1BHQ1

Mac-1 i domain cadmium complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
b'SDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD11B
publication title Cation binding to the integrin CD11b I domain and activation model assessment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 66
structure length 189
sequence length 189
chains with identical sequence 2
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1bhq100
1PD1A 3EH2A 3F78A 1L5GB 1OAKA 2ICAA 1CK4A 3BQMB 2I91A 1ZOPA 3EGXB 3BQNB 3EG9A 3PPXA 1RTKA 3NIDB 3QA3E 3PPYA 5E6UB 1AUQA 1MQ9A 3BN3A 5E6UA 1ATZA 1JEQB 1IJKA 3FCUB 3PPWA 3K71B 4UM8B 3HXQA 4PN7A 1JEQA 4CN8A 4CN9A 4Z7OB 3ZDXB 1M1UA 1M2VB 1CQPA 4C2BA 1DZIA 1M2VA 1Q0PA 2M32A 4M76B 1XDDA 2VDMB 1QC5B 2ODQA 2XGGA 1QC5A 1AOXA 1T6BY 1QCYA 1T0PA 3TW0A 4F1KA 3M6FA 1RS0A 4FX5A 4HQOA 1IDOA 4C29A 4IXDA 5HDBB 4HQFA 3HI6A 1MHPA 3GXBA 1M10A 2WW8A 3EGXA 1JV2B 1ZOOA 1SHTX 2XWJI 3TVYA 2VDKB 3K6SB 4XW2A 1BHQ1 4O02B 1UEXC 1SHUX 5KYUB 3K6SA 1PCXA 1FE8A 3V4VB 4IHKA 1U0OC 2NUPB 5KYUA 3ZDZB 1MQAA 3EFOB 4Z7QB 1M1XB 2I6SA 1V7PC 1FNSA 3EFOA 3T3MB 4F1JA 3IJEB 5ES4B 4UM9B 4DMUB 4WK0B 3TXAA 1IJBA 1YVRA 5KYXB 1N3YA 1DGQA 4CNBA 5HGJA 4NENB 1XDGA 3EOBI 5LN1A 2VC2B 4NENA 2VDLB 1N9ZA 2WINI 5E6SB 5KYYB 4HQKA 4IGIA 4WFQA 5KYYA 4MMYB 1MQ8B 4HQNA 1TYEB 3ZE0B 2VDPB 3PPVA 3RAGA 1BHO1 5E6RB 1YVPA 4G1EB 3F74A 5KYWB 3EOAI 4WK4B 1JLMA 1MF7A 3TCXB 1MJNA 5KYWA 1RRKA 2X5NA 1NA5A 3NIFB 1LFAA 1PT6A 2NUPA 4JDUA 4A0QA 1RD4A 2ADFA 3VI4B 3HXOA 4MMXB 2IUEA 4WJKB 3ZDYB 1U0NA 3IBSA 3N2NA 4Z7NB 5KYXA 4C2AA 5BV8A 4UM9D 1JEYB 3EG9B 4BJ3A 4G1MB 3Q3GE 3ZE2B 1JEYA 3ZQKA 1ZONA 3EH1A 5E6SA 4HQLA 3E2MA 1U8CB 3T3PB 3VI3B 2VDOB 4NEHB 3ZE1B 3V4PB 3NIGB 5HJ2A 2B2XA 2NUTB 5E6RA 3K72B 3FCSB 2NUTA 5KYNA 2NVOA 1AO3A 2VDQB 3EGDA 2QTVA 2VDNB 1IDN1 1M2OA 1XUOA 1SQ0A 2I6QA 2VDRB 4MMZB 2O7NA 4WK2B 3EGDB 2XWBF 2ODPA 1PD0A
chains in the Genus database with same CATH superfamily
4BVGA 3DCNA 1G55A 3E70C 2DQYA 2JKVA 3F78A 3HDHA 3Q8WA 1ORWA 5JG7A 3NR2A 4AMZA 3B7WA 5A6SA 4HUQA 4EB0A 1L4MA 1Q21A 2GPBA 4GXQA 4EDHA 2G6TA 4U0JA 3LBIA 2J4CA 5IU6A 1KY4A 2J4FA 4B3TB 1ZO8A 5CG2A 5AJUA 3FPEA 4BO1A 2CXUA 3R9XB 1Y7PA 5EZSA 4QDJA 4CL8A 2J3MA 1TUGA 5H16A 3EXEA 3BXGA 2GN0A 3EA0A 1NW8A 5IWAB 2BV3A 3W6PA 1V43A 2LKDA 2E4YA 4IJUA 3VH3A 1FJ2A 3BXZA 5IXSA 3IGFA 4QLAA 1M3SA 5FX2A 1CHDA 3MBKA 4N3NA 4DUGA 2QRHA 3T54A 4H59A 4F71A 1YMUA 3IAHA 1FU8A 2PX4A 2BZ1A 2QN8A 3DKPA 3EYAA 3LGAA 3GUCA 1ZMRA 5CPBA 3CNHA 2JLYA 2HKIA 2VUTA 3DNFA 1QFJA 4F2PA 3Q6NA 1Z35A 2R1TB 3IUJA 2IU4A 1Y6ZA 2QJWA 3LO5A 3MCTA 3PHLA 4PQYA 4TLCA 1HZJA 2GT1A 2QYHA 1FBTA 3TNJA 4EJFA 1LNSA 1V7QA 1BZYA 2W6MA 4B9EA 4YLEA 1FFAA 2L42A 3COPA 3VVLA 4UCFA 1XVIA 3OZTA 4Q9NA 1HNNA 1BNCA 3C5WP 1AF7A 1TNDA 3BRWA 1S3GA 1C3LA 2B34A 2J0VA 2PN1A 2G0TA 5DNAA 1UFKA 1RI3A 5KYUA 5JZ9A 3DLBA 2PTGA 1WBJB 3FXAA 2V3CC 4MRSA 2O8VA 2PAAA 3COJA 2C1ZA 2O1EA 2PU5A 4K9DA 1K5PA 1D8TA 4A4DA 1VMAA 1LK7A 2JKYA 1Y98A 4X6YA 4I5GA 4JNKA 3SKXA 4BKUA 1XQVA 1Q11A 5DWVA 4LXUA 4GRDA 4CI9A 3L6RA 4UU0A 1Q7GA 4ZDWA 3OURA 3CF4G 5J1SB 1KDZA 1Q92A 3BL8A 3NVDA 1LSJA 2JJ2A 3KRTA 5FQOA 1U28A 1KPGA 3QKRB 4KR3A 1LI5A 4XEUA 4B17A 4OHFA 5E4JA 4DMRA 2NYRA 3T9EA 3AETA 5IARA 1SBTA 5EXSA 1Y5IA 3SHVA 1CQIB 1BE6A 2AR7A 4MWSA 3CW2A 1LLUA 4DB2A 3T7EA 4CU5A 4MW5A 2FGKA 2CUNA 1KK3A 2W4QA 2WD8A 3HVHA 4KN8A 4Q0MA 3SJBA 1QIHA 1NW4A 4TUYA 3CG4A 5BSTA 5DI3B 4DQ0A 1CZRA 4LF6B 4DWWA 4G9BA 1ZNQO 2PJUA 1WQ1R 3B2NA 5FIUA 3V2UA 2A9JA 4OYHA 3NUQA 2ACKA 4IEFB 2WSLA 1A8QA 5CTJA 3OJ0A 4HH1A 1YV9A 3KAQA 2RGEA 2W6JA 4TN1A 5C52B 4WCDA 3W2GA 4BJ3A 1U1FA 2X6QA 4HADA 4TSKA 2H5LA 2PMKA 2JCGA 3ZEAA 1XC7A 5K8TA 3R5TA 1WA5A 4JQSA 2ZRLA 4MR7A 3MT0A 3WO1A 2I67A 4E2ZA 3GLFA 4L15A 2FG6C 2BELA 4KLAA 1KTIA 1WXGA 3G8CA 4PSKA 1DAOA 2ZR7A 4JLNA 5JSKA 2HA7A 4N0QA 3HSSA 1DMSA 3ZHRA 4CKEA 2VS1A 3K9WA 3BT7A 3UV7A 1JA0A 4UHKA 4A6DA 4BZZA 1HV8A 2PVCA 4QDXA 4RW0A 3RCBA 3F5FA 3ZR4B 3HB1A 3ZI4A 5AT1A 2GHIA 3TW4A 1S9DA 3IR6A 3R23A 2M6RA 4JXKA 3TSWA 4YUZA 5A04A 1S5PA 3BCHA 5ITSA 2X58A 3KZCA 3NMUF 2GYYA 1VRWA 5B6PA 2FFAA 5M5BA 3BSWA 1TMOA 2C2MA 2D54A 3WLHA 3RS8A 3L7DA 5IAKA 1LBTA 2XOKD 4CCAA 3D8SA 2W8ZA 3HCOA 5E8JA 1XCBA 5BWLA 4KTTE 1WUKS 1PGPA 1PTJA 2H0RA 2PGNA 4OGLA 2I4RA 4MDHA 5CDFE 1VZ2A 1T2NA 4N0EA 2P9TA 3ETDA 4J9VA 3WLLA 4U63A 3IOEA 3KR2A 2GO7A 1WQ3A 4UMFA 2IHBA 5KNCD 1GRVA 4ZDKA 5TQJA 3ZQUA 1MR3F 4JT4A 2ZUEA 1XNGA 4ZICA 3PQ6A 4HEA1 3SQWA 1XCGB 1XDBA 1IWPB 2CHGA 3QW2A 4AG6A 1O3YA 4Z51A 1VBNA 3JQAB 4XYMA 3T5DA 5HNKA 2M98A 2BI7A 3HRIA 4JOBA 5ALLA 3JSXA 4BEVA 4JB8A 2YQ5A 1UBJS 4V0ME 2Z6QA 1K3FA 2WAXA 1J7JA 1EJ2A 3ZWXA 1PQPA 5TS2A 2EW2A 3KKNA 1IIRA 1E2KA 2O2JA 3IR7A 4M0PA 3EGXA 1OH6A 1V8OA 2J9RA 3NTXA 4DIOA 1PAUA 1SVIA 2KB0A 4EW1A 5AFSA 1UF9A 3OSZA 5HKOA 2QA5A 3FROA 1USGA 2I2AA 1OTHA 3AKEA 3BWYA 1Y1QA 1TEXA 3L49A 3FVWA 1F2UA 2H1VA 1UAGA 1ZG3A 2IA5A 3RSOA 5K0TA 4DWVA 5GV8A 4ZJYA 5CFMA 3HV2A 3JWJA 5JEDA 1DCTA 1DAFA 3N2YA 4JWTA 1U4NA 5KYXB 2WP0A 4BNNA 1XZGA 3GEIA 3EEFA 3VDMA 5F51A 3AR9A 3ORFA 1L5ZA 1SKYE 5EE3A 4W7SA 1GOTA 1NVXQ 5BQ5A 4FOTA 5K0NA 3UNXA 4QECA 2AHRA 5FWNA 2CJFA 4E11A 2QDXA 3DLIA 3CLTC 3PYLA 4AXBA 3TVTA 3VR6A 1I2ZA 5FPKA 4YJ3B 4UUMA 3WDSA 1F8FA 2HV8A 3O0DA 4DY4A 5J63A 1XPUA 5SV2A 2RH9B 3HZRA 4FD3A 4YALA 5ARDA 1C1XB 2PH5A 4FXPA 1NNLA 4F12A 1WU8A 4HVCA 1GSIA 1QHIA 4J4TA 2TYSB 3ROQA 2Q5OA 1M6EX 4HAWA 1W0KA 4JLAA 5ABPA 5C80A 1EFRD 1DKQA 2IEDA 3SG0A 1ZGZA 1PX2A 4MMXB 3HXOA 2QAGC 4I4TB 3EXIB 1QFSA 1ZMXA 2ISQA 1A98A 1JLSA 5JC1A 1YUBA 3MMNA 4H4CA 2B25A 4RMJA 4B6RA 4YT2A 2FSGA 5K0EA 3LOPA 1Y48E 4QUEA 5EGSA 4M0CA 5TQ0A 1BVHA 5B6IA 4G86A 1JQJC 2O23A 4DGSA 4EQ6A 1OMOA 3CTPA 1ZONA 4ZOBA 3QEBZ 5CCBA 1TCAA 1N9KA 1UM9A 1X1AA 2JS7A 3TJZA 4MZDA 4ZAYA 4C22A 3I3OA 3M5PA 3QKSB 1E4YA 4Z2YA 1REQB 4L28A 3V4OA 2H7XA 4BLRA 2ZBFA 4XCVA 1WP4A 1NMSA 3CUSA 4FU0A 4MYCA 1VI5A 4JWKA 3GLTA 3P20A 1CKEA 4MO9A 4OFXA 2X41A 3T0IA 1QP4A 2D1TA 2HF7A 3AERA 3CEMA 3H1TA 1O54A 5CVTA 4UBJA 3RREA 2AOUA 3VYWA 3S2FA 5IVPA 3RVBA 3BTVA 4NARA 1OT5A 2L2QA 1FYFA 2ZWIA 5AKYA 5AW1A 5CX1A 1KSJA 3RNLA 3FFWA 1WCWA 4GM0A 1QUFA 3VKWA 4GX1A 3KPVA 3TGWA 2UAGA 2REQB 4HJXA 4XWWA 4ZDIA 4NS1A 3H4VA 1YJAA 1T35A 4RMGA 1WXWA 1T0IA 2CWWA 1WS6A 3ABRB 1H0KA 1K68A 3MELA 4JBHA 4G25A 4OAOA 5CXQA 2SECE 3WZMA 2D1SA 2GTIA 3O8QB 5SYAA 1V1RA 1XEXA 2GCOA 3EDMA 4JC4A 1JT2A 1KTVA 2B8WA 4OHWA 1JHOA 2Q28A 4QAJA 1NBEA 3L06A 5J2UF 5B4UA 3LPLA 4OVKA 5BWMA 3CZRA 3AVWA 4RFVA 4TXNA 1W1IA 1AE1A 1S1CA 1VKHA 4KCGA 4UJ5A 5FBKA 1KFJB 3I9V6 4CF3A 1U1DA 4O4LA 3TS1A 3HVRA 4U9HS 4UHEA 3NOVA 3U4IA 4KWIA 5DIZA 3TAHA 2WF8A 1RWBA 3MWDA 1C0IA 1KYWA 1RYHA 2UVPA 1DXQA 3EXFA 2RGGA 2QBYB 2WPDA 5ALDA 2CV0A 2QYOA 4FN5A 3L9XA 5GJWC 3DOIA 5BSHA 1ZOOA 2Y0EA 4ZHSA 2YMPA 3LO8A 1U81A 5KWIA 4R40A 4N7BA 4O4HB 1TK2A 3DAYA 3EFOB 3E3LA 4WERA 3GCZA 2I2WA 4B4UA 1GWNA 4OMFG 5AM5A 3VJLA 3A1NA 2QAGB 1DQRA 1AGNA 1TPZA 2O2XA 5KX5A 1R3UA 5KSOA 3AHHA 1G18A 3H16A 1UC4B 5CU7A 1W2WB 1JKIA 1BKDR 4WKNA 2R6FA 4FMDB 4L1KA 1YT5A 1WXEA 4O2BF 1YHYA 1E79D 2PTHA 1R66A 1WEKA 2GUGA 5IUKC 2WFLB 4GBMA 4POAA 1DE0A 4R0VA 4X62B 4B6EA 2RHMA 3NWEA 5ETJA 3RUFA 3CH7A 3EG5A 1UKCA 1MABA 1MD9A 3QHPA 5AW0A 2G08A 4ESHA 5DULA 3K7EA 4B76A 5ALJA 3IL2A 4Z3OA 4TV9B 1UBKS 3DV0A 2Z09A 4B3CA 3NU1A 3TG2A 2XQFA 3N8IA 3WIVA 2C5GA 1CR1A 3WYCA 4BO5A 1RHJA 1EFTA 2JHCA 3HEAA 4RIHA 5KTPA 1GPLA 2VYFA 1RCUA 1QZXA 2XRYA 2R7MA 4ZARA 5KQPA 3M1AA 1Y8RB 4GMDA 3PC3A 3V7WA 1XB2A 2R4QA 3DBVO 2W2NA 3HI4A 3WQRA 2IK8A 5AM2A 3IQGX 1BU8A 2H31A 4XZ3A 3IJRA 3O4JA 4L02A 1ZGAA 1KC3A 2E1RA 2I55A 2XVAA 3U4AA 1N33B 2BE9A 2OHXA 4MVJE 3TNYA 1QO0A 3F7NA 1ODJA 1Y1PA 4BNWA 4EJSC 2NX2A 1PK7A 3GJ3A 1R0YA 2AMLA 3OQJA 1U3CA 4DEXA 1MB2A 3RYIB 5H9VA 5GTDA 3QX7A 1H9CA 5TNXA 2H4JA 3O2JA 1YTUA 2I1LA 1YS9A 3A26A 3KHTA 2CFIA 3ONWA 3LLMA 5I4IA 5ECDA 1AUPA 2OXRA 4BMSA 1KZ9A 2HJ9A 3KEOA 2IQIA 1F6BA 3WBFA 5B1YA 2PEYA 1YXMA 3VTZA 1RIIA 4C0QC 1DTSA 1WULS 2OZLA 1YJ8A 1UMDA 4TYNA 2G63A 1N8TA 3I37X 4OLHA 2EZ8A 1ZK3A 3WGLA 3B1VA 1A95A 4HAVA 4NL4H 3EG9A 2VEOA 1G21B 4ENSA 5FCDA 1U9CA 3KYCA 4J7UA 1QVWA 4N18A 5LZ7A 3ACCA 3CINA 3SJ7A 2QMHA 4P58A 3ZDAA 1ICIA 1GV1A 1JWAB 1L2TA 1NTRA 2P5UA 1NLYA 2RAVA 2Z1NA 2ZRQA 4YRNA 3UEOA 4Z9AA 2UZ1B 4BJ5A 4HCJA 1DB3A 4F6LA 2FRVA 2YN2A 3KSAC 4OB6A 3UHOA 2CFTA 2QR5A 2FPLA 5C8VA 4KITB 2OHOA 1Q2XA 1H4TA 1PNQA 2LV8A 2O7VA 3UC5A 1RRVA 5B36A 3KSZO 2Z2YA 3KYBA 5A4JA 1V7ZA 2GPTA 2NO4A 5FUQA 2QNBA 3S0JA 5JAZA 3CH5A 1ZJ5A 1LS1A 1Z7WA 5KSZA 2OLEA 1FS6A 5DM2A 1L4NA 5D5HA 1ZRMA 3QNUA 4A91A 4D5GA 3HE3A 3BH7A 3LT4A 4CQLB 3I1FA 3KP1A 4N3BA 5JO9A 2HWXA 3Q87B 1L7OA 5JZBA 1TT5A 2XW6A 4BMVA 4JR1A 1WPGA 2ZJ0A 4QTUB 3ZD8A 4RFLA 3U09A 2I6TA 1LK0A 4I3FA 3IMFA 1QGAA 2VEDA 4FN4A 1N0UA 1Z82A 1VP3A 3EMVA 4C7XA 5JPIA 3TXAA 1BKYA 1RR6A 2H7VA 4N0PA 2QSUA 3WB9A 4RVCA 1UK7A 5KVVA 4PV7A 2ZJAA 1K6EA 5DW3A 2VRCA 4QTYA 3MHTA 5CEEA 1FP1D 2MYPA 3F3KA 1R0LA 4MQ4A 4ND8A 4GEGA 1YCHA 4RORA 4R68A 1AX9A 4B35A 4US2R 1W7AA 5HJEA 1F3LA 2CMGA 2VJLA 4PC7A 3URMA 2VQ3A 1XRJA 1XU4A 3S8YA 3I9KA 4BASA 2WF9A 3W5CA 5ULLA 1SVSA 2BZGA 2JGJA 2RH5A 2V74B 2X77A 3IVRA 3KDAA 3D59A 3LY5A 5EEGA 4WNYA 5KYWA 1P0PA 3PBKA 4J1QA 2HHLA 4HNQA 3F5DA 4CPDA 5JTUA 1FDOA 1G1AA 3BE8A 2Z3ZA 1Z5UA 3T7KA 3WSVA 1ZITA 2H9YA 3I9JA 4GI7A 2BGLA 3PJDA 5LDHA 1LLQA 3DULA 1T3LA 5GM2A 3TD9A 1MG0A 2EP5A 3S2SA 1U1IA 4IHAA 1MB9A 3AUTA 3OZIA 3UJ9A 2OV8A 4P4NA 4BRUA 1UDRA 1MVOA 5HBRA 4IIJB 2E3JA 3D02A 4UM5A 4Q9LA 3ZLUA 1P1IA 1CULC 2HRZA 3RRJA 2G28A 2Q4OA 7AT1A 4NV0A 4HDAA 3DVLA 5E7MA 1GTVA 3WK9A 4B2YA 4BQFA 4Z1MA 3MCVA 3IVXA 3AP1A 1BH2A 3ANMA 3QE4A 1U2DA 4HR7A 4EA6A 1N6HA 3A25A 2HLPA 5AJTA 1MP0A 1CRWG 3A9WA 3VR3A 3ZQ4A 5FFNA 3S8EA 2XZOA 4LNUA 3RRXA 3A7EA 4QICA 2GJ4A 4MJ3A 1XMSA 4V1CI 3INRA 2RIRA 5KWJA 3T5AA 3IV6A 1R9JA 1TU0A 3FNQA 2C20A 2BR3A 3AEQB 3QH4A 5CGZA 1GGFA 3TRFA 4YXWD 1RYEA 2ZUBA 3ENVA 1CF9A 3WLAA 3UN1A 1RI2A 3F6RA 4MAAA 2WZDA 3JQDA 2BOVA 4LE2A 4MHSA 4TMKA 4YMGA 4HX9A 2UZIR 4UUPA 3H11B 4QYMA 2OWDA 1Y33E 1HTTA 4HGQA 5C34B 2A59A 3WWEA 1UFRA 5KUTA 1B8PA 1Q50A 2QLMA 1JL3A 1QQ7A 4TQUS 2ZBRA 2DLDA 3I83A 4KJZA 4N5MA 5BXQC 4TS3A 1IK4A 1A2KC 2ET6A 1RJEA 5A5DA 2XJ9A 1BJKA 2XNJA 3SC6A 3TVDA 1DXHA 5A4DA 1M2VA 2ZUTA 4B43A 1JVBA 1OBHA 2J87A 3D6VA 4X00A 2PMBA 3EQZA 4J0DA 4Z0PA 5KWSA 5CLHA 3LRXA 4PZAA 1N6IA 1O77A 4KK3A 3B1YA 2QPTA 3U9TA 4ROTA 1AURA 4WTOA 3EIOA 3W4JA 2EF0A 1KO4A 2YXPX 1Y8CA 2PCJA 1E9FA 3RIMA 2IDMA 3DDUA 2PUWA 4L4ZA 5JVDF 5TJHA 3VMMA 2IH5A 3IHLA 2PZAA 2IZ6A 3A37A 3OIVA 1KMNA 1MGPA 2DECA 4TXMA 4IDAA 4QSMA 1JVSA 4XPIA 3ASZA 5TQ2B 1V4VA 1T10A 2EV9A 2OHHA 2IY7A 3A3KA 3FBTA 1SHJA 3QVUA 4B8ZA 4B3MB 4B40A 1IE3A 2G76A 1TCUA 7YASA 3CSSA 2BVNA 2ZE7A 3ISJA 2VZ0A 2PXAA 1V3QE 3FOWA 3FYHA 1C81A 1II9A 5DT2A 3GAMA 2CLMB 3AUFA 2JGMA 2VWGA 4BRWA 2IHUA 1V9SA 4KH0A 4NMHA 4XYBA 3WISA 1JMYA 3SSAA 3WX0A 4BV9A 3EVTA 3A8TA 4L6CA 3G0BA 1M54A 3TLCA 1KI4A 1E99A 2PRIA 1MJGA 2G5CA 3KOWA 3I01A 1ID1A 1NU6A 1GAEO 2DP4E 4QYIA 3RC7A 3KOXA 1PWYE 2JVJA 1I4WA 1N4AA 5IN4A 4PXAA 2C00A 1R6BX 4V39A 3UTDA 1N5JA 1TCBA 2I2XB 3H18A 4K87A 2GCEA 2EKZA 3IA7A 4R1MA 4EFNA 3LX8A 4P80A 4AT1A 2WFZA 3C43A 3L93A 4C2AA 5CCEA 4D25A 1R5JA 1TVCA 3JD2A 4I3GA 2FW0A 5BN3B 1B2LA 2ZJ7A 3QSGA 5ALUA 4NPCA 4WI1A 1FX1A 2OZVA 2Z1MA 4UAVA 1ZOIA 1LVGA 2X0EA 1TU4A 2PD6A 4PG4A 5I5EA 1Z06A 2Y71A 1C7RA 2GGSA 4RKYA 5AKXA 4PSUA 3IPCA 3DMDA 1QGZA 1OXVA 2FR1A 1C9DB 1YA4A 1V2HE 4KE6A 2QTAA 2YXDA 5GV7A 2IHTA 4L4SA 3T5CA 1O95A 1P2VA 5HUQA 2C96A 2HA3A 4NCHA 3UH0A 3UHFA 4A8JC 3RYTC 3FF4A 1JHYA 3GNTA 3JQBA 4BVEA 3OP1A 3OT5A 4ZFNA 5AIBA 1KO1A 2I78A 5LUBA 4JT2A 3V80A 5K8UA 1ONOA 5U4XA 3VA7A 1A2OA 4BWVA 4HS9A 5DTEA 3RROA 2OM6A 3ODPA 4HMQA 2BI4A 1AXGA 2AUTA 4P35A 3WOVA 1ETHA 3SD7A 4BNGA 4PTYA 1J33A 4DA8A 5HR5A 4F5ZA 2NMVA 3QV2A 3K2EA 3TLBA 2FW6A 4J29A 4LHWA 4R69A 3VKUA 4LYAA 1F5NA 1TM3E 2V6BA 2ST1A 1GRCA 1YS6A 1RYFA 2UZ4A 1VMDA 2WIGA 5FUYA 5FEMA 1M1NA 5F98A 2DKNA 1R64A 1N6RA 1YA8A 3P9ZA 3BH6A 3OHSX 3URKA 3WK5A 4DA7A 5I45A 3MWFA 3OTWA 4FDVA 3R75A 4OA5A 3WL7A 3PPIA 3AR8A 5B3AA 1G4AE 3QI2A 3GRKA 1ESZA 3B9PA 2P27A 3GB9A 4MVJH 2X13A 3K6RA 1DKMA 2ZUSA 1WSWA 2AR9A 1GKIA 2ZG6A 2AOXA 4Q12A 4I1RA 1JEOA 3K1YA 4MP3A 5ALFA 1II8A 3IEIA 1NXSA 2C4TA 2WWFA 3DV2A 2VP3A 4LXXA 4QEKA 3PNOA 3H7IA 5EJAA 2GBPA 4UBKA 4NJEB 1JPVA 2ZYWX 4PZ0A 4R1SA 5B1EA 2H4HA 1JU9A 1LI7A 1ZOLA 2PX5A 5JSZB 1V8DA 1U8EA 2X0JA 4QXQA 4DBLC 5IT5A 1BGWA 2OD2A 3LDAA 3BXEA 3JQ6A 3CJQA 2O6HA 3FVTA 4NK4A 4C08A 4E5UA 3RWOA 4R2WA 4ERNA 3EGWA 1O4VA 2HH9A 4OI1A 1ODLA 4E1BA 1AKUA 3JVEA 4BNDB 2RHRA 2DQSA 1JIKA 3KKMA 2O7SA 5ELLA 1WETA 1HE3A 3BXHA 2FVXA 4RFSA 3WP1B 4TZ6A 1X7ZB 4N54A 1GZDA 3NB0A 1LK5A 3O8CA 4WA7A 1U5BA 3IKTA 1L0BA 2JGLA 2W9XA 4JLOA 4TSFD 5A2GA 1DC8A 4IIVA 3ZJUA 1NVMB 4B6FA 1NOKA 3AF6A 1XCOA 1V11A 2ZJOA 4EENA 2FHPA 4RK7A 3KJIA 5FUXA 3ME5A 1G2PA 2B4QA 3O4FA 2WJHA 4WFIA 3OTIA 4F4JA 1ID8A 5HCIA 5GAJA 5MN4A 2RHBA 1PO7A 3QBJA 3PJFA 3OX1A 2P2CA 2F1IA 1ABFA 2GPJA 2OBLA 1F8YA 3GFFA 4NBTA 2GPNA 4PLVA 5DYWA 3UJ3X 3WY9A 2FUCA 2LP4Y 2NU8B 1HWYA 1RIFA 3ILSA 4LOHA 1UJ5A 3OHMA 5EIEA 1Q0QA 3M1YA 4E7OA 2WSBA 5A0TA 4HSGA 4F2WA 2PAFA 3M6LA 2F1KA 4UBIA 2CXHA 1X1BA 1DKLA 1EJ0A 1AN9A 1XLTA 4MKIA 1XMJA 5HGXA 3IYLW 5E1OA 4XARA 2HK7A 3VR4A 1Z6YA 1Z3CA 3WICA 4C0WA 1DQPA 1H8HD 5DX8A 4CFYA 1CUBA 2NZWA 1JEYA 1TDJA 1RABA 2KBEA 5CT4A 1JP7A 1QVVA 4DEYA 2NU6A 4D74A 4X54A 2ZRBA 4XVCA 2NG1A 3I58A 1FYXA 4HZUB 2HXSA 2I4TA 4RZQA 5IVDA 3L4KA 1AJEA 3NX4A 3E7PA 2P9JA 3OT1B 4WA8A 2QTVB 3EPJA 1CZKA 2P8SA 4Q7KA 5EHQA 4IJQA 2XF2A 4OXXA 1WVMA 2XYPA 2AE1A 2PKQP 2YS7A 1ECCA 1TLLA 5E7JA 2A9QA 2O5EA 2VBIA 1PD0A 2OECA 3V32A 2A1UB 1QFMA 3M6IA 3OE4A 3GN2A 1RADA 3BMQA 3SVZA 1CK4A 3VYSB 4BUCA 3RUPA 5F76A 1XZFA 4HDNB 2V7BA 2H85A 3A9CA 1OC4A 4I9GA 2PGXA 4ZC8A 3WQQA 3AVYA 5CDGA 3IIEA 4BP1A 3RKRA 3NC4A 5EPEA 3ZHSA 1X7HA 1V5WA 4HT3B 1NX9A 4OL9A 3USCS 2A14A 2R8EA 5IM4A 1XWFA 2OC4A 1QYXA 1FPQA 1U2EA 3IXLA 4U7PB 1FXUA 1KA9H 3E7FA 3KQWA 3BH0A 5DNEA 5JCJA 3WYFA 4F4IA 5C1BA 1YFKA 2G9UA 4XWOA 2OBXA 5C8YB 3KZOA 5JFGA 1WDKA 5K0ZA 1EVZA 1VHDA 2BDTA 2VT2A 5D01A 5A5FA 2G40A 2RGCA 4NDAA 3IA2A 2J6HA 4N65A 1DBIA 4E32A 5JD5A 1L6IA 1XPRA 3VOBA 1VIVA 5G0SA 2J0QA 2OFXA 3ZPXA 5JJKA 3D6UA 1Z22A 3QJ5A 3KFLA 3LBAA 2ENUA 4Q7LA 5PGMA 4D8UA 3ASVA 1GFSA 4YCCA 4G5QA 2JLZA 5JSFA 1CG6A 1D2GA 2CV1A 1QFYA 2HSDA 5ALRA 1RRMA 2GEJA 3B89A 4II3A 4EL5A 1Z39A 2CXSA 1TC1A 3M1LA 1GRQA 3T52A 1YBAA 1NVGA 3AB7A 2WHXA 2JGAA 5C5CA 4G8CA 3P45A 5KYKA 3ESRA 3H4MA 5JAMA 2V7UA 1RWMA 3SR4A 3LUHA 2OQ2A 1NBIA 4AUMA 1NUTA 5CNIA 3FJ1A 3TI9A 2B30A 2GN2A 3E9YA 4GUDA 4HLUA 4I55A 3V1TC 1DGQA 1RWPA 2XIQA 3P4UA 3JQCA 4QBFA 1MJGM 2AJDA 3P0FA 1YOVA 4N0DA 4TLEA 3I01M 4D3ZA 1LGYA 3HP4A 4X7PA 4H1VA 4NZNA 3DVQX 2ZT6A 5LJLA 4JBIA 1SM4A 3ZLTA 4MQUA 4EPTA 2P4HX 1S2MA 5H80A 3KYIB 1IVYA 2FI1A 5EVCA 3G89A 4YV0A 1B0AA 1EVYA 5GIOE 3IO5A 5IF3A 2VSXA 4C43A 1YVPA 5I9SA 1FX0A 3E8MA 1XZAA 1QFZA 5BPHA 4U7JA 1ZSNA 2ENWA 3IDFA 2A1TS 4QJ4A 3UT0A 2VXYA 4KFSA 3OEEA 4R9NA 3R3VA 2Y1OA 5J2TF 3EIUA 4YJKA 2ZDQA 3O3CA 1I3LA 5EKXA 4ZYXA 5KKNB 5BSUA 3DMPA 1H6DA 3Q3JB 1OWPA 1QZTA 4C21A 4ZCTA 3F9IA 4RGYA 4OFWA 1NN1A 2AG1A 3JRNA 2WHYA 3LOUA 3R3HA 5FBLB 4HDRB 1U2GC 4ZAWA 3V33A 5FI5A 3TD2A 5IXYA 3Q7EA 1C3OB 1L5VA 5E6UB 3N2KB 2YZMA 3GJTA 3RGGA 4PGGA 4HY3A 3EBLA 2QXUA 1E5TA 3A6GA 3FKSA 1JXMA 5F35A 4TWIA 1HFWA 2HK8A 1CB7A 1YCFA 4L9AA 5JARA 4KMSA 1ML4A 2HQSA 2BDEA 2QRQA 2C94A 1VJ0A 2CMFA 2ZIAA 1YZQA 3P4YA 4X90A 4MB0A 4IDPA 5F21A 3F7MA 1SXIA 3E9ZA 3B78A 5LQSA 1YO6A 3DMGA 1GKKA 2PH3A 2CUKA 2OA0A 1XNQB 1F0YA 4Z53A 3U3DA 2B82A 2FB9A 3BMOA 2E5WA 4AMVA 2FFHA 1DAMA 2C95A 3R1IA 1N6KA 3B3FA 4JITA 3LTNC 1IZ0A 2OV4A 2PPVA 1PD1A 2SCUA 2Y1GA 3EIXA 3JQ8B 4AI6A 1GTZA 3PHIA 1LBEA 1W52X 3GR6A 1YU6A 2I66A 3L8GA 2NZJA 1P29A 4AN1A 3TLGB 2DQKA 2AQ8A 5TQVA 5JAPA 1EFPA 4EPWA 2F4NA 3PX3A 5JMWA 1T5HX 1NE7A 1T4MA 3D6HA 4F93B 4YCBA 2RG7A 1U2SA 2PMFA 1QK4A 1CJCA 1HORA 1Q1QA 2DUMA 1CY0A 1ZD8A 2EZUA 2O5VA 4FEEA 3T7RA 2OGTA 3UY4A 4DIMA 1SUBA 1WSDA 1MXHA 2VK2A 3U4CA 2ZCJA 3V3TA 2PS1A 5ITZB 3HKCA 3QVTA 1YZYA 4A2PA 1HX7A 1QC5A 4PG6A 3E8XA 1Q0UA 1HXHA 2OG2A 1ZVVA 3NRCA 5H0IA 2OB1A 3VPBA 4UHHA 1G6HA 3ND7A 3TQTA 3R4CA 1NY6A 3OIGA 4DR1B 2DRIA 3CR3C 3ENKA 4HO1X 3ENNA 1AGYA 3P5BA 3WMWA 2ATVA 3A6PC 4K9PA 1J00A 1JLLA 2JA1A 2V03A 3O38A 4FFOA 4ISBA 2VZ8A 1C1YA 4ENVA 1VG8A 1TUBB 4NV1A 4QPCA 4BTVA 3MJ4A 5J4VA 1PCXA 2WWVD 4KMMA 2M6SA 1U0OC 1J0DA 2WJ6A 4MQBA 1NAHA 4ITVA 2NQ8A 1W88A 3TEFA 1JJBA 3A2MA 3VDXA 2C5AA 5LDGA 1Y8ZA 1E0KA 1FJHA 4NU5A 3HM2A 4UBOA 2PZLA 3GGJA 4YRRA 3SQDA 3IBGA 1Z17A 1I8TA 1J39A 1TTQB 3KAJA 2OLKA 3KBBA 1WKBA 3FSGA 3UMJA 1WDLA 5ICSA 2OXIA 3GP8A 4GXTA 1RAFA 1EGAA 4XM2A 1Z4MA 4PPFA 1E7WA 4DUGD 5J47A 3T1TA 1OIVA 1R0XA 1N2SA 4WFQA 4I50F 5D6NA 4BYMA 4QLOA 2XTZA 5AOCA 3FUVA 3O83A 1N32B 4Q9IA 1KQNA 3UAGA 2QIOA 4ML3A 1GILA 1UXOA 4Q9HA 4HFRA 1G98A 4QQNA 5K09A 4H6PA 1SNYA 3N76A 4S12A 5LWHA 3RFVA 4CT5A 1W8DA 4Y6LA 4WJLA 1JKXA 1BU5A 2OFPA 2B9EA 3I6ZA 4E5PA 1PR1A 4OA8A 2P3QA 4PXYA 5EIHA 3BRWD 4NYIR 4CG0A 1Y1TA 2WZCA 1JAZA 2NTJA 3PT5A 3N2EA 1I36A 1L7QA 3A32A 1Y4DE 2JGFA 4KZKA 4UU7A 1D07A 5ICGA 1CQWA 3FYUC 3ZGXA 4E12A 1RAAA 1HRDA 5J1TB 1ZJWA 1P9RA 1WV1A 2EBHX 3RM3A 1D1SA 3W77A 1X74A 1ESEA 2R6GA 4QBHA 5LZ2A 1FDSA 3LT5A 1KYYA 3BTUA 3WGJA 1ZM7A 4GIBA 3KTDA 1MAAA 2Z43A 3UAZA 1JHAA 4TKUA 1E62A 9ABPA 1O6ZA 1T8PA 3NFYA 3QUQA 4UHBA 3H19A 3DKKA 4Q66C 5KOIA 1MCZA 5IAAA 3GLHB 4PPGA 2W83A 4CM4B 2FPWA 3QOWA 4MV0A 1Q0ZA 2Q5EA 1CUSA 1MB4A 4GI1A 5K3AA 5HIMA 1G2QA 2OQRA 2RBGA 3I9V1 4O2AF 2R44A 4I19A 4WJZA 4FMBB 4FDAA 5J40A 1N6NA 5A9SB 3MM4A 1CQXA 4GYKA 5DO9A 3T1OA 1MORA 3RKUA 3BM5A 1WW2A 3UT5B 4D3FA 1VSTA 1X7GA 2W6JD 4HNAA 3MB8A 4HGNA 4JQCA 3W6NA 1YS4A 3L0OA 3TE6A 4RWEA 3P2EA 1PLLA 2X76A 1P72A 3G9TA 3GARA 3T99A 1XZPA 1X7XB 3RLFA 3ZNOA 4PHCA 5DGHA 2Y3IA 1Q7CA 2JBWA 3HA5A 5KHLB 1QH8B 2LXNA 1K89A 1KP9A 1DC5A 4CGYA 1PWXA 1U98A 3D8UA 4AYTA 4NBLA 1KWGA 4K6FA 1KJ8A 5IC5A 2A8YA 2ORIA 3AW9A 3GHHA 2VJMA 4Y18A 4HV4A 3NHYA 3SU8A 2AFRA 4NH4A 1K7YA 1S7GA 4A0RA 2V7VA 4A26A 3ICVA 2R751 4UXJA 4LZOA 5JD6A 4HBGA 5U4QA 2F8TA 5I3CA 4UZEA 4EHHA 1NM5C 4YRKA 3IT1A 2BRUC 1C5KA 2H4ZA 2G9QA 1D2HA 3FFTA 3VBCA 5EJ6A 1AZWA 3WHIA 5JY6A 2ECQA 3NLLA 1H0HA 2W11A 3AEYA 3W5AA 2DR2A 5AVKA 3T06B 3DYIA 5K8JB 2WB2A 1PR2A 2RAFA 1LRKA 5BYJA 5BWBA 4DKJA 3E5NA 3D0OA 4Z7QB 2PIDA 5I51A 1XWWA 3ZOKA 4R71A 1NVEA 2FN8A 2BKVA 4OI4A 3MQFA 1O9GA 4ID9A 1UBLS 1WCIA 1ZK2A 3U1BA 2D0DA 2CLKB 3HGQA 3QY0A 1S2GA 4BFWA 4MPDA 1V5EA 1ZUD1 4PIMA 3I04A 4Y9SA 1DX9A 1PEKE 1VE7A 3UGTA 1V8PA 2HLHA 4IFBA 3UZUA 3A0RB 4D5EA 5A3QA 1IHXA 4D97A 4FYJA 1NRIA 1R10A 2BTQA 3K0HA 3PLRA 5L4SA 1XPJA 4TZKA 3T1NA 5IDWA 3VVBA 4DBLE 4ZQIA 1D2AA 1NI4B 4JVMA 1ND5A 3KPUA 2EEPA 1EEXB 2XE6A 2OBMA 3STUA 4RD4A 5SYNA 2H1WA 1GPWB 2H48A 1KYXA 2PVPA 3DNMA 3EOAI 1H65A 4WK4B 5DK6A 3A4MA 5EJMA 3X1MA 2QNRA 3ULKA 3U7RA 1QIIA 3KZVA 4DBZA 5CA1F 2EARA 2OUKA 3EIEA 3T9BA 4CIVA 4MOWA 1L1EA 4F9TA 2CHFA 3GLIB 1WVGA 2PFKA 3CQ9A 3DPUA 1TKAA 4FP9A 4HYYA 1MLDA 3G2JA 4IM7A 4B83A 5IM5A 1E1DA 2W43A 2H1HA 1KPHA 3VJRA 3LF1A 4W6ZA 4BXOA 2ZWPA 2HN9A 3ER9A 1Q1BA 2XYQA 1Z5GA 4RL6A 1HLGA 5HKAA 3BRQA 4MGYR 3ROZA 2JFUA 3QXGA 2VYNA 1E59A 2Q41A 1CUIA 4MWZA 2VBCA 4RQUA 2Y93A 1P0CA 5GM1A 3SXPA 3VI3B 1PSDA 1DBSA 1PIWA 1FFXB 4XAQA 4XM1A 3VR6D 1OPRA 2R96A 3ZNPA 4C4AA 5LQKA 4OAQA 2QL5A 4BATA 2GD1O 2QLTA 3SK0A 5BNFA 3A6JA 4DCGA 5KOHA 5LZ9A 1AVTA 1GUZA 2OAP1 4PO1A 3L4BA 4LV5B 3E4DA 4CHGA 4YPOA 2XXAA 3PP8A 1G3QA 1OI4A 5A5VA 2G5PA 4JI0B 4AP5A 4QL3A 3L0IB 1W0KD 5GPBA 2HNKA 1KKLA 2CNOA 2Q21A 3FGOA 4H7EA 4IKEA 5J2UB 1SD2A 3PDIA 3QLJA 4LXQA 1CR2A 4L5JA 3ZCTA 1T3HA 4D4LA 4Y2RA 1FMLA 2FFBA 2YY5A 3NNNA 3SIPA 3I52A 1H85A 2GEUA 1URPA 1UWLA 4JBGA 4OQLA 3UV6A 2HO4A 2PJZA 1VBMA 4XSVA 2Z8XA 5BURA 3OQNA 3Q7PA 4IDFA 3DC2A 3JQEA 1CUHA 5J58A 2P35A 4TL8A 1VXOA 1V8FA 3JQFC 4DS3A 4C03A 2ZE5A 4MJXA 1PR9A 2BHRA 2CK3A 3GUVA 3LYHA 3N07A 4IJMA 4NYJR 2GCIA 3F2VA 3S40A 4B44A 4C88A 5BSEA 2EJCA 2XZPA 3ZWYA 1PHPA 1KRHA 2BEWB 2C7VA 1ZD5A 2HLDA 2I1WA 4FC7A 5ICCA 3ZVRA 2XUKA 4JIMA 2ZATA 2DH6A 2Z5FA 2ZYTX 3DFZA 3BGSA 2NPFA 3TTUA 2AF4C 3Q7RA 1JR3E 2PIAA 1XK6A 5KOJA 1J9GA 1GFZA 4B79A 1UJCA 4FX5A 5IMBA 5HTOA 4IH4A 1N57A 4GPAA 4OLJA 4MLCA 1UDXA 1VG1A 4O2BB 4A03A 1NC1A 5KJ6A 3ZGOA 1R0SA 4F85A 4FHDA 4QXAA 4RPCA 4XDGA 5EIBD 4F3RA 4ZYVA 3P9CA 4UHDA 3WGZA 1VL6A 2WC1A 2X6RA 2QDKA 1E2IA 2D5IA 1M2WA 1Y6QA 4N8EA 1RBYA 1RXIA 3ZIDA 3LT0A 2JJYA 1QPZA 2X15A 3Q6IA 5LBTA 3U31A 3A6EA 4OM8A 2FDCA 3ZWWA 3JATB 1KOFA 4LDQA 4PAQA 1YB1A 4KX3A 1OV4A 4CL0A 1B16A 2ORYA 4M4SA 4D0NA 3MLBA 4YRCA 4A92A 3OQMA 5AJVB 2CHUA 1SBIA 4XSGA 5SY6A 3RJMA 1XT6A 1IH8A 4XIIA 1YJCA 4KGZA 4HUTA 4QGBA 4M98A 3H3JA 4MKGA 4XUCA 5B58T 1ZQ1A 4Z9YA 1M2EA 5HIJA 4YC7A 3IAXA 1ECJA 2BTOA 1SBQA 1YFJA 3QYFA 2CMHA 3WLFA 1WDWB 4BFXA 5DBGA 1O5TA 2VJPA 1FNBA 2OP0A 4R1UA 4RK6A 1A88A 2GZAA 2QN3A 4NTZA 5HIKA 4G1FA 3C5CA 3R3XA 1E0JA 2WPDD 2C29D 3RC8A 5E9AA 3OZBA 4Y2YA 5IKEA 3HCEA 2FZ4A 1E77A 2PZGA 4H0CA 1B76A 4QOSA 3C6MA 2C9DA 2WABA 2ZUDA 4CF4A 2V6GA 1R6XA 2IL1A 3DDHA 5C3MA 3IEMA 1U0NA 3OJWA 5EVJA 4PPNA 2Z9DA 3PQ3A 1BMTA 2E48A 1QM5A 3T35A 3Q7IA 3NBFA 3KKEA 2EFHB 1EGMB 4DRXA 4KPUA 5AM1A 4UOZA 1QDUA 1M5TA 3TW8B 3SYKA 1Q20A 2A5YB 2A9FA 3FMIA 3HSYA 5K9ZA 3HCCA 1VB3A 2PBZA 3FUXA 4DJDC 4KPGA 1KR2A 3EGIA 3S68A 1FXSA 1LC3A 1M34A 4KIFA 5L8VA 3W3ZB 3P96A 1CJBA 4JDPA 2H52A 2PFGA 3O4IA 4C4PA 3FLEA 4EJMA 1G3IA 4K3VA 5GOTA 4AMGA 3NJ8A 3AUKA 1GU0A 4GKKB 5KQRA 4DM7A 1M0SA 2VJOA 3UC9A 1T3GA 4CV3A 3T3NA 4XH9B 1ZVKA 5JS2A 1Z6ZA 3SQNA 1MW8X 2NAFA 2XUOA 1QKJA 3UMFA 3UW3A 5LZ4A 4INPA 4B4OA 4BP9A 2QMYA 1DADA 3AZPA 3E22A 4G1BA 2QPOA 4CM8B 1FQWA 5LL6P 2RC5A 2GJ9A 1JG4A 2IOYA 1W87A 1UEJA 1X70A 3L46A 2HPHA 4YQEA 1AS2A 4FFNA 1EI9A 2C2GA 3QA3E 2QR2A 3I2IA 1JB1A 1SAYA 2A9RA 3QG5A 2WKQA 3M6MD 3LDUA 3PHCA 5D3QA 2QPLA 1WCYA 4C0BA 4CCSA 4CIDA 1CUUA 1E6MA 1OXXK 3Q3EA 4LDRA 2JDIA 4D9KA 1QO0D 5KNDA 2VHWA 1DC3A 4URYR 5FKJA 4LFBB 4JJ8A 4OU4A 4U3JA 1NY5A 1A8UA 3AR4A 2ZWMA 3FUCA 1HT3A 2AI1A 2FUKA 2ZGVA 3L7MA 4JBWA 4A15A 2XI4A 4JL6A 2GCNA 1OJ7A 3D81A 1H2BA 4H3HB 4OHMA 4HQ6A 3P71T 4ZVKA 2ZSUA 3C6BA 4YRBA 5CBPA 5HEKA 3KELA 3P2OA 1F1JA 4IGAA 4G0NA 4NIMA 4DQDA 4KRYA 1QDEA 2VNJA 3AP3A 2GZ1A 4GHWA 5FTKA 4DSNA 1GNRA 4B45A 2XSZA 4K1LA 2OBBA 4F6RA 5BPFA 3RUCA 3HHPA 4EWLA 1KMHB 3I04M 4UNSA 4L8WB 4MWEA 3OKCA 4LQLA 3WP0A 1CVLA 4J6EA 4EZBA 2BFAA 3HLYA 4PYOA 1TVKB 1UIRA 1AGXA 3W7VA 2JFVA 5HE8A 4QUGA 4ER6A 4YREA 2HCJB 4B4DA 2O2IA 3R6DA 1IB6A 4UATA 1RYMA 4UMEA 1O87A 4UASA 4BQEA 1FNNA 1HLPA 3UBMA 2A0FA 2OGWA 2EIXA 2P4UA 4YJDA 5AI6A 2HJHA 2Q27A 4JLWA 4OMDA 1Y5RA 4E14A 3A4YA 3NIBA 1L1FA 4W1QA 2XMQA 4NOMA 4ZOAA 1T9CA 1XI2A 5FLXA 5CLIA 5HCUA 3FGNA 1NBHA 1E9BA 1R4NA 3A31A 4PGFA 3HLTA 2BFCB 2GNPA 4MRPA 5I7UA 1WMBA 4TRMA 2X9LA 5SZJA 2VUUA 3UA3A 3ZC3A 3KQYA 2IKQA 3ZHCA 4L51A 1N8SA 3RHFA 1RLIA 1TEVA 2G1KA 1AK2A 3T7TA 3FYSA 5FNVF 1JVNA 3VSAA 5EE9A 2IYPA 5FOXA 3KQQA 2HHCA 3BGIA 3RSCA 2BGRA 3VOTA 3DB1A 4DV7B 2A1TR 5C3UA 2BWJA 1UOEA 2ACVA 4EYGA 5IANA 1X86B 2YMLA 3WB0A 2HHJA 5IJWA 1RYZA 5DX1A 2Q5HA 2VRCD 1PR5A 2C7QA 4X60A 5I47A 2Q3DA 1P17A 5J9FA 2GARA 2XGSA 4G1UC 2Q5LA 1ZK0A 2PANA 4XB1A 2EYUA 2EU8A 3LHIA 5I3ZA 1MX1A 4RESA 2VAXA 5E6RA 4ZVLA 2YZNA 5H8WA 2BCGY 5CNMA 3SS8A 1QQBA 1K7SN 5K0JA 3OCYA 4XXHA 3PL5A 2I9PA 2QI9F 3U3RA 2VZ9A 1O6FA 1YWGO 1L7AA 2KQUA 4P9NA 4A1OA 4DWOA 3G85A 1YKSA 2ZUFA 1BCRB 4RGBA 4HOYA 5CM8B 4WXRA 3ZU4A 3RC2A 3X1XA 1VIAA 1BD3A 2BEKA 4C6TB 4INOA 4J16C 1G8PA 1T36A 2J0EA 3DOCA 1DNPA 3G49A 3MPOA 1VMKA 4BGDA 4MS4B 5CHEA 4MR8A 2IYWA 2Q3CA 1YQQA 4YBRA 4A8HA 3G6WA 2HT1A 2NLOA 2ZVJA 5GY7A 1BS9A 2QAIA 1CD5A 1FFDA 2D1QA 3FI0A 2BMVA 4KQHA 5JVDB 4N6GA 2Y0CA 1ESDA 3W3AH 2DPLA 1FUIA 2YBEA 3VVCA 1CQPA 4D79A 4I1UA 4G01B 2DHRA 1BXGA 3E9QA 4J7AA 1R0BA 4RETA 1UBMS 1WABA 3FWPA 2HSWA 3GJYA 4WAUA 1TW2A 4MKRA 5AVJA 3VR3D 3AB3A 5CB4F 5JWHA 3E7DA 1V37A 2A3RA 4LRYA 1C30B 2PKXA 1Z33A 5IKPA 1TYBE 2YCBA 2CDBA 3R3SA 2OOKA 4O08A 4W99A 4C76A 3HCPA 1CE8B 1K8XB 4P2GA 4UPDA 4C0KA 2QD3A 3HWWA 2JJMA 4EITA 4JSYA 2BEVA 2GESA 3L8MA 4Z4CA 1QU2A 1FL9A 2FPIB 2VHXA 4LTNA 1J42A 1O5IA 3C1TA 3DM5A 1RAEA 1FXWF 2GETA 5JQGF 1R0CA 4C5BA 4XIFA 2HDHA 5I9BA 3UMBA 4A5SA 3L7BA 4OJKA 4LQCA 4FFMA 3VU9A 2FX3A 2J46A 2FPXA 2ZIXA 4EGJA 3CPHA 2GERA 5K8VA 1HYEA 3OTGA 4TZ0A 4TMFA 1QHEA 1UKVY 3R9WA 5IJ9A 1W85B 1KE2A 3GRAA 1DC7A 1GCAA 3ZV7A 4A82A 3C4JA 4E5MA 3NHPA 3JTEA 2WG0A 2X8BA 4JX8A 1GA6A 5TDHA 3TOSA 5KJCA 1LSOA 1LVUA 2P9QA 4Z49A 2QUIA 2ZDGA 3WNVA 4WLNA 4F3TA 2VH5R 1U3TA 1G42A 2QL7A 3RDPA 3TBFA 5IRCD 1A0OA 1PG2A 2VVTA 2IBTA 3TCXB 4RLSA 5K0LA 3F8TA 5B7QA 1JDBC 2KWIA 3IPRA 4A3SA 3HNOA 3EZ9A 5MHTA 4LWPA 3ZCVA 3IP8A 4HLQB 2EFJA 2BGKA 2C54A 2ZOSA 4NU8X 3BCSA 4XGIA 5E38A 2RI6A 3RTAA 2YHSA 2J30A 4GDMA 4QJ3A 2CFCA 4BMCA 3I76A 4R7TA 3KJQA 3PFCA 4FTWA 3FETA 4KYVA 4YJFB 5BT9A 2ZRMA 4LOJA 1EHCA 2QRPA 3ZWMA 3RFFA 1V35A 2EFGA 5BMVA 2AUNA 3MRTA 4OQFA 2R4UA 3VSCA 2WA1A 4NE7A 2ASVA 2JI8A 2OQIA 2WB4A 2NUTB 1I0ZA 1MDFA 2Z9BA 1V47A 5FLYA 1RYBA 3FHCB 3UM9A 1L8LA 1Z75A 3GVXA 5LR6A 3NKLA 4KOEC 4J0QA 3IP9A 1IN7A 2EZ4A 4LKRA 1OZAA 1JLHA 1TT7A 4QU0A 3HRKA 3WMRA 4BE7B 2DULA 4ZOCA 2VP5A 2GDJA 1TOAA 1QVRA 2DBVO 2GFHA 3NKVA 5ALWA 2AKEA 2W2KB 3S6JA 5JE8A 2J3LA 1EDOA 3P2JA 1ESCA 4E6PA 3JR7A 1W2HA 2P7HA 1NIPA 1V8ZA 4OGWA 4QNMA 4UNRA 5C2JB 4XWGA 1SXQA 2IPNA 3EVNA 3KYJB 4K46A 1I3MA 1S1MA 4Y2VA 3BFPA 5DH9A 3VNAA 1F1BA 3S28A 1LPNA 2FVYA 5BN4B 3SMVA 1ZN2A 3UAWA 3K71B 4F8EA 2C4WA 3RARA 2R8BA 3IIMA 4U7WA 1PUXA 5LQUA 4DA6A 1EK6A 2FP4B 1OXMA 1L1QA 4D8VA 2IQ5A 4R16A 3U3MA 4N7RA 1G6KA 1A4UA 1SCUB 5LB2A 3WLIA 1O95D 1TEHA 4G07A 3ZY2A 3N2GB 4Y6QA 4BNKA 1D1QA 4RYLA 2NUAA 1Y4UA 3ROFA 2YWFA 3JD3A 4FYIA 4C29A 4QOEA 1QS0A 4GUAA 3ET5A 3PNVA 1PV1A 3Q8XB 4RHXA 4V03A 4LHXA 4QOJA 4MLPA 3QPCA 3IH5A 1P7ZA 3VH1A 4L95C 3ORYA 2CKMA 3RYCA 3JVVA 1FMFA 5TGTA 4RTNA 1VE5A 3ST7A 2C7OA 2F59A 4QDKA 5B7NA 2PUBA 2AJTA 2PZFA 1K1EA 3LJKA 3QLEA 4D3SA 3EAFA 1W36C 4GL2A 4A10A 3OFVA 2HCTA 5JCOC 3QVKA 5C1PA 1RP7A 4WXPA 4FFSA 4NZMA 5DBOA 4UM9B 1RWOA 2DWPA 3L6BA 3OEHA 1IXSB 1NKTA 2DBYA 5AXCA 4HEQA 2BEUB 3P7MA 1SPXA 3CEHA 5H3CA 3UGJA 2FPUA 2OO3A 1BHJA 3DDNA 5BORA 4MYHA 3EEQA 4L3VA 2VPYA 3ZJ5A 2HWUA 2QMUA 4IXNA 4AY6A 1KQOA 4TGLA 4NI5A 4NEQA 4CM6A 1TQ6A 2ZCUA 3BRCA 4MV6A 3JSAA 4NCNA 4TT3A 2A5JA 2Z6UA 1VJRA 3B38A 3U4DA 1G20B 1HK7A 4C06A 1DIHA 4YIHA 3C39A 3H83A 1KO8A 3CONA 1TAHA 1UK9A 1RKBA 4NHEA 4YUYA 4HQ0A 1PRYA 4QVKA 2WD9A 1C3VA 5C0OE 5B58C 2VA8A 2AZTA 3E1KA 3SJZA 1DEHA 2I6GA 3SFTA 3WIUA 1WCXA 2B1QA 2V54A 1X80B 4WZBB 3N3AC 2LBPA 3ZU3A 1A4XA 3AUYA 3RGWS 4JT8A 2HA2A 2AFVA 3LYUA 2FPRA 3T38A 2PZJA 2CCKA 5K99A 1K2WA 2PG3A 4XQ0A 3R7NA 1RKUA 3U0BA 5EXPA 3ZJTA 3EC2A 5HZHA 4PR3A 3MD9A 1PSWA 3PHJA 3OUZA 4MUKA 3U3KA 1UXHA 1D7AA 2QK4A 4YQFA 4Z0TA 3TPFA 1OFTA 2ZRDA 1C9EA 1X38A 4DZTA 2PZBA 1SBYA 1SUFA 2NVWA 3GEHA 2UUAB 2IE8A 3VC3A 1U9IC 1WZIA 4ZRMA 3SFVA 1YDGA 3LIIA 1APBA 2R65A 1B6TA 4XWYA 5B3LA 1HYHA 1RWVA 2GILA 4YLYA 5KB3A 4MQLA 1L8QA 3DKVA 5EXXA 4G85A 3AI2A 2QW0X 1DIGA 1QJCA 2J9FB 4YRTA 3ZGVA 4DRYA 3HP1A 1GHTA 1QDLB 2BHTA 3TDNA 2QUHA 3RJTA 2C1XA 4HRAA 2O7NA 3GJXC 1V16A 1SBNE 1GG5A 3KB8A 5DYYA 3ZK9A 1V71A 2Q2OA 3QEMA 1DXYA 4B4WA 3U9SA 4BAGA 1YJXA 3VR2A 1PJQA 2DPGA 4QTXA 1JW9B 1ISIA 3STWA 1L4FA 2J9YB 3PHBE 2BTEA 5I8WA 2XA1A 1UT5A 3VR4D 3CRQA 1EUYA 2GEBA 3FMGA 5E8RA 2YFYA 1B15A 1L5RA 3D3JA 4ITUA 4R01A 4DFDA 1QOZA 1TUEA 5IDXA 4CLOB 1A7AA 1T9KA 1GGVA 4RF4A 4CR7A 1QH1B 1NFRA 3WGKA 1W36B 3T3IA 3K6KA 1X1RA 2EJUA 5C8XA 2N9UA 3KO8A 4ZAGA 2A5GA 4KGXA 4YDQA 3AG5A 2XUQA 2M32A 2C03A 4OKSA 1CUJA 3BF8A 4QX6A 2O0LA 4RVSA 5BQ3A 2ODQA 1WXHA 3VH4A 3V46A 3I32A 5TMPA 4RPIA 1JRLA 4IJVA 5EUCA 1H2EA 1KJNA 3DTTA 3GMIA 4M21A 3KBOA 8ADHA 2D4HA 3GUYA 4AZVA 3WJ1A 5JHHB 2J45A 1RZRA 2TMKA 1FDRA 4RKEA 1BOFA 1PV2A 3VOAA 3NH9A 4PX9A 1YCDA 4ENRA 4G26A 3EEYA 3OPYA 2F1OA 4DDWA 1RHRA 1QRAA 2VHJA 4P92A 5DE3A 4BMZA 2PS3A 3MUFA 5HQTA 1SQ6A 3ZGLA 1Y3DE 1RQGA 3IAAA 4QXMA 3IMCA 2XLBA 2A30A 4IMIB 1HSZA 1HLFA 4C14A 3SFZA 1IL0A 1H93A 2E9SA 3C74A 1ZD2P 4BIMA 4C0AC 3OLQA 4RVFA 3EMKA 3OX4A 3OTOB 1OASA 3HXKA 5JISA 3OCZA 1P4RA 3G8AA 3OKFA 4DIKA 1DO2A 4OX9B 3QA9A 4AP6A 3VPCA 2FWAA 5J2TB 3T3HA 5JCJD 1EQUA 2XDAA 2XRMA 1B8NA 2VDLB 3IUYA 3NAGA 4M60A 3WGVA 5AVUA 3HCBA 1B3RA 4EYSA 3AEUA 1XEAA 1M2FA 3GFVA 1E2EA 4IGIA 1UOPA 1CY2A 2VZLA 4FNOA 3EN0A 2JG3A 1AV6A 3SZ3A 3B6KA 1L7PA 1GUBA 1IEXA 3HQ4O 5NLLA 4D9EA 1FMTA 2QTZA 1JHXA 1WDTA 2CHQA 4RKWA 2FJPA 2P77A 3IHWA 4EUFA 4MZXA 3EQ8A 4NS4A 4CEJA 4RVDA 1M72A 4ZV9A 5CDTA 3WGUA 5LQNA 3T3OA 3REGA 5IS2A 1M73E 2J9ZB 1CUYA 3IIJA 4MS3B 5ERXA 5EYPB 3TOXA 4YPVA 4YYEA 4K28A 2VQSA 5GJBA 1VECA 4MI6A 2BFEA 3F8SA 1P5HA 1QYCA 1UP6A 2CL5A 1O9HA 1P9NA 1XJCA 2YZGA 3CZMA 3NWPA 4RY8A 4L78A 2W2TA 1FTNA 1X1EA 2Z4TA 5LBUA 3REQA 2Y27A 5KDOA 2ZTLA 3RS9A 4QUDA 1MT3A 2F62A 4W9NA 4M9SA 3HJCA 1PGJA 1C9YA 1WXFA 1RJWA 2PJDA 1GCGA 3IILA 4Q3CA 2BFMA 4NX2A 4L9RA 3NONA 5HIIA 5HJ2A 1XCLA 1CS0A 3LC2O 2ZYHA 1GCIA 2G70A 3LHDA 3MD0A 4K9KA 3L0DA 5DYNA 2KSQA 1WW3A 1DQZA 1UPFA 3AF1A 2Z98A 1TM7E 1DIOB 4WGGA 1T9ZA 2ZRCA 4K6MA 3I23A 3VQTA 4CMKA 3CNNA 3D6NB 1CJVC 4MA5A 3CBGA 3OEED 4XA8A 2BR4A 5L3SA 2MOKA 3I0NA 2IZ0A 2HA6A 4K0RA 2F55A 2CNWA 4WUTA 2X9VA 3TQSA 4DNQA 3WBBA 4L8YA 1ZA1A 2DE0X 1M67A 2A57A 2X2EA 4U2BA 2E7ZA 4RKQA 3CF2A 1ISRA 3IX7A 1XQ9A 5DHQA 2P79A 1SB9A 3LA6A 3ZWKA 1UMCA 2CB0A 1S9HA 2CC2A 1J07A 3HY6A 4IBOA 4Q4JA 5LZ5A 3VR5D 3FKSD 5JR3A 4P8RA 1OCEA 1AQLA 1QE5A 3QBEA 1HQDA 4E1AA 3MTQA 5IDVA 1HUQA 2WAMA 5AICA 1U7DA 4DMKA 4HNGA 2ZSFA 4XCQA 1JFRA 3DFFA 1E98A 3HB7A 3LUDA 5CVCA 3V48A 1A71A 3P9PA 4P0PB 2F9LA 4L5YA 1M0WA 2JFOA 3ILXA 3L40A 3ZD9A 2JAUA 3INNA 5L3ZA 4BQRA 1ZJJA 3O2QB 1I6WA 2FPPB 2P4EA 2P8JA 1JFLA 1Z4KA 1WQ4A 4UTXA 3WL8A 2FKNA 1MA3A 3I6MA 1FP2A 5T8KA 2JCXA 4I4CA 2IHVA 5REQA 5F2KA 1H3FA 3CPJB 2ZAIA 1BN6A 4I50B 1H69A 1RVDA 4MUAA 4DC1A 2Y4NA 1XCMA 4PIVA 4BNMA 2X0RA 3LLSA 2PX3A 3GJ0A 4R9UC 3JR3A 2G06A 2BW0A 2NSJA 3MTDA 4ZIRA 1Z8DA 4LRXA 3I4LA 3CEJA 3ANTA 3QP9A 2AC7A 5KNBH 4P7BA 1ADGA 5KPDA 4G0UA 5HW0A 3ZKWA 1SCDA 2YUIA 1BX3A 4HLDA 1FYVA 5ECGC 3Q3CA 3LQRA 5JSQA 4WESA 4YT8A 1JTVA 2PUHA 3FOCA 3I5UA 1Q1AA 3DUFB 3M82A 1RPJA 2JCVA 4AU1A 3A2LA 1Y9DA 1DRWA 1MBZA 3PC6A 4M3NA 1EWQA 3B5IA 2FYTA 1LV8A 4KP7A 4HMOA 2OXTA 1JMKC 2J5KA 3G0OA 1XNJA 2BGIA 2PMDA 2ZI4A 1U5AA 3OLYA 4R1LA 3MFQA 5TPWA 1CY4A 3VNQA 4GX2A 3U1TA 4PCVA 4BWGA 2B1GA 4TV8F 1EFDN 2GRUA 2L18A 2HSEA 1KMCA 2UVDA 2JFFA 2CVQA 3OOYA 4RELA 3U9LA 3UHAA 3WLQA 4ZYWA 3TOCA 2AZMA 1XX6A 4AS1A 4KQFA 3SXUA 4Z7NB 2V7WA 5K51A 4C7OB 4HHEA 1M8GA 2WYIA 1ZM4A 5KIAA 4B84A 1TZCA 3WDLA 3GFBA 4O2AB 1KJQA 2C5LA 3Q3GE 3FSGD 4DLLA 4HH4A 4KR9A 3SR0A 4EMBA 4FHGA 1NMXA 4E2YA 5DF1A 5A4KA 3M4NA 2IXEA 3KZXA 2HF9A 1KIMA 2JATA 2P41A 1K7XB 3HWX1 5CDSA 1MJFA 1PJ3A 4PQEA 3DB2A 2YWJA 1WF6A 4JNCA 2HQOA 2ZM6B 2O2ZA 2F48A 5CK4A 1QV9A 2AOTB 2ZCVA 1UBRS 2QSJA 2WNIA 5FFMA 1Z5ZA 2XZTA 3M5CA 2IPXA 2C5EA 1P19A 4LSZA 4OLAA 2R6CA 4L74A 4DMLA 1H1DA 3IT3A 1SC4A 3PFBA 4P3OA 3AU9A 3CSUA 1CERA 2EL7A 3PDCA 1DWOA 3DHNA 3QF7A 4GMHA 5EIFA 4B6GA 1IULA 1KU0A 5H4GA 2DF8A 3P5SA 2J5BA 2VTKA 5G1NA 3EDQA 5THQA 3WRVA 3HP7A 3C1UA 1J2JA 4H7HA 4HDKB 3SZGA 3RUIA 4U9IS 4YP1A 4KEAA 1FDVA 2P3OA 1AKTA 3DP9A 4UOEA 4M22A 2XB6A 3P19A 3ZH9B 2BGWA 4M9QA 2ZSEA 4B74A 2B8JA 4WZBE 2JGEA 1N8KA 1KMIY 2B9VA 1OX6A 3ORQA 4HN2A 3B5EA 3ACDA 4KXMA 3PXBA 1EVJA 4L2IB 3DJYA 3R76A 4R2HA 1UIMA 3DO6A 4NRDA 3CNBA 4XEHA 3QWFA 4YLGA 3DMNA 1B23P 2XXJA 4U2CA 3PQ2A 4NBWA 5IFLA 3QLUC 3F3SA 3K0AB 5HG0A 3IODA 5GZ6A 4HG2A 2LKCA 3FTNA 3TUJC 1P4JA 2GF0A 3NWBA 2FSUA 4P5PA 1TLFA 4MYDA 4XVUA 4X8HA 1NF8A 2GZHA 1P3DA 3MWLA 2Y2UA 4WK6A 2FKAA 4YAIA 1GQ2A 2GPSA 1C0PA 4B9AA 1GO2A 3CV3A 3IV7A 1A9QA 4U2KA 1IYZA 3P8ZA 4XWTA 1XHEA 1E5QA 2EZTA 2BONA 4UULA 1E2NA 5T64A 5TSDA 3RD5A 4UOQA 3TSAA 2VHEA 2JLVA 4XI9A 5HMMA 2ZIZA 1RCTE 4FZRA 4TTQA 2PPLA 5C81A 1R50A 3CO5A 4YJGB 1XZ8A 1TM4E 2J6IA 3UXYA 2P69A 5CA1B 2F9MA 3QUCA 4MYTA 2HDNB 2D2VA 4H7DA 1R8SA 4FQ8A 3TLKA 5JYCA 1P0MA 1TA4A 4UDOA 3UYKA 2YVKA 2AVNA 3IAM6 4JGIA 3TZQA 3BBPA 3EXHA 5EJGA 1NQWA 2G9RA 2WINI 2EBFX 3DAGA 4FLMA 4IFTA 5AD1A 2ECPA 3TE7A 3MPUA 2CKDA 4PS0A 4RDHA 3RAPR 3H05A 1NP3A 1NULA 1QIEA 3GMTA 3QXHA 2P9YA 1VGQA 1HOXA 1UZNA 2Z3VA 2ZB8A 1AUVA 4TQAA 3ZKAA 1BFUA 1EKXA 4PN3A 4MSUA 3NAMA 1FBNA 2R47A 1GCUA 4CUJA 4DCJA 1YQEA 2Q49A 2J0UB 3BGVA 3U13A 3WYGA 1WSAA 2EBUA 5JNUA 3PQCA 1JBEA 1YQGA 2FA9A 2O2YA 3WMEA 1SCAA 1D6NA 3W1VA 3MINB 4PLZA 1X8JA 4HI0E 5F9FA 1VYTA 4WJKB 4GZMA 3Q2IA 4YROA 5F3RA 1K4YA 1P7PA 1EBFA 3IIIA 4D3XA 1ONPA 2V9PA 4PYLA 1FQOA 1X39A 1T6ZA 1C4WA 2BAGA 3E7WA 3LUKA 2Z4SA 3KPYA 1ZNZA 1D3AA 3UMSA 4W5QA 3D4OA 3HKBA 4JROA 2W8BA 1J49A 3ZXIA 2C7GA 3OC0A 2F7SA 1Y8QB 3FDXA 3FTFA 2WJIA 4QYSA 1RPZA 4HN9A 1XMXA 1NWHA 2QUZA 2WD7B 2FNAA 3D8BA 4H1TA 5TVGA 1AKWA 1D1TA 3VKVA 4EFLA 4IPTA 4L6AA 1JHUA 1DBRA 5IT9A 3DKIA 5ITVA 1D2MA 4ZI2A 1YGPA 2WV7A 4KVZA 5M3BA 2W7TA 2G17A 3GZ4A 3LX5A 3P94A 4J43A 4IICA 1QKIA 2DGDA 4PZYA 3B6EA 4G1VA 2ZB4A 3VV3A 2EW8A 4OAPA 1P1HA 1R9GA 1M6VB 1EX6A 2ZPAA 3JYPA 1DKRA 4LAFA 4NATA 4QSHA 5I7WA 4IRMA 1A1VA 3HBAA 2Z0MA 2EDAA 1L7BA 1K2VN 2VFAA 4LZLA 1ZUNB 1Q14A 4EDFA 4JJIA 5HKKA 1MIHA 3KR0A 3FF1A 5DLYA 3TH5A 1VE3A 5LM3A 4DV0B 4N5HX 4OREX 2FEAA 4RF5A 1ZMOA 2F2TA 1THTA 4J8PA 4YA6A 5JAIA 1NP7A 4DSZA 2QHXA 3A6FA 2PUVA 2VYND 4OBEA 2WJ4A 4AZ0B 5JMTA 4DSUA 3LECA 4M36A 2D0OB 2NNWB 4WZAB 2PL1A 2WP8J 3PXEA 1ZH8A 4GZ6A 4WZ6A 3QPVA 3HDYA 4ARAA 1M2NA 2REXB 3N1UA 3NBKA 5KYVA 4PZLA 3RE1A 1EAYA 1JN0A 4E21A 3CH4B 4LQ4A 1IBKB 1CUVA 2QPAA 2VHYA 4OKIA 5P21A 5IH7A 5HK9A 1T0PA 5IKOA 3RTEA 2YOGA 2CD7A 1BRMA 2Z4RA 2WT8A 4HQOA 4KL8S 5GJCA 3ROEA 4PICA 3OWOA 2ZYDA 3F3MA 2G8NA 4H15A 2F3SA 4D3DA 3L1IA 1ZDMA 4XWKA 2A5LA 1LH0A 2BFDA 3DZJA 2FFJA 5BYKA 3WYEA 4AJPA 4KZPA 3GFGA 3H3XA 3O4RA 4ENTA 5FAKA 2FR8C 5EJ2A 1PJCA 2Q8PA 3WLMA 5BSFA 4LF7B 3PQ7A 1RW4A 2QLJA 2NUBA 2R25B 2X0NA 1YI1A 4I9FA 4PWZA 1P6QA 2V8OA 4GS5A 3ZTYA 1T91A 4ENQA 1K75A 1WMFA 4YEDA 2CK3D 1PFKA 3L0BA 4ZI7F 3NDJA 4EY5A 1HQKA 1HNWB 3FPJA 3TQHA 1RRPA 1U8TA 3CS3A 4G5GA 4A7PA 2HLDD 3OA2A 4M6WA 1XDGA 3M6WA 4LHYA 1GPMA 1V7CA 3ZH2A 3SEZA 1JNXX 1AKNA 1KJYA 1MV8A 4OHCA 2PZ8A 3C6XA 3GX1A 1CZUA 1SOWA 2PXXA 2QEQA 4NONA 4PBTA 3R41A 4K6KA 2YV4A 3SIXA 4ARZA 1K4KA 2B1RA 3EVFA 1OFUX 4EX7A 1BS1A 3R6GA 3R7SA 4EO7A 4Y7CA 4D0SA 4OSPA 2K6GA 4IRUB 5IAEA 2XJ4A 1UWCA 5ICEA 1I4DD 4R5MA 2C9YA 2XGOA 2XCUA 4RPJA 3UJAA 3AUUA 5AHWA 4E4TA 4G0VA 3V9AA 3GFTA 4OXRA 2QL6A 4EHBA 4PZCA 5A1JA 4ZPJA 1MO6A 3CR8A 2R7LA 1TFRA 3HU2A 3IUQA 5FHRA 1KY5A 3C98A 4G5RA 5D3MA 3BE4A 3LSYA 3FBGA 3B1XA 5FAXA 2ERXA 1EYZA 3O8OB 4G36A 1CBUA 3NV9A 5CLGA 1NNSA 4YS6A 5I9MA 4G9GA 1TKBA 2VG8A 1ND6A 3Q9LA 2RGAA 3GRCA 2YQ4A 3IURA 2WSIA 3CTMA 2YHIB 3EPRA 4XUGB 5F23A 1MNQA 2C78A 2HIHA 3D0QA 1OGJA 4Q4LA 1SXJC 1KZ7B 4XUDA 3ESCA 1KBOA 5BVGB 2NO5A 1H2AS 1C3XA 3R5SA 3SDSA 3OLVA 4KDFA 4MRMB 3ITNA 1AMNA 1T6YA 3LT2A 1H9BA 3LYLA 4UDNA 1IHOA 1V5IA 2H3EA 3M2TA 1SOUA 2OEPA 4KFRA 3B1WA 1AMOA 3LW8A 3MSXA 1MT0A 3ETJA 1E4EA 2V0GA 1GGEA 2QI9C 3DWIA 3MIZA 1EUQA 4I1IA 3GCGA 5JBIA 1L5HB 2II6A 3GZTB 3OU6A 5LKAA 4WVLA 1Y6FA 4BQSA 1CZNA 5FBQB 2AS0A 3DO8A 4B3DA 2RGXA 4Q82A 1G5IA 4E31A 1P7CA 1WPQA 1XQWA 2GAOA 4IWYA 4WSOA 1KFKB 1XDUA 4ZJPA 4P86A 4F3CA 1AHPA 2GBLA 3ANSA 3BMNA 3EF0A 1NQTA 2VN8A 4G4SO 1ODKA 2MIIA 4XDYA 1IATA 2V59A 1PL6A 2ZDHA 4FIDA 4LV8B 1JQEA 4PYJA 2A35A 2NACA 3EZ6A 5L3RA 1YB7A 1WWKA 3L5KA 4D42A 1E3JA 3A4LA 4ZO8A 3DE3X 4KVFA 3RFXA 4N01A 3GPIA 4TQGA 3IP5A 2ZWOA 3EARA 1Z26A 1YB2A 2XMZA 3AJEA 4NPHA 5G41A 1L6RA 2IWHA 3D4BA 4RV5A 3OOJA 3QE9Y 3Q7QA 4Z99A 2BHLA 2YWBA 1CJUC 1G8AA 2QP9X 1BA3A 3H6HA 3G2MA 3IR5A 1DAKA 4GOLD 4M9ZA 1E2FA 1T3ZA 3SN6A 3V97A 1VRVA 2OPBA 1C14A 4JUAA 3R7DA 1FE8A 1FSFA 2AMFA 1QIFA 1IPEA 2A0YA 1E2HA 3AP2A 1XE3A 2VK8A 3KJHA 3N7TA 4S1PA 3RU3A 4D9IA 5EXTA 4RSRA 1DSSG 1QWSA 4RY0A 3DEZA 1I6MA 1NJSA 1OXSC 2H7CA 2JDID 5KNDD 4LIPD 3VKFA 2XUIA 2CB9A 1V2GA 2HEIA 3AHDA 2BLNA 2IYQA 3PDWA 4FR0A 2X4DA 1RRCA 2IH2A 3VRHA 3RTCA 2XVMA 5FNVB 1OF1A 1KGDA 4MVJP 4FFBB 1R3DA 2IP1A 4DA0A 1E7YA 4ZGGA 3QVJA 1KRXA 4HNUA 1LB1B 2E4UA 1XCJA 1YONA 4KYUA 3ONFA 1QF6A 1Z5OA 4R8LA 3TAXA 3QYJA 1SXJB 1L7VC 3DEFA 4CWAA 4JEMA 2XSZD 1FP7A 5BOSB 1W1WA 2F1JA 1OWOA 5FUVA 5ECYA 1EDBA 3IIKA 4BMXA 3W6UA 4Q34A 1QGDA 3WZLA 3AGQA 1CC1S 3FDJA 2O05A 3NHUA 1XRNA 2WTEA 1GQRA 3CRW1 1E2GA 3KVOA 1YU9A 3L77A 1A7KA 3MFYA 3SDZA 5AW7A 4L75A 4ZPXA 1Z6GA 1XBTA 2XE4A 1WG8A 2A0WA 1EX1A 2UYQA 3L7IA 3WHPA 5GVRA 3GLQA 4ZO9A 2QX9A 4GWGA 2PWPA 4NYJQ 4JI1B 1U7PA 4ZJZA 2Q2QA 3CCBA 3EMBA 3HWSA 4G1MB 5LKRA 4YAFA 3ZE2B 5P8WA 4DA9A 4Z0NA 2YWRA 3RASA 3Q8KA 3TG8A 2PYIA 1P44A 1DX4A 3BJZA 3MS4A 1OD6A 3PNMA 1PF7E 5DZSA 2DHEA 2N1MA 3W05A 5MF6A 3CLUD 3MT9A 3QKRA 4IKOA 1FVXA 2HGSA 4J76A 1YMVA 2VF7A 4N47A 821PA 1D0VA 4FGZA 2WVAA 4X91A 1WL8A 3TLMA 1U9YA 1CQIA 2VWHA 3KV3O 3PNKA 2B69A 1XXHE 1R4MB 3JASA 3UWOA 2WR8A 1KJWA 1ZNYA 3H13A 2ZRPA 1AQIA 1QE3A 3QHAA 2PNFA 3EGDB 1W0JA 1H5QA 2H1CA 1X13A 4B09A 5GONA 4JI7B 2KJQA 3H9EO 2GPAA 1C4OA 3U19A 4TM8A 3D4LA 5CB4B 5HRUA 4QDOA 4TTIA 4EF4A 2VHVA 1H0SA 2E5FA 1SBCA 2O0MA 4OFZA 3Q0IA 1Y3CE 1GPBA 3KUUA 3TO5A 3H1FA 5K0BA 4EI8A 4CEIB 1SHZA 5BVHB 1RJDA 4K2AA 1RQXA 1F2VA 3AEKB 3SC4A 5AXBA 3FCUB 3LNTA 2D5CA 1IWOA 3B51X 3CLKA 3T4EA 5FLEX 4FFLA 4YPFA 5AK5A 5JQGB 1KR5A 5JPDA 2ZQYA 1G8FA 1XYYA 3U16A 1IVNA 2OY0A 2PBRA 3VUEA 1NMYA 1U7WA 1MTOA 2NU9A 3UT6A 4MRRA 3OCUA 2I8AA 4JP1A 1IPHA 3SAJA 5JOQA 2Y99A 1UXJA 1BX0A 4OUDB 4QTZA 3WOHA 3LUAA 4DIEA 4YRAA 3NW9A 4WX2B 2C2OA 3IDSA 3V7UA 1U0TA 4QUIA 1SHLA 3S5JA 4E4RA 1AKMA 2AK2A 1GXSA 1KI6B 2ZJ4A 3I72A 4S1OA 4L5IA 5MN6A 4NK5A 3Q40A 4R2LA 5A0FA 5JLJA 4G4GA 3WIDA 3OCVA 1E1QD 4ZT5A 1PJLA 4LUCA 4CKXA 4ZYYA 5J3JA 2BP7A 2GLTA 1U02A 1YZUA 4GU5A 1JEJA 2XDQB 3HXMA 1D6SA 1GPJA 4FFRA 2K2QB 1G4HA 2XB9A 1Q1ZA 1VSUA 2BL4A 2VK4A 3ZCQA 4BO7A 5JNRA 3A4NA 3K70B 4HLCA 4EJ2A 4Z86A 4AN4A 4H0NA 5KKCA 4Q03A 2B6HA 4MW6A 1OOEA 3M33A 4U6NA 5FA6A 5TY0A 3P2IA 3F4LA 3JQAA 3N9IA 4TLBA 2XH8A 2WU1A 2PKCA 1I1NA 2VSOA 3IE2A 4HXEB 3WXMA 4F2DA 3RVQA 1KS9A 1OLXB 2OXEA 3IB6A 3ZE0B 5IW8A 2APJA 5EESA 3PX7A 1ZW1A 4C30A 2FX5A 5HSGA 1XTVA 2LTAA 2UZ0A 2L19A 1ZN7A 2I4NA 4HNHA 5AM3A 3N2LA 4B32A 2AFHB 4KPYA 1NYRA 3K4PA 1U04A 5BV1A 3ER8A 3GV0A 4P4UA 1DV2A 3RHZA 4LDAA 1OLOA 1P74A 1SCIA 2WAAA 1WUJS 4ALIA 1SPBS 3GJ6A 4EGCB 5BQFA 2VCYA 4MVJG 1QG2A 1WXDA 2OBYA 2Q5FA 3JY6A 4RNCA 2NYVA 2A84A 2XA2A 4Q4AA 5KYXA 1Y6JA 2QW8A 4U8GA 1L7MA 1E6KA 4RIIA 2AB0A 3IQWA 1KXZA 1GTL1 2X8WA 3L8ZA 4LMBA 2O7RA 5EKDA 2CJXA 1NXWA 4OQNA 1VHTA 1ZA2A 2YYAA 3IQXA 1KOLA 3QM1A 2V6JA 4LGCA 2I87A 4YJ3A 2E49A 2VTDA 4R8KA 3LE8A 4D26A 1R12A 3R40A 4U5QA 5IN5A 3CVUA 3UKDA 3GA5A 3NHLA 3FOEC 4MRNA 5M34A 5AM4A 3VTFA 1K06A 3CVVA 4WACA 4UKDA 3S3TA 3LL7A 2BUBA 4OATA 5L4LA 1ODTC 1Z0KA 3BA6A 3CW9A 5DCYA 2QAJA 3EH2A 5AK4A 1EAMA 1NL3A 3DVAB 3SHQA 4S1NA 4ZI5A 2Q4TA 4REQA 1L5GB 2QN2A 1DOZA 1E2QA 3WRWA 5JT1A 4INJA 4UUOA 5DU2A 4BFLA 2BFBB 3K1JA 1OVGA 1E0SA 1WHTB 1RTKA 2AEMA 2HPAA 3WAKA 5IJ0B 1OX4A 3VZSA 3E9CA 4HQRA 2JH9A 2VTBA 1J5EB 1IQUA 1SUCA 3PPWA 4BN5A 3CUWA 1LRJA 1B8UA 1MFZA 3AW8A 1YFLA 4O4IA 1QHFA 3QX3A 1OSNA 1RWWA 1Z4JA 1TQDA 1REQA 5AW9A 3FX2A 1H4QA 2P78A 3R09A 1P3JA 3RVMA 4C7JA 3V1UA 4HWPA 1Z28A 3VZCA 4Z4FA 2YY6A 3I1JA 3DYBA 1W96A 3NEPX 2J48A 4CKZA 1EHYA 4NYMR 5JADA 5M2QA 3E23A 4V24A 3VAYA 1ZAKA 2X42A 5ALVA 4JJEA 7REQB 3TUZC 3P9YA 2CV2A 1LXCA 1IUPA 4UE3S 1JA9A 3VZBA 1LPOA 3U48A 4BQIA 2XKKA 4B3XA 4BO9A 1AZSC 3LVBA 5IM4F 1UPUA 2VDJA 3PGKA 4G23A 4J0HA 3K6SB 2BSAA 2H1OA 4G5SA 1SD1A 3RSFA 1HNZB 3M2PA 2A78A 5BUSA 2G1PA 3RTGA 1FFYA 4B7CA 5C7OO 1MC1A 1M1XB 1O57A 2X3FA 3SZRA 4F5DA 1Y5NA 2YYSA 1AUOA 1HE1C 1HQCA 3FNBA 3O8QA 1HFEL 1CUGA 1SVUA 4UDYX 5AHOA 2O19A 4Y6RA 1P2FA 5AKJA 1K98A 1N3YA 1N9GB 1U3VA 1DG1G 1C2TA 1MPXA 2D3WA 1DEOA 2QG6A 2QZJA 2XQKA 3JRXA 4K9QA 5NULA 3QSYA 4GDFA 4WEQA 1I4EB 1JPUA 1M0TA 1VL8A 1HDXA 3O73A 3UK1A 3CCCA 2PDAA 2WIJA 5CLQA 1MO3A 2YNMA 3H75A 3I5XA 2FCAA 2PX8A 4BUZA 4HXFB 3OD5A 3GT0A 2QBYA 1C1DA 1KSHA 4CF6A 3F6PA 4EX6A 3LLUA 1ZHHA 2EIHA 1JNYA 3EXAA 1Y42X 4O4HA 1GL3A 4DDUA 3N6XA 2ACWA 4LCJA 4BLUA 3GQBB 3RAJA 3R0IA 4Y2HA 4TTTS 4IJ6A 4BFTA 1QP0A 2FZLA 4K6CA 1N7GA 2JC3A 4ZOLF 2R2GA 4YCSA 4R54A 3OEHD 4FE3A 3LDHA 3TB4A 3PEUA 1TJYA 1JDPA 2C82A 2Q0XA 4O4JA 1I5OA 2AWNA 3RI3A 2I3AA 1G5PA 4CLXA 1E2UA 2P9BA 4HDMB 1XOIA 5CAEA 4RTPA 3UXEA 2IYYA 4QBIA 4HWTA 2WFLA 3M6XA 2VQEB 3OA0A 4MULA 1L3IA 4KX5A 3AF2A 3WL6A 4WECA 4BX3A 4DJTA 3BULA 1NG9A 3HKEB 1GZHB 2YXLA 4Y8VA 4FX2A 5LLTA 1U7XA 5CT6A 3PGLA 4NP6A 2OXFA 3HKDB 4B7AA 1KPIA 3ZY5A 3PSHA 3CM0A 1IDN1 4BB6A 4LJ7A 3N75A 3NHFA 4NC9A 1N3LA 1QTNA 1XZCA 4GMGA 4EMTA 1VYVA 1VI6A 3LCMA 3T3DA 3H8VA 3PKIA 3T6KA 3GEDA 4AG5A 2GRJA 5G1PA 4F56A 3L5OA 2Q0HA 3Q5EA 4R3WA 4MCHA 2QLFA 1CHNA 3PYXA 3EW9A 1IRIA 2EQBA 1MFPA 1ULTA 1Y8RA 3C15C 2ISSD 3PCRB 3K8ZA 2NGRA 1VDMA 4RXMA 1SXJE 1YS1X 4N5NA 4I1PA 4EA7A 1Y7HA 2O59A 1CSEE 1R18A 5T41A 1DQYA 3W8DA 3BQNB 3MGAA 2ZBUA 3GEEA 3AFI