA 1WU8A 4WIAA 5WRFA 1EWTA 4AZSA 1W5AA 3IT0A 3ESQA 3QK7A 1GQQA 4GMXA 5T4EA 4H1HA 3WLAA 1O6CA 4HGRA 2ONZA 2IHYA 4YRTA 3G89A 2QD5A 3NPMA 4KUHA 3WRYA 4AYXA 3PIIA 4IINA 2A9VA 2PKEA 2QTVA 1FFGA 4G1EB 4S35A 4ETIA 5L40A 4G8BA 4F2PA 4B75A 4I2NA 5IEJA 1A9TA 2P40A 3E9RA 1F8FA 5KJEA 4R0MA 2PXXA 1QFMA 2XMRA 1GSAA 3LZDA 3GQBA 5TMEA 4Z54A 5EXEA 3ZPXA 1G6OA 1YB5A 2ID9A 2COEA 4R8LA 3RTAA 5KDOA 3OLWA 3A11A 4OIMA 4F84A 4LI3X 3BA6A 2BWJA 1T26A 3DTVD 2DT8A 1RKBA 3IBGA 3LPNA 4O1IA 2WJAA 2Q1WA 4TMKA 1AH2A 1JAIA 4BECA 1SK8A 2VJOA 3P94A 4C4RA 2ST1A 4WN9B 4IIHA 3WIOA 3ET5A 3VH1A 2YMLA 2XDAA 1EZ4A 3CZ9A 4K9KA 4PG4A 2OYRA 3TSOA 1SU7A 3KWJA 3WLEA 2VOEA 5HMLA 1LJLA 3ZCUA 4BTLA 2JEOA 2PZ8A 4BATA 3B1YA 4A8HA 4LN1A 2GA8A 4P3YA 3T7EA 4A1FA 4YPVA 5JJLA 1E3SA 2C9DA 3VDRA 2E4YA 2DXIA 3ZDCA 4AJIA 3WGHA 4JZYA 5CNJA 5THQA 4GWGA 2HEIA 4G8CA 4PVDA 2BJHA 2P6OA 1IXKA 4LE1A 3CEMA 3IUEA 3LT1A 2I6QA 3U81A 2W8BB 2WTNA 3BDVA 2V96A 1ZM7A 1MJ5A 2H00A 3ZJ4A 1NJ8A 2Q5FA 5FV7A 3Q6NA 3PNLA 1Y4UA 2BMWA 1Z4QA 2X0KA 3GJZA 3TQQA 5EXXA 2IEAA 2VR1A 3B1VA 4IYJA 4KFUA 2XV1A 1QDLB 1KH3A 5FL7A 3I01A 2AN9A 1ZUWA 4FYIA 5DGDA 2MCFA 4CL0A 1RKXA 4D42A 1U2DA 2X1MA 3ANNA 7MDHA 4IQ8A 3BQNB 4X62B 4CIBA 4ESOA 1W94A 3AU9A 4WE3A 3W5AA 3SZUA 3FPEA 2GVZC 5MGBA 3PFIA 1BWRA 1HT1E 1W2WB 3W79A 3V4RA 3GH1A 2P27A 4RVOA 1G8FA 4JJFA 2GLXA 1X7ZB 3DBRA 1QIEA 3PNSA 4WXPA 1QFXA 2GF9A 2YICA 1AHHA 2J3QA 3B6IA 4OL0A 3C5HA 2IV3A 1O89A 1CY4A 5K3DA 1YD7A 2XWSA 1W34A 1YKSA 2HA5A 1WAMA 2Q3DA 1JZTA 3IIJA 3N53A 1YBFA 3ETJA 3INYA 4JJKA 1PWYE 4CKWB 4JD5A 1NXPA 3H2HA 3C6QA 1EX9A 3M9XA 1U0TA 3QMVA 5HK8A 1KZHA 3SNHA 4JOSA 4URVR 3QVGB 9LDTA 2O8DB 2FKNA 1JFFB 1NWHA 5A9TA 3NU1A 3HGQA 4HEA1 2QL5A 1E60A 3L6RA 4JL8A 3JQCA 1L5HA 1BFKA 5EZYF 1CYDA 1BMDA 3QKUA 4OUDA 2VYFA 3CPJB 2QRJA 4ODIA 5LU9A 5GJBA 2QPLA 2P9FA 2N1BA 2QN1A 2VHUA 4L51A 5GJCA 3CW2A 1QCDA 2WP0A 2TSYB 3JVUA 5DNCA 2GNAA 2P9TA 4JYMA 1PT9A 4HQLA 2AKAB 3SI7A 1XCBA 3GDWA 3JYNA 4BVAA 4YQFA 5BR8B 2NZ8A 2WHQA 5CFOA 2OGZA 4B3SB 2DJIA 1KJQA 2YVQA 4BWFB 2WVGA 4CCSA 4I6JA 4Q47A 1JIQA 1SCDA 3AHJA 1OYYA 3W6PA 4FMPA 2PZGA 3ZCXA 4OFBA 1T0HB 5TB5A 3OVMA 4DJJA 2HPVA 2EIHA 5CVTA 2BZ0A 3UC5A 1E6MA 3UTDA 1AT1A 2IYXA 3GRAA 3MVEA 2IY7A 3HJBA 5HQ3B 1JJFA 4OBBA 2QENA 5EZSA 1V5EA 2WFLB 5H16A 1H6DA 3H8WA 2GBCA 2NO0A 3BRWD 3CY6A 2Q4DA 3L7NA 4BWVA 3SF8A 9ABPA 2B4TO 1GFZA 3WK5A 4JLBA 3DE7X 3DCNA 4OHVA 5DI9A 3RO7A 1L3CA 3PEEA 4YO7A 5HE9A 5FIUA 3RUFA 1GAWA 3PWTA 4PO9A 1R6DA 5DO9A 4TYWA 1M2KA 2ZWAA 3IIKA 4N4AA 5EQFA 3GGJA 4GW3A 2CFRA 4J16C 4ER0A 2ZJ1A 2AH5A 3UW1A 3M5WA 1JTEA 3G8CA 3D6AA 4FVTA 2CHUA 3ZV4A 4A36A 2DUUA 3SY8A 2DG2A 3FYTA 3STTA 3UYKA 2LV8A 4JIMA 1ZLYA 2ECQA 3ZHYA 3L5KA 5ALMA 4WN9A 4UDXX 4DA7A 1NFFA 4EGJA 2MINB 4MH0R 1LEHA 4CM1A 3NHWA 4ZVTA 1UL1X 5CA0B 2COUA 4JLJA 3LQFA 3QVLA 5BWMA 2Q9UA 1NP3A 3CLRD 1SA0B 1DIRA 3PQ3A 2P4QA 5LYJA 2Y1LA 1S2MA 3OIWA 3M5DA 2YWCA 1X1RA 4MVWA 4A03A 3ZGLA 4WOKA 1CIVA 2XF8A 3FHOA 4ZC8A 4J2TA 3IMFA 3IVMA 4M4SA 2HCBA 2J0VA 1CJCA 3M2TA 1FDRA 1XLUA 3DZ8A 1R15A 4IXWA 2HDNB 4IDBA 2O2JA 5FOVA 4BRUA 5BQFA 2DPLA 4QULA 5EHXA 1P44A 1GSHA 3SBXA 1XKTA 2W8BA 1IM2A 2AR0A 1O87A 1JIJA 3DMDA 3DMFA 4WCVA 1ZCZA 4RUKA 3WSVA 1SC6A 4KPUA 1CTQA 3TQRA 4CDGA 3E0QA 1RZ3A 3A4VA 2GTHA 1DWUA 1TC2A 2PX3A 4FYMA 3WGYA 4FZRA 1FSZA 2E1RA 4YRJA 1GEGA 2VXCA 3B51X 5KWVA 4J7CA 5J3JA 1TLLA 2ZYSA 2UVQA 3KOZA 4TRRA 1IRIA 5T8KC 4B7CA 5LNK6 1P1JA 5FWXB 2WM3A 1U7TA 2ZRBA 3F6PA 4P86A 4V0RA 4CL8A 4HV4A 5BOSA 2NAFA 1IG3A 1ZC3A 4J91A 3ZX5A 2NM0A 2PS9A 5DTRA 1OLXB 2CDAA 5GZ1A 1OWPA 1KERA 4KSBA 3D3JA 4QGHA 1QHFA 2HK7A 2J3HA 4RQTA 5HM8A 2XGSA 3FGOA 2Y4NA 1WMSA 1CQIA 1OX4A 1T8SA 1TPYA 2X23A 2JJYA 3FMPB 1KHHA 2EFJA 3DM9B 2HLDA 4NBWA 5SICE 1XD2B 4CM3A 5B2FA 1UMKA 1GEEA 4M1ZA 4DSNA 4C6SA 1XZBA 3IAEA 1XZPA 1SIUA 1I6KA 2PRSA 2R1TA 3KEMA 3V4ZA 4XYMA 5JTUA 2B4KA 4DC1A 4AKGA 3OSZA 4IHAA 2EV9A 3ROFA 4R1QA 1B2RA 3ER8A 4HGOA 3H4MA 3HXLA 3I5YA 5DHAA 3UOGA 3KU1A 1YJ8A 1ZVKA 5BV0A 1F8YA 2J5QA 1Z16A 2ZROA 4PIVA 2QSZA 5LWQA 4DGSA 1AXRA 3O9MA 1QRRA 1GPDG 4QD3A 5AI9A 4JB2A 3OZEA 1W88B 4YJKA 2FMXA 3C98A 1VB3A 1W73A 3KYBA 3VSAA 3OQMA 1CRZA 2LPMA 1IQRA 3RLIA 1C3XA 3ZGYA 4BMCA 1YQTA 1UBJS 1FU4A 4AU1A 4BS9A 4ZHSA 1ZICA 1IBRA 1ZEJA 2QLJA 1J4AA 5A02A 2POCA 1N6IA 2HD4A 4QUHA 5THXA 1X1TA 3P0JA 3CO0S 3KOMA 4D6PA 4YRSA 5BRAA 2CEKA 1X7HA 2Y1CA 1F38A 4WZAE 3HA7A 3AG5A 2F8LA 4Y18A 2YZNA 3IHTA 2I3AA 1R6TA 4JOQA 4RF5A 4PR0A 4BZQA 2ZSBA 3D8RA 4B45A 1F17A 5EJFA 3E8MA 3SSOA 3R1IA 1N3LA 1JA0A 3H5IA 1Q5PA 1E3LA 5EHIA 3GFOA 1GPH1 2ETXA 2HXYA 4KDFA 5DKFA 1FNSA 1IHXA 3DMNA 4CRWB 3LUFA 1NUTA 3VR2A 3DOOA 2BFNA 2O2EA 3KXDA 4LV6A 5AICA 5AM2A 4YT8A 4FHEA 2A9RA 3G1TA 2GB4A 3O91A 3FPSA 1SHJA 3TR0A 3ZDDA 1E9RA 1G0OA 2G1PA 1EI9A 1Q0SA 3VR0A 2IA5A 5G40A 5BQ3A 4TQAA 1V39A 5FH9A 4JCOA 3ROEA 1KU6A 4DUGD 2IHUA 1BEEA 4K1XA 1SVOA 3TQTA 3HXMA 1U9IA 2OZPA 1HYGA 5TT0A 4Y1RA 3L92A 1OASA 4ZOAA 2RCNA 3WK6A 2HRBA 4XYGA 4M7PA 1UP7A 1EUCB 4NDNE 5HFAA 4CXMA 2ZB7A 4L73A 5AVTA 1F4LA 1M73E 4X94A 1OA1A 4GWKA 4HDSA 4P22A 5JCOC 4DNPA 3FYSA 1UPUA 4GYWA 2H4HA 3GAMA 4ZT5A 5AIBA 3CZMA 4HDKB 5HCIA 3BGIA 4EABA 5DNWA 5HQTA 1XTJA 1R4NA 3MUOA 3PDJA 5FOWA 1EYZA 5TE9A 3HUTA 3KK0A 2FPMA 4UAVA 4YDHB 2DU8A 3PPWA 4HQOA 4ZVSA 3PNOA 1SG9A 3UVEA 2IKSA 2CCGA 3F90A 1H65A 2ZTLA 1K86A 4IVNA 1XRNA 4A3SA 1CB0A 4IGEA 4DNXA 1ZJ6A 4WZBB 3KKEA 5P8WA 3BFPA 1VSTA 4LRXA 4HWOA 2EL7A 4RK5A 3COWA 1TUIA 2HHJA 3IEXA 2D1FA 3GP3A 1GN8A 1LPNA 2IOFK 3TGPA 1UDRA 4R3WA 3VNAA 2GUWA 3VJLA 1R37A 5CRIA 3WL5A 2PKXA 3CLTD 2NZJA 3WFIA 2QZPA 1B0PA 1UC5B 2ZS8A 3QHQA 2RHLA 4JI3B 1F2TB 3GWGA 3U4GA 1W2GA 4YJ3A 2CVHA 5I7FA 5A05A 4LX8A 4ZK6A 3G2NA 4KJXA 3K2IA 4I5FA 3RS7A 4WLVA 4EOGA 2GEFA 2Z2ZA 3L77A 1GR0A 4K6HA 2JGAA 4KNWA 4NY1A 5M5BA 2XKAA 1TK9A 4NBNA 5TC4A 1F3OA 4RL6A 4DG5A 3A4IA 4O4HF 4WOCA 1I7QB 4P4GA 4YS6A 2V3VA 3OWXA 3DC7A 5B55A 3SG0A 1G5TA 1NT2A 3E9MA 3K6RA 5L3ZA 4PYJA 2HAEA 3IHLA 3M49A 5LB2A 1U8AA 1U65A 1Y1LA 3CZ5A 3ORQA 2QHXA 2E5WA 3DAHA 1LF0A 2WWYA 4E1AA 3BE8A 2WUFA 2UV8A 3MD0A 1C7QA 4ZRDA 1UPTA 2OILA 2A9FA 3HVRA 4MCHA 1IZ0A 4AJEA 4J2HA 3MCZA 1P91A 4BQFA 1M8KA 4QQFA 5FD8A 1TM2A 4UE2A 5CLLA 5BYJA 3JQ8B 3PBKA 1KE1A 3GGSA 1LPOA 3NBXX 4IF6A 2XWPA 2YJ5A 2HK9A 1JKIA 3E3OA 4IJKA 5ITVA 2CNNA 1W47A 3G2KA 3NT5A 3UOWA 4BNGA 2A9QA 3CWQA 3ICEA 2HYDA 5J5AA 5LZ2A 1U31A 1NKTA 5AOCA 4QVKA 2RFLA 3WIVA 5BR4A 5EE5B 4D6XA 1LA2A 3VZCA 2ZI6A 3P96A 2FW8A 4C5AA 1EJBA 4UNSA 1SZJG 3CKMA 3JZMA 1QH9A 4YCLA 2FSPA 4DZZA 4JLUA 1JXOA 1WABA 4NCHA 2GD2A 2VQDA 2WRZA 1VJ1A 3ZBQA 5SY4A 2JGRA 4AAYA 2D5CA 3U6KA 4D4LA 5HILA 4RFSB 2XH8A 3A36A 4FGJA 3RADC 2V1UA 3BIWA 1V5IA 4MCAA 1C30B 4I5EA 3WDSA 2CLMB 1S2NA 3UK6A 1YC2A 2IS6A 1KZ4A 4NBTA 3LUPA 3L4JA 3M4JA 3ADKA 1AJEA 2FFHA 4ITUA 5K2MA 4EZBA 1R0SA 1Q0LA 1JR3E 1XZAA 3IIMA 3ITDA 1P2GA 5IKOA 2XT9A 1O9BA 3T38A 4M0CA 1V8OA 1FDUA 2FJPA 2V9PA 3KB2A 1CUGA 5FA8A 5KOHA 5FI3A 2JIBA 4WN3A 3T1VA 1G17A 1T6XA 1ZAKA 3MS4A 3ONNA 1K97A 1FU8A 1M2NA 1QHGA 1ECJA 4P7JA 4EI8A 3UIEA 1Z2AA 3G5MA 1LDNA 1Y7TA 5CEJA 2H7YA 4X6UA 5EEHA 3VOAA 1T35A 1ZRSA 2BFEA 3TCNA 1F06A 2Z1DA 4DRXA 5KJFA 1QB7A 4RH1A 1Y98A 3RCBA 1FUKA 5GADl 2PKRA 3C14C 3GFVA 4DJFC 1GNPA 2EKPA 2C96A 3D64A 4JELA 5EKUA 1A1VA 1FA9A 4BQQA 1QK5A 1WMFA 3H5VA 2JGMA 1VE1A 4BO0A 3NVMB 5TGDA 5IMSA 4ASUD 1DJOA 2G5CA 2PMBA 3QY0A 3IIIA 4YCSA 1GCGA 3OFSA 5FTWA 4S3MA 1BXRB 3JYOA 4S1NA 1V25A 5DEOA 2VT6A 3HGMA 5LLDA 3MT7A 1V9LA 4GZLA 4WBNA 1N5MA 2JKYA 1GTJ1 1NXVA 1OZAA 1U3GA 1BZYA 3EDOA 1RQPA 2P0YA 2WFLA 3HWRA 3NASA 1KBOA 1XLTC 2D00A 4WZBA 4C1NA 2YUTA 1YONA 5JCOA 1BO6A 2DWOA 2ZRNA 5FPQA 2P5YA 2ZPAA 3KSAC 3EY4A 4PAOA 3DFKA 3OTQA 2H9IA 3ILYA 3NHRA 2AZMA 1N2BA 1Z15A 3PDUA 2FN7A 3O8QA 1NVAA 3ABZA 5AHXA 1ZXXA 4K3VA 2DT5A 1OYWA 4X84A 4A91A 4FYXA 1F2TA 3RI3A 5CDHA 1RWPA 4HLUA 1XWFA 2YRXA 5K0EA 4N0MA 1GRNA 3JS5A 1X1AA 2G1JA 4R3NA 1RNLA 4KXFB 3VC1A 1FTSA 3JZIA 1SQ6A 3VR4H 3ED1A 4PQRA 4D9HA 5ERXA 4N01A 2A0KA 5EJ5A 1F7VA 1GPAA 2W6PA 5KJ1A 4DV4B 2JHFA 4KRFA 4JUCA 4KAJA 3LD9A 2XNJA 2XUHA 3HI4A 1QOZA 4P0TA 4XUDA 2RDMA 5HF5A 4CLDA 1KNXA 4W9MC 3UUFA 5FTMA 1JPNA 4X00A 3N9IA 1DOAA 3PLRA 3BAZA 4PLCA 2AQHA 3F1LA 3WHPA 4BMPB 3TZKA 1T9AA 3R74A 2MYPA 2JGDB 3IAS1 2BM1A 4F5ZA 2BSAA 1BOFA 2H5IA 2Q6OA 2JFXA 1DAGA 4HZIA 2FNAA 3LVFO 4YO8A 4Z3OA 1NAHA 1KJJA 3G0BA 1OCEA 3RVDA 1JAZA 3OJLA 4AKHA 5JE8A 1A9ZA 3EF1A 1DZIA 3AIKA 1J8YF 2O3QA 3D6MA 2ECFA 3GEEA 3WWPA 3ICCA 4KYIB 5DNAA 3VSBA 4TTSA 4B83A 4E5KA 3LRTA 2XTAA 1P5HA 1SBTA 3A1UA 3NORA 5ESWA 4Y6GB 3HXKA 1OZGA 3TAHA 4KIJA 3P20A 3PYXA 3NVKI 1NN5A 2NP6A 2XMGA 3AB7A 1YRQA 1QCYA 3GFBA 4P4SA 3B7WA 1SXGA 1XCLA 3PJFA 3DLAA 2O2IA 2BFCA 2JW5A 3AEQB 5F33A 2BE9A 1QAMA 2CXNA 1XEWX 3DZDA 1AS0A 1ZVMA 3MBIA 5EWJB 4BKRA 2ZWOA 3LFTA 3B78A 2JJMA 3BL8A 4HVTA 3IEPA 4ZZ1A 2SICE 1F5SA 2FGJA 4AXXA 5L3QA 4L22A 5FA5A 5BQOA 1P7ZA 2ORYA 3CEPB 3ZE7A 5JCXA 2AXNA 2NSLA 3F97A 1KQFA 2WSMA 5DRTA 1MHTA 3SQXA 4PS1A 1KXZA 5I4IA 1JUDA 1TMOA 4BB9A 4MDHA 5HBRA 4PYQA 3FTEA 1D09A 3L4BA 4P5DA 5BNIA 1PUXA 2Y8EA 4WOBA 4ED9A 4QXRA 4LECA 1IM5A 1D8AA 1V8FA 2X4GA 1OV4A 2R79A 1H4VB 2IUTA 1Y5LA 2CDBA 5EQDA 2X8JB 3VNSA 2YASA 1BH6A 3ZX4A 3GJQA 2P67A 2WU3A 3TRFA 4AX4A 4MHOA 2DBVO 2UZ3A 4RK4A 2QG9A 3LP8A 2JGIA 4PX3A 5FL7D 2VQEB 2EFYA 1FSGA 1WBJB 3GBPA 4GAEA 1T4GA 2EOAA 2QAGB 1Q21A 3IS3A 3UJ8A 1RJ9B 2FH5B 1DE0A 1OVMA 1YJ5A 2CUTA 1HWYA 3OZWA 3PQ2A 1EHIA 3ECAA 3D6FA 4NZ9A 3ZV5A 4DLBA 1DBQA 3U61B 3THYA 3GLHE 3MWGA 1XNJA 2HA4A 1E5DA 1P1RA 3B13B 1NU6A 3KJZA 5ITWA 1GZSA 1B00A 1MJGA 2ROQA 4C6RA 1AQJA 1PX2A 1HE8B 1VI2A 4P80A 4GP9A 4ZPJA 3QOYA 3ZDQA 1UZMA 3ZZNA 3HYRA 3MGBA 3GA0A 2JH8A 13PKA 2PZEA 2Z5GA 2W2PA 1DOZA 1ECGA 2HCRA 3EFOB 4V2IA 4X7MA 2NU7A 3H5RA 4NX2A 1UM8A 2D3WA 2WAXA 4GPAA 3G02A 1JKFA 1FJXA 2YHUA 5DN6D 2BH2A 4F3TA 1Q0RA 5L6LB 4DT1A 5LQNA 1JJVA 1ULZA 1YCDA 2GN1A 4WBNB 3K70D 2NXWA 3EDQA 4I8DA 5F3DA 2GAJA 4JC8A 1T8YA 2DFTA 3BE5A 1Z7EA 3OHMA 3QPCA 4FILA 2VYQA 1T5LA 1A27A 4RF4A 5IVHA 1YZ3A 3C3DA 1ATZA 2EZ4A 4UZFA 3SPXA 3CZPA 3TEJA 3FPLA 3RC7A 1M33A 2LKCA 3T06B 2XCTB 2R1UA 2YZKA 4EI9A 1XFAA 3AV3A 3HCAA 4MKXA 1L7DA 1FVXA 4GEKA 1KY4A 3WIEA 1ZU4A 5JNSA 1JU9A 4TMYA 3S1AA 3HTXA 4J0EA 1PK8A 3RS5A 1G5HA 1MDBA 3B38A 1U0BB 2RK6A 3ODGA 2ZOSA 1KYIA 2CCJA 3MTAA 4Y2YA 2H1OA 2DWPA 2HBYA 2O6HA 4HDSB 5E6UA 1PGPA 3MRVA 3VZBA 1V47A 1VDZA 1A9XA 1XRMA 3AF4A 2GYYA 3I4LA 4Z9BA 4WKCA 2JFBA 3BL6A 4I55A 4HATA 4AP6A 4UJ5A 1X70A 4IIXA 5IG2A 3ZJ5A 3BGSA 3VHXB 1NWCA 2J4FA 1Z36A 3EIWA 1HSZA 1B15A 1B3RA 1Z5UA 3L07A 4AMGA 2HBRA 3PCTA 4RH3A 3PTAA 5GONA 2AR9A 4QVGA 5C9ZA 3O9VA 2WD7A 1FCJA 4QXQA 5CB4A 3IVRA 4XWTA 4Q01A 4A7PA 5JZMA 4CGZA 4JH0A 1GCIA 2ZWPA 4XWWA 4OK6A 2HU2A 1FVOA 2EF0A 4ALMA 4F5WA 5CFQA 1XU7A 1WB4A 2WJVA 5JISA 2C04A 1J00A 1VFPA 2QW1A 2QU7A 3FAKA 1ST3A 3ZWKA 2OXRA 1Y42X 4ZOQI 5DN6A 1I6MA 3KWLA 5TMBA 4C0AC 3I32A 4MLCA 1TJYA 1LQUA 4MNTA 3J81k 4E1VA 4KHPB 3JD2A 2WAOA 4YDQA 3TAXA 1Q77A 4Q5IA 4PHCA 5D01A 1ZVJA 2R68A 3BXEA 5BVGA 3CX4A 3LGSA 1KIMA 2L17A 4OQNA 2GXSA 2AEMA 4W8HA 4ATNA 1NI4B 4RZIA 4DCPA 2QL9A 3OQ6A 4M0PA 3CJQA 3IUPA 1Z4OA 2GCOA 1VC2A 2D2VA 3P2EA 1E9EA 5TPWB 2B8NA 5F9FA 1NT4A 1TVKA 3AYXB 3DYIA 2GSWA 5DTIA 5EYPA 3T7DA 2P1DA 4F5YA 1O6FA 3M5PA 1AQIA 4L5AA 3GNTA 4IKOA 5DM2A 4I5DA 4AFNA 1XRRA 3N76A 4R1UA 3TTSA 1A8HA 3IP8A 1LX7A 3D43A 2NTVA 1GPWB 3IUJA 2BGRA 5IHXA 4D9BA 3AM3A 3HXQA 4CM4B 2CXUA 2G9VA 1HC7A 4RMIA 4JXKA 4KWHA 3U37A 5K9ZA 3ELUA 4FBLA 3UT6A 2QTTA 3AO0B 3BGDA 1TM5E 2FWNA 5I9LA 1QQAA 2VTKA 1W4LA 3OPNA 1GSIA 4OPMA 4YUWA 3JALB 4C4YA 5KNDA 3EPLA 1N36B 4N3GA 4UAUA 1KSFX 4QLBA 1OH8A 3AERA 3GVIA 5IZ4A 1VXRA 5K7SA 1A96A 2B1QA 4EX6A 3QW2A 5ALFA 1MOPA 5IKMA 1UZLA 4FYKA 1FS4A 2ATEA 1DHRA 1YJAA 3ZXIA 2BFDA 3K05A 3L93A 3VVMA 4ARSA 1UH5A 3B9RA 3M5CA 5HIKA 2R9VA 3DV0B 3VDQA 2GBLA 2I2DA 4QOSA 4YMWA 3NCHA 3OQHA 1T6ZA 2B1RA 2PD4A 4N7RA 5IHPA 2VIIA 3OPMA 3C43A 1DOHA 4MIKA 5EUMA 4TS1A 4BKPA 5B58C 2IEDA 3BHJA 1IK4A 4HLCA 3D8BA 2OO7A 2OPBA 4P83A 1LK5A 1TF2A 3EF0A 2B7LA 1TM7E 4Y2TA 4D92A 3LJKA 1FNBA 1DXYA 1YWGO 3L7LA 3NGMA 4FD2A 4O2BA 1TK2A 1SEPA 4E5SA 4DG8A 1BSVA 4CM8A 2Q62A 2H0QA 3ZVMA 3H86A 4NQZA 4PXAA 1N2CB 4DDUA 5AW4A 1KFJB 4I9NA 3OQPA 2B7CA 2SKDA 3Q3EA 4Z4IA 2A5GA 3FTQA 2NOAA 4LDRA 4U8HA 4JV5B 5D87A 1MAAA 3DL2A 3L0BA 4HS4A 3KU4A 1FDIA 1G41A 1TUEA 1Y7HA 2EYUA 2GN2A 4HTFA 4HB0A 4WV3A 1SZPA 3CKLA 3H1AA 3ZR4B 4UJ3A 4DMCA 2XY4A 3EMDA 3QEJA 3F71A 3N0TA 1Q83A 2UZ1A 4QC2A 3QEBZ 3L79A 4MIEA 2QYOA 4FBGA 3I2FA 1AKUA 1Z8DA 3TOZA 1LVUA 4M0UA 1QK3A 3HCDA 5CJJA 2VDJA 2Z98A 4X1KA 1II8A 2AG8A 3FY4A 4JGIA 3WTCA 2OXCA 3ZJYA 1ESMA 2GPJA 3F9RA 5AM0A 2VL7A 3TL3A 2N3ZA 1ODKA 5KTNA 2ASVA 4KQMA 1SUSA 1ZS9A 1PJRA 4B2IA 1XEXA 2VTBA 3TCXB 2VK1A 1WVIA 3GMIA 4H6PA 4F21A 4NZYA 4WTOA 1TT5A 4IJ6A 4REMA 1B8VA 1HM5A 5AKEA 5LQDA 2P8SA 3E9QA 5CR9A 2VDUE 1F9AA 3I8XA 4N3AA 5FHQA 1G6KA 3QUCA 4KIGA 3DD5A 2RGYA 2M6LA 3RSLA 4GICA 2CLFB 4DGQA 4GPTA 3TQSA 1P5ZB 2FWMX 2TS1A 3G0IA 4LF7B 2OK7A 3ABQB 2ZUWA 3LL4A 4HEQA 2ZYIA 2GJKA 2ZR7A 1X77A 3WS7A 3LLSA 4ZT7A 2RC6A 4MWOA 3KR0A 4UREA 2FE1A 2FF5A 2I6TA 2PPLA 1IONA 4UW9A 5DK4A 3ZZ1A 3Q9SA 4AN0A 3PHBE 4WJLA 3KQUA 1UPAA 2O3TA 3OTOB 4MR9B 2QX8A 4KLNA 4YR7A 2BR4A 5K51A 2ZBPA 3O8OB 1N5DA 1NVTA 2QOEA 2H5JA 4E30A 1E2MA 3A9RA 3KHKA 5CDSA 4PR3A 3GLHA 2ADOA 2J87A 3IPYA 4URUR 1H0KA 3F1KA 4FPXA 4YT5A 2WWVD 2O14A 1T6BY 2XMZA 3DMHA 4X8HA 5AKHA 3NHAA 3ONEA 5IDQA 1L9XA 3T7SA 3HCFA 3RU9A 3T94A 2YWRA 2ZTHA 3B5IA 5JQGB 1UDBA 2WJ4A 2ZJYA 1M2OA 4UU8A 4KGDA 1Y3BE 2EJBA 2ZSFA 4KR6A 5IJAA 2NSJA 1DV1A 3IO5A 2WYWA 4S0ZA 1GGEA 3QA3E 3AZOA 3HR7A 4BV9A 2CMFA 3TD2A 5MN6A 5T6BA 1E5QA 1CU1A 3GGCA 3P1JA 1LRJA 4GGOA 1GG9A 4PC3A 2XSZA 3NYWA 3NEJA 2P35A 1NSYA 3FMIA 4E5YA 4JBNA 2GEDA 4EPRA 5HTOA 5BXYA 1NOKA 4F86A 2PUBA 3JALA 2PBZA 4I7EA 3T3OA 1C1HA 1M3SA 3AUXA 3CINA 1EFRA 4QWMA 3INGA 5DT2A 2HUNA 1T91A 5EMKA 3P0IA 4HGZA 1SQFA 4M9XA 2YUIA 3P7MA 2DFDA 4XTRA 3SDSA 3ZDEA 4OXNA 3NNSA 1KY3A 3QELB 4GQBA 3UAOA 1M6HA 1E1CB 2BKEA 1EFUA 3FYHA 2LP4Y 2VUIB 1IY9A 4PTLA 3QOXA 3O8CA 4KVZA 5EWJA 1YIDA 4AMYA 4XYEA 2ODNA 3V8QA 2WU1A 5TS3A 4ZQFA 1EBBA 1PV4A 3KPVA 4M21A 4C88A 1MMFB 1LBTA 5EINA 4XX0B 4UHDA 1GADO 2WIKA 3JCZA 1OU4A 3R20A 1ADFA 3K5WA 3SLGA 4OLBA 2CBZA 4BFWA 2HRCA 5IJZA 5IFLA 3N58A 3EW9A 1ZOIA 3WISA 2VNKA 2AN4A 5AK5A 1P18A 4KACA 4BO7A 1OPRA 2WD9A 5H3CA 2LZ0A 2PSJA 3O4VA 5F98A 2CNWA 2IUUA 3B82A 1ELOA 3KAQA 4G25A 1WOMA 4K9MA 4MROA 4NCNA 1E96A 1NJ5A 1SXJC 4IO0A 3RC9A 2E4AA 1W0JA 2IS1A 1UXGA 3LV8A 1UWCA 2JFWA 1TQHA 2ANBA 1YI8A 3RK4A 2JFGA 3PGMA 2JZOA 4Z0HO 5J43A 3TGLA 3PG5A 5CG1A 3KJNA 1GWNA 4JKOA 2PKYX 1EA5A 3T95A 3TJRA 2RAVA 1SWWA 2A3RA 2ESRA 2QMUA 3OT4A 4J8PA 1AUXA 1YBMA 4Q19A 3RIGA 3UGQA 3A05A 2QAGA 3P26A 1EK1A 1ZGGA 2FQWA 2ACKA 4NULA 4D7AA 2JA2A 3OG9A 1J9GA 4CKZA 1R0LA 4K05A 4N0QA 3KQKA 2I7CA 1VJTA 4ZO4A 3E61A 2QTHA 4UVGA 2W6OA 4K5QA 1NNUA 3PHIA 2Q21A 1WB5A 5SZKB 5SY6A 1XDBA 3GEDA 4C4OA 4JMPA 3ZWAA 5CFNA 4UTOA 3ROXA 2XZDA 4TTJA 3ESYA 4ZVVA 3ZY5A 1H8EA 1P1CA 3ZD6A 5CW2A 3N6RA 1U3WA 2Y0CA 4DT1B 1EK0A 1TKRA 3GUUA 1OHHA 1RC0A 1ZIDA 2GPBA 3H1EA 3T34A 1JHZA 1AKEA 2OHFA 3GLFB 2FSHA 3PNBA 1E1LA 2EDAA 2WIGA 1Z18A 4DOMA 4MYSA 4EO4A 4ZQGA 1RJWA 1KDZA 3P2KA 3HUFA 2GO7A 1J06A 2BP7A 3PC8C 4LRYA 4UUAA 1NQOA 3BD6A 4Z9AA 4I1VA 3P0FA 4KPFC 3MTDA 4IFEA 2H2GA 3DZIA 3LBAA 1WDKA 1QR2A 1PS8A 4J0JA 5DI3B 4GC9A 4V1CI 1JQ3A 2DPYA 1X7YA 2CK3A 1PWEA 2FZCA 1ZITA 1J90A 2YJ4A 1XX6A 1X8KA 3OD1A 4RQUA 2GGSA 4MO9A 3BJIC 1JB9A 4RY9A 2C03A 4GVXA 5G1NA 5KNCD 3BXHA 1VOTA 4TTAA 1L5LA 4RDIA 1W5TA 3ID6C 1YL5A 4QAQA 2WHYA 5EIFA 3IAM6 3STVA 4B4UA 1TD9A 4Y2VA 3M1AA 1T2FA 3QVGA 1FDTA 4DV6B 1ZH4A 3RW9A 1Q7TA 1FFYA 1VHTA 4GMGA 3AEUA 4QYXA 1RRKA 2A6PA 4UMEA 3SIRA 2C8VA 3DWIA 3L40A 3ZWNA 3I62A 3W7AA 2H29A 2I3GA 5IH7A 4UDOA 1Z0FA 4GF5A 2IS4A 5FF9A 2Z5FA 4PHFA 4ME6A 1ZUNA 2EL9A 1BMFD 1FBNA 4NONA 4P33A 3VKFA 3M6IA 4NYJR 2V74B 4DBVO 3NRCA 3N74A 5FBWB 2CVPA 5FO0A 4UNIA 1LFDB 4B7UA 3KKOA 5AUPB 2JS7A 2JFPA 1AK2A 3HHEA 1HLFA 5ALHA 5C7YA 1D6SA 2OSBA 2VA8A 2H85A 1SHKA 2SECE 1DJLA 2BKUA 2ZI3A 3G68A 3KT6A 5H68A 4D41A 5LJIA 4K86A 2RGEA 4PBTA 3ICQB 1HOTA 3ENWA 4DE5A 4EARA 5H0IA 3OBBA 3EZ7A 3RUPA 3W78A 4HDMA 4GKJB 1G2IA 3K0AA 2HSDA 4J49A 2Z3VA 3E15A 4TT8A 3JPYA 1CQWA 5KTPA 1ISSA 1H4TA 1TVKB 2EF1A 2QN8A 3VKWA 3BCRA 2GD1O 3LT0A 4RIEA 4RHYA 1A8IA 4LGYA 3NVDA 2VLIA 1X7WB 4UBKA 1WDLA 4KXYA 5AI6A 1PJCA 3HMKA 2EKDA 1VL1A 3BX1A 3I9V6 1T4BA 3W2IA 2DBYA 3ENZA 3GJRA 4C0LA 1A5SB 1KH2A 4JLVA 4LBZA 2PUAA 4L4XA 2CNWD 5K3BA 4Q48A 2BCEA 1OYOA 1VKHA 4D3SA 3DLHA 3LKVA 2G9UA 4C2TA 4X54A 4UUPA 1H9AA 2Q5CA 4JA0A 3IAFA 3Q6IA 5AJHA 4KOEC 4A2PA 4O29A 2HIMA 4DM4A 1DB3A 3SLRA 3FOBA 5CK5A 5JCPA 4WMLA 2FHPA 2P62A 3R7NA 3I9V1 3C6ZA 3NTLA 1DIBA 1S3IA 3W7VA 2IZ7A 5JD5A 2X3UA 3OC6A 2P9QA 3BF7A 3HXTA 3O0TA 4G8DA 3FVWA 3MRSA 2JIMA 3CLUD 2ZCVA 4DUGA 4U2BA 3AT1A 4B9EA 4DZRA 5CDGA 3O0DA 4G1UC 3V1KA 4AW9A 3GX1A 4NJEB 1JHXA 1PU2A 1YV9A 2JI9A 1CS0A 1NZFA 3L02A 4MRMB 2AJLI 2QK4A 1SA0A 3R6TA 5B2ZA 5LZ7A 4WZAA 3KVVA 2ZIUB 1EFRD 1WKVA 3IQZA 4LYEA 5HMMA 1E6EA 3WXBA 3MFYA 4P4TA 5LZ4A 1JPJA 2VHXA 4PGMA 2Z4SA 1G5RA 1VE6A 2QZSA 4YJGB 4KN5A 3RLFA 2HZBA 4UEOA 3I9FA 3HH8A 3IH5A 2HV9A 2VF5X 3DUFB 2OQVA 3QBDA 3RUDA 5C46F 1VSVA 5KHAA 1I1OA 2UUAB 1NATA 4C08A 2C4UA 3PFNA 5COBA 3TQIA 3BWDD 4TRJA 5DRYA 4BNMA 2VDOB 1LH0A 3PENA 1ZLXA 2GCIA 2AIRA 4CM5A 1ZXLA 1PR9A 1DC6A 3G17A 4NLLA 4AM8A 1ZN9A 3EQ8A 3LG2A 3PC4A 4Q1BA 5BSUA 3RROA 1X2BA 4TV9F 1K5HA 5ALSA 3IHWA 3ENVA 2X5KO 2DTEA 4ALJA 4H7EA 5KYKA 4RHXA 4W5JA 2NWQA 3BBPA 3EWNA 5J2TA 3BGVA 1Z47A 2OV1A 3E5MA 3CIOA 2OHIA 2VHEA 4PSAA 3EHDA 4BLTA 3KAJA 1EK6A 2O2DA 2VO1A 3DVSX 3KSBC 5EXSA 1W5FA 3HB0A 4KI0A 5AOBA 3DXZA 5CA0F 1CQIB 1OX4B 3A3YA 5DYTA 1E79A 4HVLA 3E5HA 3KTFA 1V8BA 3O7MA 1T43A 3EOAI 1U8YA 4OYYA 4S0XA 4M1TA 3GZ4A 4Q1AA 4JI2B 4QU8A 5EJ4A 3G0OA 1WPGA 1EUZA 2A57A 4Z86A 4HNTA 1O57A 3DWEX 4AJLA 1B0ZA 4LPSA 4YHBA 1HNNA 3DNPA 3PA6A 3EULA 3HYCA 3F8TA 1GTVA 1VKNA 1N5OX 1XZMA 2R4QA 2W7TA 4HMOA 4HMQA 1P74A 1CFJA 2BZSA 5JEEA 4PRYA 1UBSB 1W88A 2QJTA 1ZUNB 2QQFA 3QJ5A 5DWDA 1QQ6A 1W1IA 4WBXC 2RE8A 1T5HX 1DTSA 3MCVA 4TKMA 2A86A 4FINA 4AZWA 3DLTA 5JCJA 3VU3A 5C7LO 1W1WA 1YE3A 1X7ZA 3HBMA 2ODAA 1SUIA 3L01A 3VYTB 4S05A 2YL2A 2F43A 1XIVA 4Z3KA 2NO7A 1PKXA 3GLHB 3SZMA 4XR4A 4F85A 3DEAA 5HJ5A 3NOOA 2HDHA 2X8WA 3LBFA 1FPQA 5EIWA 1Z88A 3ESRA 3HNOA 3N2ZB 3OHSX 3M1LA 1M6EX 2Y0PA 4JJ6A 4TMWA 4EUKA 3QVTA 5IN5A 1OFHA 4IDFA 5DCUA 5ESXA 4PLHA 2AJDA 1E2PA 1Y82A 4CTJA 1DTEA 2A88A 2O2XA 3KTAA 4I3HA 5I7SA 2KPOA 3OURA 1SC4A 1HFWA 1Y3FE 3I9MA 3M4NA 4UUBA 3QEMA 3CUTA 4IIGA 3MWJA 4M0LA 5LN1A 4YV1A 4PCLA 3I1YA 2WM2A 4YUAA 5BRJA 1DWOA 4CIXA 1JXAA 1TAHA 3C3MA 4R8VA 2FN4A 3U4QB 1EDDA 1CK4A 1GTRA 1PHRA 4Q4HB 2ETVA 5EMJA 5CHEA 5CXQA 4ALIA 2I6SA 1KI1A 4ZQCB 3R9IA 2Q50A 4WWHA 5DYYA 3MWDB 4FNGA 1A9OA 2RGCA 4TLAA 2JLXA 5GQSA 3ANLA 4M3NA 2XECA 3EIHA 4F3NA 2FPIB 4ZAVA 5DEIA 1H3FA 1P6UA 4G41A 5AOAA 3T1QA 3UATA 5C7IO 5JZVA 1N6OA 4KLAA 4MV4A 5AJVB 1O7JA 3V1LA 1K75A 2HF8A 4GO1A 3HFJA 4FX2A 4JKIA 1N1MA 1Z82A 4O2BF 4WZAB 3HSKA 4YCNA 4KRXA 2JI8A 1QFSA 1Y8AA 1Z12A 4OO3A 5D7BA 3DCYA 1MQSA 3USES 4NJMB 3M83A 1YGYA 1R8JA 1BE8A 2GDZA 3PQ4A 2G71A 4G0ZA 1I1NA 5AK6A 5FUYA 4IIJB 1UJ6A 5FPPA 4EENA 3PUHA 1C2YA 4GOXA 2MSEB 2V4UA 2HV8A 2V45A 3IRVA 5AW8A 2Y0DA 1MT3A 1WXEA 3SHVA 3WFZA 4LGVA 3FDIA 4MKRA 2C9ZA 3VZDA 2Z8ZA 1ABBA 1O2DA 3LHSA 3W6ZA 4RE6A 3A6GA 4FBMA 4PYNA 3H83A 4TTTS 4MP6A 1Z8FA 4NH4A 1N2GA 1CJKC 1RKQA 4KN9S 3CE9A 3PJDA 4QODA 4W9RA 1QORA 5HVNA 2IV2X 2VJKA 5JSQA 1YB2A 3N2IA 2ZRPA 4LVNA 3OM8A 5DLDA 3AR3A 3TD6A 5IC6A 1OI3A 2IEZA 4QYMA 5C2JB 2W90A 1DAMA 1HYHA 4K6MA 2OCAA 2BDEA 3AILA 1TA0A 3HKEA 1IZYA 3KO8A 3LY9A 1XEFA 1VBKA 2R2GA 4JJ8A 2C07A 5F23A 1O97C 3L6BA 4IJVA 4DA4A 1X1EA 2ZJ8A 3T4UA 4KBYA 1VECA 4TZKA 1W5EA 1ZOPA 3AU8A 4IGAA 3MJSA 1EESA 2FR8C 2RGAA 1WMDA 1WHTA 1HPLA 4HL6A 2DWCA 2QLFA 3RFTA 1FMFA 1KOLA 4M1YA 1ZJJA 3X1JA 2YFKA 5GY7A 2C5GA 3E3LA 3O38A 5KC8A 4MJLA 1BEZA 2Q3HA 3OFNA 3NOQA 1H3NA 1AKYA 1WS6A 2BGIA 3IBCA 1YIOA 1JX6A 2I03A 1U94A 4MR8B 2CYAA 3FB4A 3WB9A 3FROA 3TZHA 1K27A 2IRWA 1SHUX 5CT4A 1JG1A 4ETNA 5CB8A 4DUYB 4ZVLA 3D3NA 2XD4A 2BW0A 1G4HA 3FNIA 4CEHA 4WBSA 1PFKA 1Q17A 3V32A 1WBBA 1N0UA 4F2GA 1OGYA 3TVDA 5FI0B 4BQSA 3KKLA 1YVRA 3UZUA 1AOXA 5H81A 2WV9A 5LCXA 1T8UA 2Z3ZA 5BNWA 3F46A 2EBHX 2B7BA 2FCAA 2RC5A 3FHJA 2WD8A 2IODA 2NO1A 4PHTA 1TTTA 1XC7A 3BFKA 3OWHA 3GJTA 5H1YA 4UCXA 1JA1A 3IP7A 1WPRA 3ND9A 1U5BA 3PNKA 2Z43A 2FZEA 2J7PA 4D98A 4ZZ2A 1XEAA 3IVXA 4ZZ3A 1QO0A 4ZVQA 1G5FA 1UBKS 5T3UA 5JHGB 3AKYA 1QUFA 3B53X 2Y1GA 2GAFA 1PGJA 2ZI7A 4G1VA 4ZVRA 4TLDA 4BIMA 1L1QA 1PS9A 3DBIA 1CJSA 3HC7A 3OLXA 3ZWPA 1L5NA 5HF9A 4FT4A 3PUVA 3ENNA 4QM7A 1X19A 2CLKB 2ZAYA 3Q7PA 1S3SA 3II6X 3K09C 3QEMB 1N7HA 4BJ1A 1FJHA 4PYMA 4Q15A 4COKA 2LR0A 3MUFA 2QD1A 3OQJA 4D1YA 2H65A 5A4IS 1KI4A 3JAKB 4I4NA 1XNQB 2R8ZA 2VJQA 2W58A 1TTHA 3OOYA 4FZ3A 1RBYA 3URKA 3VYSB 4PTYA 2HO4A 3COPA 4V0LA 2VQ6A 3P9QA 2PXCA 1AZTA 3N2NA 3VVLA 2FEOA 3MAJA 4QPPA 1GGJA 3OCXA 4R0NA 3T1NA 3C3XA 5BW6B 4CM6A 4EBFA 1PSZA 1QGZA 1RCUA 1UP4A 4LGMA 1R0BA 2C5LA 2NYUA 5SZIA 4JLPA 4OCZA 2NZVG 3EQ7A 3O4HA 4P84A 2IYAA 3DAFA 3MJDA 2AXEA 4DW8A 1T3SA 3C6BA 2W2XA 1VMKA 4L9WA 4RGBA 3U17A 1EUYA 2FZVA 4YRKA 4WUVA 3GV0A 4MWGA 4KGVA 4DLVA 5EHZA 4KN8A 5AHWA 5CLFA 3AY6A 2VBCA 5CPFA 3ZHTA 1VKZA 5JAUA 2Q5IA 2HSZA 2FP4A 1YB7A 2WIBA 3EA5A 3GFSA 4J03A 2NU6B 2PV7A 2IIPA 3O4FA 4PCAA 1KA9H 1JQEA 5B1HA 4HBZA 1XKQA 3O8QB 2OCLA 3ORYA 2JD2A 3H9JA 1JDNA 3DT6A 4FOPA 5H3LA 4DIKA 4RL4A 3H1GA 1B76A 4R9RA 3LCRA 3DFFA 5FBLB 4UE3S 3LXXA 1NBOA 2NU8B 2UXBB 4X1IB 5BMVB 2REXB 5A4KA 1T1IA 1ECBA 1C3JA 3DKPA 5F5NA 3HKEB 1ISHA 2AF3C 1R2QA 3KXIA 4HWKA