1BHQ1

Mac-1 i domain cadmium complex
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
189
Chain Sequence
SDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD11B
publication title Cation binding to the integrin CD11b I domain and activation model assessment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 66
structure length 189
sequence length 189
chains with identical sequence 2
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1bhq100
4NEHB 2VDMB 3TCXB 1RD4A 4G1MB 1SHTX 4HQOA 1M10A 1ZOOA 3HI6A 3M6FA 2ADFA 3V4VB 2VDOB 1QCYA 3EH2A 1YVRA 2ODQA 1NA5A 1AO3A 1IJBA 1IDN1 3ZE2B 1M2OA 1MQ8B 4HQKA 1BHO1 2WINI 1AOXA 2I6QA 4IXDA 4XW2A 5KYWB 1XDDA 1PD1A 2XWBF 3EFOA 5KYWA 3HXOA 3PPWA 4IGIA 1DGQA 1MF7A 3E2MA 4A0QA 3EG9B 3ZDYB 1M1UA 1PD0A 3FCUB 5E6RB 1LFAA 4F1KA 3EG9A 3FCSB 3T3PB 1SQ0A 1CK4A 5E6RA 1MHPA 4BJ3A 1JLMA 4WFQA 2VDRB 3QA3E 4HQFA 4WK0B 4FX5A 4WK2B 2XWJI 3NIFB 4UM9B 3TVYA 2XGGA 3EOAI 5KYNA 3IJEB 3EGDB 4IHKA 5E6UB 4CNBA 3NIGB 3EGDA 5E6UA 1N9ZA 3F74A 1IJKA 5KYUB 1OAKA 4Z7NB 1PT6A 3K71B 1CQPA 5KYUA 1RTKA 2NUTB 2M32A 1RRKA 1MQAA 3PPVA 1RS0A 1V7PC 2NUTA 2QTVA 4C2AA 1MJNA 2VDLB 3BQMB 3BQNB 1M1XB 1AUQA 4M76B 4UM9D 3NIDB 3ZE1B 1JEQB 4DMUB 1SHUX 4MMXB 3PPYA 1JEYA 1U0NA 1JEQA 3VI3B 1FE8A 5KYXB 4C2BA 1TYEB 3EGXB 3HXQA 5KYXA 2I6SA 1T0PA 3EGXA 1N3YA 3F78A 4HQNA 1U0OC 4WJKB 5E6SB 1ZONA 2X5NA 4CN8A 5ES4B 1MQ9A 5E6SA 3V4PB 2I91A 4C29A 3TW0A 3EH1A 2ODPA 3ZDZB 3TXAA 5BV8A 3EOBI 1L5GB 3PPXA 2IUEA 2WW8A 4MMYB 5LN1A 2B2XA 1M2VB 1YVPA 3T3MB 3VI4B 3K6SB 1M2VA 1ATZA 4PN7A 3K72B 2VDPB 3K6SA 1QC5B 1BHQ1 4O02B 3N2NA 4CN9A 4Z7QB 1QC5A 4NENB 3ZE0B 3BN3A 2ICAA 1UEXC 4NENA 1IDOA 1DZIA 5KYYB 5HDBB 4WK4B 3RAGA 1T6BY 5KYYA 2VDNB 3ZQKA 2VDQB 3IBSA 1U8CB 2VC2B 4UM8B 1XUOA 4G1EB 4F1JA 2VDKB 5HGJA 1JV2B 4JDUA 2NVOA 3EFOB 1Q0PA 1JEYB 5HJ2A 2NUPB 4Z7OB 3GXBA 1FNSA 3Q3GE 3ZDXB 2O7NA 4MMZB 2NUPA 1XDGA 1PCXA 1ZOPA 4HQLA
chains in the Genus database with same CATH superfamily
3KLOA 2Z3VA 1N32B 2GPAA 2ZVQX 4ALJA 3KM0A 1MORA 4K8RB 4WOPA 3LGSA 1RC1A 1TF5A 1VYVA 1NUQA 4AX8A 2W4QA 4Z9AA 4B2LA 2EEPA 4MVWA 2BMFA 5U1PA 3HI6A 4JK3A 3O0TA 4FOLA 4QASA 4EUEA 3QUCA 1ZL0A 2WJVA 3E7XA 3IV6A 1DCFA 1VJ0A 2Q4BA 3ZHUA 3IEUA 1AO3A 2WJYA 3JVIA 2GAJA 4PLWA 4OCZA 4CLHA 4ZC1A 4EZBA 2C4HA 1Y81A 2NO6A 1X1EA 4R1TA 2R11A 1CJMA 2X8LA 3QTBA 4TV9B 4K6OA 2DFLA 1LTHR 1M8FA 1H2RS 1USUA 1VYUA 3K09C 4EF6A 4Y1RB 5EIXA 4OHPA 4BRSA 4DQXA 1TKRA 2Q3CA 2HPAA 2ASVA 4I14A 4OXIA 4XR4A 2O4UX 1T2EA 4K8OA 4DSAA 3JVUA 3IP5A 1QFXA 3K4QA 3W9SA 1Z5VA 2ODEA 3D3KA 3R41A 4JL5A 5HF9A 3LCJA 4R8LA 3PWZA 1Z2EA 3LZCA 4XQCA 3QWAA 1FRFS 1EVQA 3U09A 1RPNA 3A27A 4LKOA 2WE7A 1U7ZA 2WD7B 1KHTA 4GMXA 1XU9A 4I4NA 2XWJI 3S1AB 2IP4A 3KYIB 1OA1A 2QR5A 1ESEA 2WE8A 3KQWA 4FUTA 1BD4A 4Z9YA 4I3GA 1M2FA 3S44A 1GFWA 4RDIA 1DINA 4LBWA 2XDQB 5HQJA 2JGLA 3IAXA 1CYDA 2IZ1A 5FJJA 4D56A 5K4GA 3TM4A 1JHRA 4A73A 3F73A 3NWJA 1EK6A 1UPXA 1QRDA 3URKA 2PVCA 3IXLA 4QDTA 5CCEA 1SHKA 4B17A 4F3RA 3DMYA 4EPWA 4CKWA 3FHJA 4BPBA 1SVIA 2Z9CA 4HATA 2Y0DA 2WPDA 5A05A 3GX1A 4Z4EA 3QKRA 1JLRA 3OM9A 4L72A 4HAIA 2G0AA 2J0SA 2QP9X 4DLBA 5IBQA 3N5KA 5GY7A 2WYWA 1GNQA 2K2WA 4MRMB 3RM3A 1K5DA 3ZWKA 2PX5A 1L5NA 2MR6A 5DHRA 2AD1A 5K51A 2PWBA 5JH7F 2D13A 1A72A 5LMCA 2HNAA 2HO5A 2JAPA 1YCFA 1Y4AE 5H0IA 3JYNA 2QMQA 4AICA 4E09A 1E8DA 1JZTA 3IHWA 3WGMA 1NULA 3DBRA 4NONA 3R74A 5EQDA 2X4DA 3JARA 3PIRA 3TAUA 2FDXA 5I7SA 1SCKA 1ONOA 1PV2A 5AESA 2GZ3A 5FYQA 3FPSA 1CQWA 4KAXA 1QYWA 5H7XA 3EPPA 4G41A 4R1UA 4EHFA 3L0OA 4JZKA 3DPIA 4ZCMA 1G7RA 1JR3D 3FDJA 1FDUA 4JIMA 2PXCA 3FWKA 1XAHA 2XYVA 4RVUA 2KM1A 4TTQA 4TQUS 5I51A 3SYKA 3M5DA 3FROA 4ITVA 2B37A 4R68A 4MARA 1AGXA 1CV2A 5HGJA 1C0LA 2ECKA 1DQSA 3BMNB 5HILA 4C0QC 3A8TA 2ZJYA 3NCHA 4UAVA 4F11A 4YY3B 2F2TA 3NOXA 1HX7A 3JQ6A 4CL3A 1FP7A 2C8LA 4UBOA 4MS1B 1KK3A 1B3RA 4GYKA 3S0JA 3H4MA 2QTTA 4F3CA 2IL1A 1VE3A 2JHCA 1VSVA 4URZR 3HM9A 1GUDA 1LBEA 2JJQA 5B12A 1RZRD 1X86B 2NO9A 2H5IA 4DV5B 3BPSA 3JAWA 3H2IA 1ZWKA 1F3LA 2PUEA 1ZMBA 3AX6A 1W75A 4FMPA 4YI5A 1X7ZB 2ZBVA 3LLVA 3NEJA 3RRFA 1JQEA 3OBBA 1KP9A 3P1JA 2XQKA 4IIDA 4LRWA 4V0NA 3B53X 5HM8A 2GCPA 2IC5A 4QYIB 3L4JA 1HEIA 5FWAA 2ZXFA 1MO4A 2IY7A 1GFIA 1ZBDA 4RK4A 2ES4A 1UMKA 2V7QA 3OOYA 4NP6A 4Y6RA 2VBCA 1G5QA 1V8DA 4JOSA 4G24A 4MRAA 2C1EA 1YRBA 2LXNA 4JCOA 2OP0A 3DKRA 1H2EA 3P0JA 2PZMA 5A1JA 1SKAA 2AVDA 1P4GA 1J22A 2PRKA 2RK4A 3G9XA 1QQTA 1KK1A 3HYRA 3PEFA 3D43A 3LUGA 2O2HA 2XSZA 2W2TA 3ONVA 4N3AA 2I8AA 5CFZA 2P0YA 1HFWA 2JLZA 3LT4A 4QXMA 5I01A 1ZGHA 3EGDB 5ULLA 4B6PA 2GCOA 3LUCA 1GLNA 5F1KA 3SN6A 4F5YA 5E1DA 5G0WA 4F6CA 5E2AA 1DCTA 1KZHA 3KUUA 1JHXA 2Q9AA 5EPEA 1GPWB 2ZS8A 1M8PA 2VR1A 3LUDA 4XX1A 4IDBA 1KO1A 2FFQA 3C8MA 2HJGA 4DE5A 4OGWA 1IB6A 5CD9A 5GGXA 2H07A 3LWDA 3DGEC 3DNPA 4OHMA 2HLHA 2HRZA 4HHEA 4N4AA 1BCSA 5IBRA 3THSA 2QRZA 3B7GA 3FPJA 3UUWA 5E9AA 3COJA 4W7HA 3VI3B 2IIQA 5A7FA 5L7TA 5CHEA 2AD5A 3VR5A 2GN2A 2WB4A 1RLOA 2Q3MA 2WF7A 4IIVA 4Q9IA 4AJNA 4GRAA 1A4UA 1TGVA 2IYOA 1XFDA 1QH8A 3C7AA 2EL9A 3CRQA 1YGYA 3EQ9A 1T0HB 3QF4B 3UJ9A 1VMEA 4D3DA 3RSLA 1JG4A 4DUPA 3OQMA 2XVMA 3U19A 3K2BA 2J0VA 4G25A 2GXAA 5A5EA 4DWWA 1YQEA 4H60A 1Q20A 2VSQA 4G97A 4AO6A 4AJPA 5CA1F 3AVUA 2ZRQA 4R7TA 4RA6B 2WF6A 4ALIA 3AHCA 1KKMA 2D7CA 3KU1A 2PZ8A 3NYQA 3WKDA 4I2VA 3GJ0A 1PYGA 2W2MA 3C3MA 3CFYA 4PZCA 5GTDA 5ADWA 2PMKA 3HDQA 3I5MA 3RSQA 2BSXA 2AK3A 3OTHA 4WI1A 4UNQA 3TOCA 5L95A 3KETA 2YOFA 3R5HA 1GGMA 1IXSB 1JFSA 4D0NA 4M60A 4QGAA 1VZ3A 1VFPA 2QRQA 3E61A 2GJ9A 3H5LA 4HLCA 4I1YA 4RS4A 1Z29A 4E21A 4IVRA 2AOTB 5F1OA 2X0RA 1DIRA 3OEWA 5DM0A 4XH9B 4B4WA 1TQ4A 1BE1A 2ZJ4A 5P8WA 5I4IA 2H31A 4O2BA 4EIWA 3UUEA 3W78A 5DHPA 3H2HA 4QELA 3NPMA 1W7AA 3C87A 2YIVX 1J39A 3OSZA 4WASA 4QJBA 4TROA 1SXJC 4L76A 3FVTA 2AEMA 2AJTA 1K7EB 3LBYA 1RFGE 4MO9A 4UHDA 3RUCA 1AKMA 4FOPA 1EX6A 2RB5A 3SBOA 5J23A 3NU1A 1WMAA 3NWEA 4MYTA 5AHKA 3W90A 1Z5OA 4G5YA 2JBAB 4JLSA 4OJMX 2J30A 3W2EA 4CIWA 4Q9JA 3FF4A 1P80A 3I92A 1EGAA 3NH9A 3ZK7A 4B7CA 4EB6B 2KWIA 1PI3A 1S7CA 1WSBA 1FFHA 1YJBA 1JG1A 1YI0A 2Y9MB 4GBMA 5F64A 4WOCA 4EQZA 2X1MA 3MCUA 3PTAA 3KXIA 3D7RA 1L6IA 3CZPA 4BFZA 4YEDA 5AT1A 1ZWLA 2X7XA 1TJPB 4ZT4A 3U3OA 1RACA 3QKWA 1C7QA 3QWBA 1TYAE 1VLZA 3L07A 3U4CA 4EUSA 3UBMA 3UAGA 3DM5A 2XXAB 3EHDA 3NB0A 3D81A 4Y6OA 4PYMA 3I8SA 3LUFA 3DHEA 3WLIA 1ZITA 4XIGS 4YMTA 2V55B 1QIGA 2QN8A 1RI4A 4G65A 4ZV9A 4AMZA 2XKJE 3BQ9A 3WKBA 3KDPA 3X1XA 4ANFA 2VUIB 4F3NA 4U5XA 3THYB 2HF2A 1SBHA 4LZOA 4AVYA 3KUDA 1NJ1A 3OO0A 1D2EA 2A5GA 2GBLA 1VGRA 2V4UA 2YJZA 1QDUA 3OE7D 1EGQA 4Q82A 4Z3DA 4DFDA 3WIBA 1BDJA 4ZWNA 1SGWA 2PUJA 4E6PA 4O29A 1FDWA 3UGTA 5EIBC 3G8YA 2VF8A 2XQVA 3F2IA 3FOWA 2ZRGA 1MV8A 1J4AA 3HWWA 3JATB 2WR8A 1RXWA 4B3MB 2P68A 3E58A 1G8MA 1NZJA 1RJDA 3KQKA 3B8HA 3DQZA 5C4GB 1QS0B 4R4JA 5CDGA 1E9DA 4OBWA 2YWFA 4XM2A 1MC8A 4FFNA 2A2ZA 4QXRA 3F78A 1J0EA 5AQ1A 1HNZB 4FYYA 2UVQA 4MA0A 3SJ7A 2WOOA 4BDSA 2B25A 3IOCA 1RI5A 4HX5A 4WUVA 3U9SA 1U3VA 3MJVA 1B6SA 3RC7A 3R3HA 5K20A 3TQSA 1VCMA 4QVIA 1AHIA 2Q3FA 5GWXA 1S2GA 4BKQA 2OLEA 1VJ5A 2IYUA 1YVDA 2QS9A 3KZOA 4G0ZA 4X54A 3T3MB 5IN5A 1LQ2A 2IWRA 5CIQA 3PXUA 5AVJA 3V1TC 2A30A 5C35A 1BHQ1 3ZCXA 4JKOA 4WFIA 5AI6A 2Q8NA 3VVMA 4EELA 2CLSA 2OZLB 4ZTBA 5IAEA 3SC2A 3JWPA 4TMWA 4EPVA 4RJ2A 3PR2B 4G81A 3L7NA 4B8YA 4YQZA 3RJZA 4ZVVA 2ATXA 5FTLA 2ZRCA 5LD2C 3CU5A 4LXYA 1N5IA 1QIHA 1JQ5A 1H6DA 4QYTA 3R1IA 4H7IA 3KPYA 3CZAA 1A88A 2QMOA 1MC1A 2ZYGA 3NO4A 1YMQA 4JLAA 4KE6A 4HBGA 4HWTA 2YJ3A 5EQTA 5JLAA 3L3BA 1ZHFA 2XTJA 1GJRA 1E1RD 4QIHA 1Z7YA 3A3KA 4WXRA 3SICE 1G6HA 2V7PA 1C2YA 1UOPA 1KP3A 3EK2A 3MGKA 4G1UC 4TOIA 4ZVOA 2V5UA 2QVBA 4GYJA 3F97A 2V6GA 4PXAA 1I7QB 3AJEA 1W4BA 2QUHA 4MQLA 3K0CC 4B74A 1H2XA 4DMRA 3LF1A 4MROA 4BWVA 4L02A 3AEZA 2N0SA 4MULA 1ILEA 3T5GA 3P2EA 4RIFA 1L4HA 1LTQA 4XCVA 2FPGA 5TT1A 3WJ7A 4AMYA 2G83A 1SC3A 2H1WA 5G40A 1E2BA 1UFRA 3GP3A 2QL9A 3R24A 3ON5A 4LSZA 1A5BB 2FZCA 4EBBA 5KCMA 5HRCA 3FZQA 3FKJA 2W2QA 4MKHA 3RFVA 4N12A 2V7GA 1GNVA 1QHFA 3O95A 1QONA 3CNNA 4KSYA 4M98A 4ZAFA 3V4OA 4ND7A 4B1FA 2WWIA 2V6FA 1NG1A 5EIFA 1JE1A 1W5FA 4J07A 3ZWNA 5LZ4A 2D74A 1CUZA 2FW7A 1WB5A 4GGOA 2R6GA 1NBEA 1DKNA 1AZWA 1FJ2A 3GRYA 4FOSA 4QT0A 2QUAA 5L3RA 3TRDA 4EA7A 2JH9A 8OHMA 3S81A 3O75A 2ZI7A 4HLQB 2VJLA 1FJXA 1GPH1 3W6NA 5JDCC 3FHLA 2XVZA 4E3ZA 4ARCA 4MH0R 2C7PA 4RYLA 3KFVA 4QBKA 4W4TA 4ZCTA 2I6GA 4DA7A 2VAMA 5L3SB 1PT6A 2CBZA 1UQRA 1KEVA 2IKSA 4GXNA 5TXGA 4UEJA 3OX2A 1XZIA 1YTLA 2XUOA 4ZVUA 2OFFA 1UQUA 3UKJA 5LA6F 1FDSA 1XE3A 2H1CA 3A3PA 1SUBA 3WGOA 1ZRSA 5JBQA 2ATIA 2QP4A 4XPIB 2CVFA 2O2XA 3JWIA 4IUBS 3EIFA 1KQFA 5BSEA 1ABBA 3QLTA 4C0WA 1MRZA 2WPNA 3N2KA 3HB0A 1U3FA 2IT1A 1HLFA 3I4CA 1TYDE 4DQLA 4G5GA 4M22A 1XQXA 4NL4H 2JFVA 1N75A 1OASA 4NZNA 2HQOA 1Z4LA 1UXJA 2VHZA 3EGXA 5FA5A 2OWDA 1G17A 2FZWA 4FZ3A 5BN3B 2CN1A 4RANA 2UKDA 4IRXA 4JLWA 1I1QB 1E1MA 4G8JA 1RQ2A 2HYIC 1H23A 2OORC 3NM6B 4KACA 2QBYA 1SKUA 2YC4C 3WE7A 3I37X 4J2TA 4A2CA 1XP5A 4XIYA 3TIGA 1VSBA 2H57A 2PVPA 2XR1A 5CW2A 1NQVA 5EINA 3U7HB 2F90A 3EAGA 4B76A 5BO5A 1R8XA 1G1AA 4TT3D 1K86A 4DV1B 5DW0A 3O1LA 1W0KD 4LFBB 1QCCA 4E12A 4Q37A 4WLEA 3WADA 4MB6A 3QI7A 1RBZA 3FCOA 3QGMA 1CEEA 3O0DA 3PC8C 3OZEA 4GWKA 4ZI2A 2Y4NA 2N47A 1RWNA 1ML4A 5EP2A 3AEQB 3GAMA 2WMOB 2GYVA 4RHYA 4UDXX 3T9EA 4B5LA 2FMUA 3TLZA 4BWFB 1EJBA 5AI8A 5AFSA 5B4TA 4ZT3A 4BZXA 1EHYA 5LB2A 2EJUA 3ZHOA 2C4WA 4C4PA 4BAUA 1PFGA 3CMCO 1PUXA 2CXUA 2QNRA 1M6NA 3OD5A 4FR5A 5EGSA 4ASUD 5BQPA 1T4CA 1EFRD 1X13A 3AKDA 1TCAA 5HQTA 3HLKA 1GG5A 3A2LA 4LMBA 2HT1A 2YV1A 3O3NB 3DVQX 4AF8A 3WO0A 1XTKA 4TRJA 4Z0HO 2EQAA 2ZCJA 3BB1A 2V97A 4ZQEA 2Q7DA 2JFBA 1II0A 2WKWA 3ZNOA 4NZPA 1G5RA 4YJDA 4MRNA 3BMOB 2RI1A 3W6OA 1YL6A 1U1DA 3FVVA 5AKEA 2J46A 3DDUA 1YCGA 1YZKA 2XUAA 2C9YA 1PL6A 1BYIA 1PGNA 1XZCA 2C5GA 1P1BA 4Q0MA 4L07A 3LLUA 1QCYA 4U8HA 2VUHB 1NVKA 2YFKA 4KW7A 4UHBA 3U1TA 1EQ2A 2OFWA 5SY6A 2R6CA 3S2YA 2BGTA 1W96A 1WVMA 1UKBA 3E35A 1MU0A 2Y8EA 1P1FA 4AQ7A 3O4IA 4N41A 4GLJA 4DQDA 1OXXK 4N5LA 1JKFA 1N2GA 3EASA 3I5AA 4HDAA 4WESB 3KTAA 3OU2A 4F9TA 5AVUA 4QPCA 5EZYB 2P67A 3DCYA 4JEIA 4MS1A 3WZLA 3GCZA 1PT7A 2CHEA 2SCUB 3I9LA 3LT2A 4GM1A 4UE2A 3EAFA 1LXCA 4EJFA 2AOWA 4EL0A 1H6BA 1Y63A 2FUG1 3KSAC 3INRA 2JLAA 2RHOA 4H1VA 4Q7JB 3SKVA 1WB9A 3EJWA 3STVA 4YGYA 5BWNA 3ZW9A 4PWZA 1HUQA 1OH8A 1X7ZA 4M37A 1ZA1A 3JD4A 2D2FA 1P29A 3MYRA 3OJXA 4I4LA 4Z0PA 5TX7A 2EJWA 4KO1S 5ILOA 1TX4B 2C82A 3U2QA 4CI0B 3HCDA 4S0XA 5HKKA 2XMZA 3U4QB 4PZ0A 4FMCF 4FEAA 4CKCB 1TPYA 2D5IA 2O2CA 4YTEA 5IBCA 2FSIA 3D8HA 1T9GS 3RRJA 1A69A 4NBVA 2JZOA 4MS3A 1DO0A 1GO2A 3QBEA 3AP3A 4HZUB 1TQDA 4C4RA 1G5PA 2C9DA 5AM4A 1RKUA 2IYTA 3GRFA 4R98A 3ZHTA 5HIKA 4HNAA 1ZZGA 1DKRA 3V4PB 3AG5A 1ISIA 4P98A 4QAJA 3TZLA 4EY3A 9MHTA 2ZUVA 3REGA 3MJDA 3R9WA 4U4AA 1RKVA 2ZSFA 3L5KA 4X65B 3JV7A 1U7XA 3KQQA 5I9BA 5LN1A 1ECFA 2W42A 4BV2A 1XT6A 4I2NA 2ORED 3K6SB 4BB6A 4LF5B 1V45E 1PR2A 3C7TA 5JD3A 3U3MA 4C5BA 1E2JA 2OXFA 1UKEA 1ZAYA 2AE1A 2BFOA 3A6ZA 3PFWO 1T3SA 3DZKA 3VQTA 3RSSA 2NVUB 1IL0A 3H2YA 3ZU2A 1H4SA 2XBMA 3FNFA 1YNOA 3Q15C 5JYCA 1Y8CA 2QPLA 1ZICA 2E3JA 2QDKA 3FM9A 4YRJA 4EUHA 1KU0A 2DY1A 1JJVA 2V45A 4NFHA 3LJKA 1XNQB 5G1NA 3QVSA 5UKDA 3VU0A 4EI7A 1Z74A 3DDCA 4FZJA 2AH5A 5DNAA 3DGFC 4BLSA 3IP7A 3TB6A 1HZZC 5JYDA 2RMKA 1OXKB 2X22A 2YWXA 3QF4A 4FS8A 3HUTA 4KLCA 4Z8XA 2UZ4A 5JJIA 2ENWA 1R0XA 4V2UA 4DRYA 1JGTA 4WKCA 1TOAA 3ZY3A 4E1VA 4F12A 1RAHA 4F4CA 4MJXA 1E3WA 1TK9A 1GR0A 1MMFB 3IELA 4MGKR 4WTOA 2ONKA 2VO1A 3CH4B 3P2OA 5IZCA 4CGYA 3LBIA 3C8UA 5KU1A 3QWHA 5FADA 2JATA 3RU7A 1VP3A 5K0JA 1SCIA 4CKEA 3VPFA 5KREA 2AMFA 1BN6A 4DR3B 1IUKA 3WR5A 4M1SA 4NCHA 2E49A 1IOVA 3GFVA 4A03A 3WLTA 3CCBA 1LI7A 4FFVA 2YMMA 3H8VA 4MICA 2G71A 5IJWA 3A4VA 1FOEB 1Y5NA 4Q9AA 1VL5A 1VI6A 2CC2A 3VDQA 5HS4A 1HRKA 3OCUA 1U90A 1DBPA 1HEUA 3ZX4A 1V9SA 4KVZA 3O2JA 4QBFA 1P1KA 1IZYA 2Q5LA 4CKXA 3WB2A 2I9PA 1BAPA 1IXKA 3FSGA 5H80A 1GPLA 1Z56C 3ZBPA 4FGUA 5B3JA 4YNBA 5C51B 5KDDA 1J90A 1W48A 3L8CA 1F3OA 5DHFA 5ALPA 4B4OA 4EDFA 1XHEA 1IY0A 3DZGA 3NH6A 5LOVF 1RAFA 4XM1A 1PJTA 2PUGA 4PRZA 1D04A 3J81k 2EKQA 1BXKA 2Q1UA 2DBZA 5GMOA 2GEFA 2NP6A 1L4BA 3IP1A 5K8UA 1MAAA 4G84A 4IDOA 5FBWB 4MWGA 1WW2A 4CL2A 1L8XA 1Z4PX 3MF4A 4EHNA 2H1VA 5CYGA 4XPZA 1G291 1USVA 4A9AA 2OB1A 1JX6A 4PSVA 3CVYA 4QPDA 3FIUA 1YOBA 1W4CA 1C8KA 3CF0A 2RGWA 3S7ZA 3L05A 1V71A 1CS0B 1K5HA 2HMWA 1Q7CA 1F2UB 4BJ1A 3SPXA 3FTCA 1VCIA 3LXXA 1PSZA 2ZJZA 3O1IC 4KXLA 4RE6A 5JC8A 4A27A 3GPDG 4LJYA 3FA2A 5T4BA 3WP0A 1G98A 3RC8A 1N5DA 3GQBA 3V5NA 5LM3A 5BSFA 2FZGA 5CPBA 4NC9A 1AU9A 1ZESA 1U0SY 3THXA 3C0KA 3WLNA 3MCWA 4CL8A 5BSMA 4H7JA 1ADCA 3SF0A 5HEKA 2VJKA 1A82A 2BZSA 2WPDD 4LDZA 3RSFA 1NOIA 1H6AA 3KB6A 1QHEA 4PRKA 3WBJA 4JXZA 1UWLA 3D6NB 1BDIA 4PC6A 3N7UA 1YZYA 1T4BA 1CE8B 1MIOB 1ZK0A 3UG7A 1RJEA 2YN4A 3CE6A 4Q4AB 4TWBA 4AI6A 5ALFA 2ZRBA 1CDOA 2YS6A 3ZI0A 2GPBA 2PS0A 2GN1A 2VYCA 3RIMA 2A9JA 5JS7A 2YZGA 1ENOA 3E15A 2CLDX 2WUFA 1VIMA 3F4LA 3ORYA 4KNVA 3L6UA 4X1YB 3UOAB 3VNAA 1YF3A 1IBMB 3UA4A 1GUAA 4HVCA 4KPUB 3AF5A 2FPPB 3K0HA 4IMJB 4EHIA 1N5KA 1QZUA 4HB2A 4EJ0A 4WEOA 2OCIA 1Q2XA 4RGBA 3RTEA 3HCRA 4LHVA 1F0NA 2ZITA 2VOJA 2H1OA 1VSUA 1C8LA 1EUDB 2FRDC 3GLHE 2AWOA 3BCRA 4PV7A 5ECDA 4YIHA 1NLFA 1WW3A 2IS4A 1XD2B 1Q19A 4JQZA 1YL7A 4CEJB 1IN1A 1F8YA 1BFKA 4V24A 1Z4JA 1G5TA 1KVQA 4KE7A 1QHHA 4DCPA 1KNQA 1DL5A 1QIFA 3E8MA 1FDRA 2PGNA 3TJZA 4CTMA 1E2MA 2RGEA 4Z3KA 3L7YA 4HB0A 5H3HA 3T8YA 1S4QA 3KYJB 4ZAGA 1UZUA 2OBLA 1FMJA 1H66A 4QOIA 4Z2AA 2QQEA 1LBIA 1LLFA 4PLCA 4BNTA 3GYGA 5GJVC 5AW2A 2BBSA 1J1ZA 4GUAA 4ZU6X 2WP8J 1XTUA 1IONA 1JXMA 3KU4A 3SGLA 2OO5C 3B1YA 2W93A 3C5WP 2BFPA 2CXPA 3HFSA 4GWGA 3L4BC 4DIEA 3TCKA 3GLHB 1Q3HA 4I1IA 4V0LA 4DLAA 4MUYA 3SKXA 4C3VA 1FLAA 3ROZA 4FOTA 4RHXA 4MLZA 5BW8A 4NE7A 3HZHA 3NAMA 5DBHX 1GM5A 3H7IA 3ROMA 3JQQA 4WDRA 3A04A 4DM3A 5DXAA 3ZWOA 4EG1A 1EXWA 2FEXA 3C97A 2WY2D 4MWCA 2ONZA 2G77B 4PHCA 5TIIA 5M7EA 3H5WA 3QXGA 1GQFA 2HIAA 5FORA 1FJHA 1P9NA 5BNFA 2V7QD 4GEKA 5LP6C 4Q02A 5DNWA 1R4MA 1DC3A 5F7XA 4R0NA 5KOHB 4I66A 3ULKA 6AT1A 4P38A 4RL6A 4AUEA 2AYZA 1RWWA 3CVXA 1N0WA 1VB3A 4EOGA 2QGFA 1Z6ZA 1E3SA 4UAGA 1G19A 2VSNA 2QN1A 3FWNA 4AYWA 1RCFA 2XSZD 3IMGA 1JL3A 3TRHA 3KQUA 1JPVA 1NX6A 3KYCA 4KFRA 1KO8A 1GSIA 1JKIA 2OZVA 1NXQA 3D8RA 4GOXA 4YHHB 2PM8A 5FQOA 3PXDA 3YASA 5A5VA 1SKMA 5G0SA 1J42A 5ALRA 3NGXA 1XRJA 4ZAZA 2RAPA 2TECE 2GTPA 2QNBA 3A1VA 4DIDA 4HWSA 3C48A 3HFGA 4JHLA 4OXKA 4TUYF 3ZGNA 2X4LA 1TTTA 3P5BA 1QVAA 2LUOA 3PDHA 1DAMA 4PLPA 1ZXBA 2P9QA 5ALOA 1WVIA 1PVDA 4AJHA 1KEPA 3L92A 4URUR 4WCFB 3GEBA 4E33A 4KIFA 3ERCA 1W0CA 4KWCA 3O2SB 2WU0A 4ZQBA 3T9BA 2FEAA 2GWHA 4R3UC 3VR5D 2FSUA 4JEUA 2J87A 2JFUA 3UBTA 1DTWA 2Q0XA 2QMEA 1NWCA 1SPXA 3GLIE 3MAGA 3HDHA 2OY0A 1C41A 1XMSA 3QYAA 3L6OO 4HD8A 4OYRA 2I22A 5AKHA 2ZRDA 4OPMA 5EE5B 4DZRA 1ZKDA 1QV6A 4FN4A 2QV7A 3GJXC 4F4HA 6GPBA 3K70C 3AY3A 1DOHA 1J8QA 1CZUA 2DJ5A 5DPMA 5F5LA 2F1OA 5J59A 4IJQA 3L40A 4M87A 3Q40A 1B41A 3SYRA 2P9BA 5MFZA 4GO1A 4QXPA 4H31A 2APJA 1M33A 2HA6A 1HXHA 2QP3A 1Z37A 2WVAA 1F9EA 1X1RA 3NEYA 4PZYA 4MB2A 3RAGA 4B4UA 4CMIB 3TM5A 3LDAA 4X63A 1VYHA 4J75A 2UYOA 1DTEA 3QLVA 5DTRA 1EP2B 2NTJA 2JZNA 2MTBA 3OLCX 4MQBA 5KHAA 1UBRS 4I5DA 3RSCA 4MV4A 2JANA 3KAPA 2EG9A 3KRTA 4M9SA 2XD4A 1U8XX 4LI3X 3M3DA 1G8GA 1BDHA 3NBXX 3CCFA 2ZBUA 3GLIB 1M2HA 4RH3A 4FDLA 3D1VA 4HJRA 2XTMA 4RPIA 1VPTA 1PZHA 3TLKA 1NUPA 3EGVA 2CF6A 3GUYA 1AF4A 1NL3A 5IUKC 3DHVA 5BURA 4D6YA 3IVGA 1F4PA 4PC2A 2VJYA 1HNNA 2DLDA 3BXHA 5F98A 4PFKA 3MMZA 4FP9A 1LNQA 2I0FA 1SUWA 3OHSX 4NZZA 4Q7LA 3TTSA 3V00A 1BVHA 2FH5B 4Q3BA 4LRTB 1ZGZA 3V42A 4DSZA 2ECOA 3DEYX 4ARZB 3GT3A 4O4HB 3VO8A 2J09A 5JYBA 4RLFA 5FFFA 4MWBA 3W06A 1W29A 2BVNA 3D7LA 3F67A 3H83A 5EMMA 4BTLA 4I1OA 5KQSA 1RM0A 2B35A 3I09A 4YJFB 2HDHA 4RA9A 1IRIA 1G6Q1 4AU1A 3BIFA 2IYNA 4KQXA 3H6GA 1MF7A 3HYTA 1OLSB 4WECA 2B1GA 3EG9B 5CAEA 1YAHA 3IJPA 4C4TA 2F3UA 3KAKA 3C7KA 1ENYA 2XHEA 1XMOB 3PDUA 4QHYA 2OCBA 1TE2A 2I2FA 4JUBA 3BH6A 1TT5B 1BVYF 1PR3A 3NIFB 5F4ZA 2YIDA 3NTVA 3ZYCA 5DNCA 2PCJA 2Z3ZA 1VCNA 1VBMA 1BXGB 1NJGA 2QM0A 1FP2A 1LGYA 2NTYC 4DYDA 4U63A 2EFHB 3N0TA 3F74A 3ZVMA 5ERXA 2Y1GA 2ORYA 4PG7A 5CYPA 2B6NA 3IUYA 4UNSA 1UM8A 2WZDA 2W48A 3KTFA 4LTDA 5AVXA 5KB3A 3RANA 5E4TA 2XZLA 2LW7A 2J7KA 1E6LA 1T0IA 2CHUA 2GK6A 2VQ3A 3D02A 4LI0A 1IMJA 2V3WA 2DBVO 3UWPA 4XAQA 1X2EA 4N0PA 3RYHB 1V16B 4L5CA 4LW8A 3DZJA 4K6KA 4QTZA 4F96A 5KJ1A 3QVLA 1YJXA 2P5TB 3ND7A 4DXDA 2BM9A 2JFGA 3BBPA 4WLFA 4PQRA 3D7SA 1IBKB 2HO4A 2X2PA 3EDRA 3K0AB 3OPVA 3R7LA 3RC9A 4LGYA 3VVLA 5HKAA 3AR5A 3PJRA 5A4MS 1N33B 1NNUA 2Q6IA 4BE4A 4BFLA 5FV4A 1T2UA 2PEZA 2OG1A 4M1TA 3FLAA 4I50A 3EDCA 5CVJA 1L5GB 4Q3NA 5F5XA 3RS4A 2W2OA 3LCCA 4PR3A 4N5DA 5GAJA 1NT2A 2AFIE 4FJ1A 3AQIA 3C24A 4ZOCA 3MCVA 2WIFA 4M55A 4EYQA 4GMGA 2XUIA 1X1CA 2PUWA 2CD7A 2ZVJA 1VE1A 4O02B 4PG4A 1DE0A 3EVBA 5EXPA 5T5QA 3VPDA 3D6FA 3SHQA 1CUFA 1ESMA 1JZSA 5IVKA 3GRAA 5AK5A 3P2MA 2IUYA 1CT9A 3LBNA 4OVKA 1ZK3A 2HJSA 2JHFA 4LGMA 3SEZA 3S3TA 4M9RA 4YREA 4QUKA 2OMEA 1LF5A 4BMNA 2WDPA 5K03A 2PR2A 1ZM4A 3R0VA 1TKCA 4GOND 2H0QA 4RTRA 3AVQA 4XEUA 1LWOA 2VUTA 3CG0A 3BYZA 1I6WA 3DAHA 2GDJA 4IH9A 5DJ5A 3I2GA 3KWJA 4OQNA 1PCXA 5EFOA 5KNLA 1M8GA 4MJ3A 3A7DA 3PKJA 1E7QA 2XDYA 3S6JA 5FWNA 1B0AA 2ACKA 2AFIB 2PGOA 3B52X 2PZEA 2DUMA 1SOAA 4WDQA 4FE3A 2P9YA 2V8BA 1KE1A 4CRWB 3P9IA 1JDUA 1K75A 4GXQA 1N4DA 3IDFA 5H82A 3RODA 3SZMA 2R1TB 3K4PA 3DLTA 5JNRA 3PVSA 3BFPA 2OL4A 3WQBA 3H86A 2Q0SA 1WMDA 1EUCA 1KKUA 2IHUA 2X0JA 4PZPA 4QJ4A 1UBKS 3V4VB 4AROA 4B6JA 3CEMA 2QJRA 4V02A 2A9RA 4QEDA 4WFKA 1C14A 3U7QA 2GPWA 4E11A 3G9UA 2PE5A 1SXHA 5IULC 4YP9A 3EPKA 2Q2VA 4JNCA 1FU7A 1U1GA 3GZJA 3JALA 5G4KB 2G4CA 5FA8A 3LYUA 2ZJ8A 3ZX5A 3V8PA 3COWA 5L3QB 3WMXA 5CNJA 2FZVA 2OGZA 5EUCA 4MGYR 1DGQA 1DIBA 2BTQB 3PNPA 1WF6A 3O2NA 1PD0A 1PVOA 1EGHA 3HB7A 1P5FA 2IXBA 4KGXA 3WNCA 4JELA 1YZHA 4X8OA 4NBNA 2ZROA 3GGOA 4D3SA 2B82A 3B51X 4RZHA 5BT9A 2BGJA 5EMHA 5I7AA 4N47A 3E0XA 3TZQA 1NM5C 1A5TA 4DJ5X 1HV8A 4JD5A 2CJPA 2X5XA 3EOAI 4RS3A 4OK3A 4J7AA 3WRXA 5HKLA 4KQIA 5BYJA 1ISGA 5I5EA 3MT8A 3H1AA 2ZZKA 1Z4NA 4N6GA 2EG5A 1DEXA 4G8DA 4GP9A 4Z5XA 4OHBA 5CA1B 4MVCA 3B7WA 4WPGA 1CNEA 1OREA 3DD1A 1VMIA 2OESA 1U1EA 3N75A 2CXHA 3SC3A 2G17A 2WJGA 1O6ZA 1UPUA 4E2XA 1LLQA 1BG6A 5CGZA 1II8B 1Y7TA 5J2TF 1DC4A 3JWHA 5AJWA 5FBRB 2X8JA 2FF5A 5F21A 1DWPA 2JBWA 3E5MA 4U02A 1TU0A 4A5OA 5GZ3A 4DC1A 4IIHA 2DR0A 3GUCA 2R66A 1BJRE 3I2IA 3CLHA 2FLWA 4MUBA 4O25A 3FUUA 3HZRA 3NDRA 1EQUA 3LBAA 4IXNA 4LZJA 3HJBA 4FZVA 1AUXA 2BOVA 3LQ1A 3AYXB 1FSGA 4KRYA 4YJ3F 4GYWA 4HMOA 3KXPA 2C78A 2R8ZA 5KJCA 3N8GA 3FCCA 4GUDA 2QUBA 1WU7A 4QECA 3RFFA 4KRXA 2ZZNA 1W47A 3TFWA 4Q66C 1GAJA 4U6NA 5C5IA 1Z12A 4MVJA 3II6X 5ICGA 2KMLA 2OQVA 4H16A 3TLBA 4DRXB 4DLVA 4B9EA 2MR5A 1XKQA 1Q0QA 3OP4A 3PGVA 4IBOA 4CKBA 1O96B 1A2QA 1MO6A 1HDYA 1CF9A 3FW1A 1CQJB 2NQ2C 3G3EA 3GZNB 3R5SA 3HCFA 3T5CA 2QRJA 1QQBA 1VBFA 1K8RA 1Z4IA 3ZWPA 4DLKA 1QTNA 4C6RA 2TS1A 3BE6A 2HJHA 2OCPA 2O2SA 3GPCA 4C01A 5IRCD 3HKCB 1EIZA 2YCBA 3ENZA 5G02A 1KI2A 1P0FA 1UPAA 3B85A 3A1NA 4NFYA 2YXLA 4OL0A 4Z0NA 3TQTA 1ZY2A 4INJA 1P1CA 4LJ9A 4B8ZA 4RWZA 3JTEA 1ES9A 4F9EA 4QQFA 4IRUB 5CVDA 3WNBA 5HTOA 4PHFA 4NXNB 3KSRA 4QVGA 2PNJA 3SE0A 4FFWA 4HWKA 2OZKA 5FRDA 2CSUA 2UU9B 2FDCA 1JDJA 3QU5A 4BNKA 2HHAA 5FIUA 1QGYA 3TI7A 3GRUA 1DAGA 1OFUA 3SZLA 4BEJA 1TKBA 3IEVA 2PT9A 2ZBDA 3EUAA 3OX1A 4HF7A 1GWNA 1FP1D 2HRDA 4UOQA 2F1JA 5ALLA 3B5JA 3N2LA 4YMVA 3JQPA 3CYFA 5D7NA 5ALSA 1UK8A 1Y1PA 1U4SA 1J8DA 2B8WA 2BHSA 5BSTA 3RIXA 3TZKA 2HUPA 5E3IA 8AT1A 3K73O 1ZLXA 2E5FA 1P0QA 2XCQA 4PYRA 1R0WA 1LH0A 3RK1A 2R96A 2WBLC 3B3QA 3QQPA 4IJMA 4E5UA 5LBIA 2OK7A 3QE9Y 5D85A 4EVRA 3A9CA 3MUEA 1JW9B 2ZYVX 1Z07A 5DYYA 3FPEA 4K28A 3A1EA 1SUSA 1C0IA 1DXOA 3CV3A 5IX8A 4UTNA 5TPZA 3ZHRA 3PXAA 4P83A 6REQB 4MVJH 3IQZA 4EG3A 3ZLVA 4KQ6A 4LE1A 3MINB 1GRQA 4HX2A 3WICA 2F9MA 1BQ3A 3NNSA 4BLRA 1DKOA 4Q4JB 3K2IA 2QN6A 4MJLA 1GV1A 4AN0A 3IAHA 3CLUC 3D8NA 4KR0A 4Z7NB 3UJHA 1HSOA 5CM9C 3EZ2A 4EF4A 3JX9A 1OI4A 3VH1A 4UD2A 1N57A 4ZI7F 3R3JA 5K3SA 3NNNA 4MUJA 4NU6A 3ANTA 5CURA 1J5EB 3N59A 5IW8A 3WMEA 2IU6A 4FWIB 4BLTA 3CVOA 1J8YF 1UWCA 3KAQA 4C7BA 4F6LA 3JWJA 1OR8A 2VH5R 1L8AA 4NEGA 1KC3A 1KMHA 3U5ZB 4DV0B 2JI7A 4ZOAA 1N5LA 4JX9A 4V3BA 3NATA 5HKKD 2V74B 1XMPA 3IP9A 1V0JA 3L4EA 4MR7B 3TE7A 1JSLA 4BMYA 3D5EA 3H3FA 1NVFA 4MITA 3G68A 1WBDA 4GSYA 1WV0A 1R00A 1N2OA 1PS9A 3U39A 3VAAA 3KJFA 1YVEI 3DE2X 3EVDA 3F9IA 1Z6XA 3ELUA 2AOUB 1LPPA 2CXSA 2ZSHA 3G9TA 4IEIA 1QBKC 2VTBB 1ZSVA 3ZIUA 3EYWA 1F6DA 3WQSB 2D0DA 3IT0A 3PNSA 4OMCA 3CVWA 4CMEA 4LCEA 3Q7SA 5ALIA 4GKJB 2G36A 1RI2A 4IMRA 3DMNA 1G2IA 1OKKA 1XCMA 3H04A 5DRYA 3OZAA 1L4KA 4PYLA 3I5XA 1MGOA 4DTIA 3RWBA 4KG7A 3MXTA 4DBLC 1HFJA 1PT5A 5HDBB 3A1CA 4QDOA 3CZMA 2HW8A 2VDNB 4YX9A 4IYJA 2BFEB 4BZPA 1TMOA 1AH2A 2Y1FA 3CNOA 2Q8PA 1THGA 1U7UA 3AY0A 4HBZA 4HTFB 2AE2A 1QYDA 1CZOA 2NVOA 3GRKA 1SVMA 1WP4A 1YI8A 3HJGA 4Q9DA 2IUSA 3RRZA 2NUPB 1H2BA 2M6SA 3PGKA 3PQ6A 4FT2A 1XYYA 2A1UA 2PLWA 2WMYA 4XFDA 5HS6A 5KNCA 4MO2A 2J31A 3STUA 4QJ3A 2GNAA 3KZXA 2RJOA 3LIPA 3T0FA 1Z2NX 4Y6GB 4CLRB 1P3Y1 3LKVA 4MQFA 3D8UA 3DH0A 3K2QA 4HGYA 3OT1B 4IHJA 3D3WA 4PLVA 1XD9A 1KFCB 1P2UA 3BXEA 3RRNA 2PRIA 1JG6A 2J3KA 1V7ZA 1FSFA 5LZ5A 2K7FA 5JUWA 1DFIA 5K0FA 3T3GA 3LOUA 1C4KA 1CIPA 3GN2A 5AVQA 1QK4A 1TM1E 4MHTA 4ZAXA 5IKEA 3ENWA 3FYUC 4ILKA 1NZFA 2BMEA 1JLLB 4JYPA 1F5SA 3QX7A 5LFAA 5KWSA 2FPKA 2REQA 3AV3A 3MFQA 1UDAA 1TCCA 1DVRA 1US8B 1T36B 4BCDA 1MQSA 3IC5A 3BHIA 4IVQA 4LBVA 5LA6B 4P81A 3CLSD 3RLIA 1L7QA 1E3IA 2IE0A 2VPWA 4R2XA 3A9RA 3QUSA 2NU7B 4J0HA 2H3HA 4L5IA 5D87A 2H9IA 2YS7A 4TRNA 3UV7A 4R31A 3RNLA 4UE6A 3WSTA 3FSGD 1AKNA 3I3OA 4EAAA 3ME5A 4XQ9A 1WABA 3R4CA 4R16A 2ID4A 3WB1A 2AUMA 3WFJA 1J6UA 2WUVA 3L0CA 1X87A 2C3UA 1MVOA 2ZRLA 5HUHA 2EU8A 1XCOA 3HABA 3FZGA 2RGUA 2OKGA 4H17A 1K4YA 4XGNA 4Y9RA 2CVHA 2ZUFA 1EA5A 2NUTA 4D0RA 4YS6A 2PQ0A 2IBTA 1NW3A 1S2LA 4KUEA 2WFMA 3IBGA 3HP1A 3D7KA 4WBNA 2VLIA 2PJUA 4H59A 4R9VA 4WZZA 2VAVA 3COYA 3M5CA 3PR3A 4WKPA 3TUJC 1DOAA 4YUWA 4UHJA 5BMVF 5CDFA 4ZZ0A 4HQ0A 5CR9A 2Z1MA 2UYYA 2Z5GA 3HBFA 4IGEA 5E8RA 2W6QA 1BE6A 1BXZA 3B9PA 4QNMA 5DM60 4HDMB 1Z62A 3FAKA 4IHQA 1VZ2A 1A71A 4ER0A 3HJRA 1TW3A 4BN0A 4Q4HB 1UODA 1L7BA 4ID9A 2Y1DA 3HK2A 1SUFA 1N9KA 5A9SA 1SBZA 2FZLA 4IMPA 4H3SA 1ZA2A 1CUHA 4KDRA 3JXEA 1BH2A 2ESRA 2EZ9A 2QGZA 2G1UA 2BR5A 1DBQA 1K5PA 3N2NA 3T61A 1R0KA 5I6DA 2E6KA 1E1QA 1X74A 2YOHA 2QXUA 3ANSA 1XTTA 2FWBA 3EXIA 3FTPA 4M0DA 5KOJB 4QFBA 3TEFA 5JVDA 2V9CA 2BFCB 2DFNA 4D3XA 1T5HX 1Y6ZA 1Q91A 2BKXA 5M2QA 1JJAA 1PDVA 2G40A 4EPXA 3GLGE 4CEIA 2JH3A 1AIPA 4FONA 3MRXA 2JHAA 2PH5A 4YR7A 4IZHA 3OLXA 1IU9A 2XRMA 4GBED 5B64A 2H7CA 3REFA 2HCTA 3F5MA 5KTKA 1CDEA 1S6YA 3VKFA 2GI4A 2PBLA 5K45A 2RC6A 3KQNA 2A6PA 2GLXA 4LGVA 1M1YA 3QX3A 4MW2A 2JLYA 3ZDQA 4DLUA 1QF9A 4L7VA 4I8DA 5H8WA 4ALLA 2ZREA 4DUZB 4OAOA 4BGEA 1BVRA 2WIJA 5EWMB 3UYKA 3TGWA 3IAEA 4NOLA 1ZR4A 2PWAA 5KI6A 4AP5A 5CCXA 4INAA 1FFCA 1ADBA 4XI9A 3ZY2A 5C4MA 3X2FA 1Z36A 5DCWA 1KPHA 4J1QA 3V48A 2QX8A 2PRZA 2YRXA 3QJGA 5JNSA 1QZ3A 3W1VA 1N7HA 5CTAA 4A0HA 4ESOA 5K6AC 4DCUA 4U6SA 4BJHB 2UYGA 4BAZA 3GLGB 2B36A 3LP6A 3PEUA 3MJ4A 4IAOA 4J6FA 4EG7A 1Z2CA 1H42A 3LQ2A 2HEGA 3EBLA 3ESBA 3QTTA 3M1AA 5T4EA 3SU8A 4Z4IA 3HN6A 3T3IA 3GGDA 2M6KA 2ZTVA 5FX2A 3JRWA 2FUG6 4N8EA 1N2ZA 3VR0A 1ZRMA 1OOEA 3UXEA 3TOVA 3S4YA 5JT1A 1W1UA 3E70C 4FMCB 2BBWA 1P1HA 4DN6A 5LMZA 2I1WA 3N8DA 2DAPA 3O92A 5G0TA 4AKTA 2CKDA 4KIUA 4AN1A 1YKFA 4QJ5A 1UPTA 1JZQA 2P5YA 1MA3A 2NM0A 2XUFA 1K9SA 3ISVA 4EK9A 5A5FA 1Q7BA 2HREA 2R4UA 3GWGA 4MIKA 1N9ZA 4ICIA 2XB6A 4X1IA 1I3LA 5AM3A 1UBTS 1BFDA 3L9WA 1KHHA 4CCSA 3W5VA 3IKTA 1EFPB 9GPBA 4DV2B 3U61B 2OFPA 2WHEA 3HG7A 1R0BA 2JAUA 3VNBA 3UMMA 3A14A 4DUYB 4LJ8A 4POAA 1XN1A 2K4MA 2NO7A 3R40A 1M74A 3FXAA 1U0NA 4Q03A 3FUTA 3MSXA 2YQ5A 5CU7A 1WPGA 4LCJA 3QE2A 3F7OA 1H1LB 5HJEA 3K9HA 4UBLA 1BMTA 1PLKA 1NN0A 1ZGAA 2X4GA 3I76A 4YECA 3RS3A 3UXMA 3H13A 1T4MA 3G17A 2WM9B 2QLFA 3HU2A 3PYLA 3V8QA 4WCVA 3USES 4C7XA 1Y7PA 1XZDA 1X7WA 2YJ6A 1GZVA 1NI4B 2IOFA 4OSPA 5KVQA 1SZDA 4XCXA 2L17A 4ZQCB 3TX6A 4C4OA 3O8OA 3R0QA 1GPJA 2AF4C 1EWTA 1QV9A 1KDPA 2HPHA 3JWEA 1U1IA 4HYYA 3RBXA 3KZCA 4Q18A 2V4MA 4GP7A 3DO8A 2JLXA 2CHVA 2QPAA 4TTRA 1WXDA 3RVSA 5GV7A 5JMPA 1U9CA 3UT5B 2G70A 4P3KA 4U9UA 2EAUA 4YWHA 2W70A 3C6XA 3BFKA 4QRDA 3IVRA 4EY6A 1DEKA 3WGUA 5A04A 1CQXA 4EMBA 1G8SA 2ID8A 4RDHA 1CPYA 4Q47A 3K8OE 3UV3A 2NGRA 4C7MA 5JZVA 1M0EA 3VV3A 3LWNA 3IEXA 3WDLA 4LVUA 2ICAA 1JMKC 2V6BA 2FG6C 4EG5A 2ZTUA 1H2ZA 1ZIXA 2F7SA 3UPDA 2IZZA 3PKZA 4DV6B 3Q3IA 4C7KA 4IMIB 4LY3A 4D2IA 3NAGA 3AVXA 1DO2A 3VU9A 4CFYA 2CFCA 3G5TA 1UM9A 5G1PA 3ZWCA 1ZIYA 2I7VA 4F4IA 3HBMA 4ZDKA 3SFVA 1PFUA 1A98A 2CNWA 2COEA 4CYMA 1OAOA 5AXCA 3G8CA 1UKYA 1V3VA 2C59A 1EH5A 3W9YA 3VYRB 3LPDA 4D45A 1Y4UA 4MKFA 3UQYS 2VL7A 3P4YA 2JA2A 3UV6A 3I32A 2PT7A 1GNSA 1M34E 1JEAA 1ISJA 1YFZA 3JD0A 2O8BA 2O3SA 2LP4Y 4ZOLA 3QEJA 1UJ5A 4RK5A 3RNOA 1OIWA 2BFFB 1OWMA 4B2YA 3DPSA 1QK3A 5LOVB 3AZQA 3VDRA 1JR4A 3C5CA 1Y5RA 3SLKA 1QFSA 3O7WA 4OU4A 3PHGA 3ECAA 5FOSA 3GEGA 4UU1A 4CF6A 3FWZA 2P4UA 2ZP1A 2DHDA 4ZGGA 3B2NA 3KOXA 1TM5E 2ZSEA 4Y1FA 2A9PA 2M1ZA 4DBVO 4FKZA 5HOEA 2QM8A 1QLWA 1GRCA 4HUTA 5BWBA 3TBHA 5MFPA 4IJVA 1K4KA 4L8VA 4TXMA 3U37A 4P5PA 4L57A 2FKNA 2P75A 1Z0FA 5B4UA 3KP1A 3IBTA 3HCCA 3Q10A 2PL9A 4CLOB 4BMXA 4X66B 2UDPA 4R2LA 4KQCA 3HYCA 1OJLA 3OLVA 2VSXA 2GZ2A 4LQCA 4KH0A 1RWQA 2QAGA 4FQ5A 3WAKA 4B81A 1T5TA 3AO0B 1M34B 3VKHA 5JCXA 3W2TA 3EXFA 3RUFA 3OIDA 3KL4A 4LTMA 2EKBA 3I6ZA 4XLTA 1AX9A 1HA3A 1A8SA 4NPHA 1KZYC 1JEJA 2WNHA 2NU8B 2VNHA 3RRMA 4CQLB 1P44A 3HBNA 5KTRA 3BK7A 1KRWA 2JPDA 3CEAA 2NTNA 2XUPA 1ID1A 1DXYA 2AF3C 4HH3C 1R5JA 2Q4OA 3F3YA 5C8YF 5CB0A 2LDBA 1MFZA 4ZJPA 5CB4B 3C6ZA 3UJBA 1YB6A 2M32A 1ECJA 1I51A 3JRNA 3KQOA 3PLNA 3RT1A 4DYVA 4MCHA 3W79A 3B38A 2DY0A 5HCNA 1JEYB 5JALA 2DE0X 2Q2WA 4ZAYA 1W8DA 2Q5FA 3AF4A 1QB7A 3BXFA 1T4DA 3C8DA 3P27A 4BV8A 1YUMA 4MYUA 2NUAB 1A76A 2TRSB 2VBIA 1CUGA 4CODB 3BWEA 4JP5A 4L3VA 2IPXA 5IK2D 4U39A 2MJLA 1AQLA 2GZ1A 4N54A 1OILA 1W30A 2QRVA 3A32A 1M75A 3IQHX 1EUYA 2ZI9A 2QOEA 2RKWA 3D2CA 4MUMA 1IM5A 4TKMA 4ZPJA 2Z3WA 3SDZA 4PGGA 5LQMA 1Z6AA 1UJCA 5ESWA 2FSFA 1FYEA 1IXRC 2QJTA 3LQ4A 3QVUA 1QUEA 4NVRA 4HDNB 5B4VA 4KDCA 2DT5A 1M7HA 4GM4A 3EXG1 1VYTA 5EHIA 1J0AA 4QEKA 4JYAB 2Y1XA 3DAGA 3SS8A 3H5AA 1UEIA 3QMPA 1M8KA 3D5TA 1V3TA 4CI9A 1E2HA 4V0ME 1CQIA 3KLMX 3SBXA 5FTWA 1C9DB 4JR1A 3RYCB 5JD6A 2JEYA 2ZUUA 1XRRA 4N3BA 2BZ0A 2OZEA 2VDVE 1SOUA 3VC3A 3QW2A 4FQ7A 2L2QA 1XLTA 3GAFA 3V3KA 5EIEA 2IHTA 1N2BA 2PFSA 4JI1B 3T7DA 1H3NA 1EQAA 4G8CA 2IYVA 4PSAA 4N0MA 5JNTA 3Q3GE 3X3HA 1WHSB 1UBMS 1VL2A 2H52A 3CZQA 4TWRA 4POOA 5BV2P 1ZOPA 1YB5A 2J9RA 1PGQA 1UMBB 1D2HA 5EKUA 1W85A 1THZA 2IXTA 4A8HA 1RJFA 3CA8A 3PQCA 3S2SA 3NDJA 3IE0A 4KYIB 2EGHA 4XSGA 4J0JA 4BMZA 1FMFA 2V9ZA 2HLDA 1J0BA 1KIFA 2W6ZA 2XMRA 4CKYA 1JUDA 2EF0A 3EBPA 3F6BX 4U5QA 5LWHA 3E05A 3DC7A 3GC6A 2OV6A 4OREX 3SEFA 2O8EA 2NPIA 3MUOA 3F0TA 3U1BA 5M34A 3EYAA 2XHZA 4OHRA 5FTJA 3USCS 1VPWA 1VKRA 4MXDA 3L1JA 1TXGA 3DZIA 1C9YA 3B20A 1RWMA 2AHOA 1YR1A 3U4MA 1CUVA 3N39C 1QIEA 1KVUA 2W22A 4M38A 4P5DA 4R8MA 4IKPA 2KHZA 1OWLA 5EIHA 3DW3X 2O6LA 1RRVA 4RLSA 2C97A 4L6IA 5K8VA 5GOZA 1W9MA 3I9JA 2CE2X 3PUHA 4LWQA 4NBKA 2MSLA 1Z7WA 4DMKA 2O7QA 2ZB2A 2GPJA 2OM2A 3ACDA 2RH8A 4UZSA 1ECLA 1GY8A 3ONWA 3OEHD 4IKOA 3UB4A 3CH6A 2RKBA 5IUJC 6LDHA 4ZCPA 2FWMX 3FUXA 3RSOA 3UMYA 4WK0B 1DKQA 1DO8A 3HWRA 5CFPA 4IWYA 4TUYB 1HKHA 1KOJA 2QL6A 3HHPA 1O9HA 1Z5WA 3CNBA 4QLAA 2I65A 3BE8A 3KG2A 4H0NA 3KLBA 3N2YA 1JHPA 1GU7A 2YXNA 3E84A 1EP3B 2CJWA 2RH4A 4ND6A 5EYPA 4RTLA 2IZ6A 2VPXA 3KXLA 1FXWA 4FBMA 1NVUQ 3MWEB 3V4LA 1TM7E 5KYUA 5DM4A 5H9VA 2ZBFA 1SBTA 1TJYA 5AVOA 1NVVR 4ZHQF 2UYCA 1ZAKA 2VJAA 4XGRA 2P2SA 1AKTA 2B61A 5KAPA 2INGX 3PE3A 3MELA 2HYDA 4YMWA 4LYHA 4X45A 1ODFA 4TKLA 1KXJA 3I3SR 3PPYA 1LLUA 4JY7A 2ZATA 4UBJA 2CD9A 5DCLA 2Z6AA 1QHXA 2Y1KA 3I9KA 5DDIP 3VTKA 4Z9BA 2KW5A 3FFAA 1O6GA 1T15A 1YI1A 1A4RA 3AI7A 5JIBA 2FMHA 1TUEA 4Z1MA 2ZBQA 2JFQA 1A5ZA 1J8MF 4AL4A 1TD9A 2AXPA 4PAMA 4I81A 2E9SA 3E5HA 1XELA 5JISA 3DZCA 3TGPA 3KNZA 5BSGA 4LWPA 5D3MB 3PWTA 3LZ6A 1W4AA 2BD0A 5KYVA 3TNLA 1YVUA 4G63A 1TL7C 1VIVA 2NACA 4DPKA 5AVTA 3CEHA 4MQ5A 4ESHA 3SG0A 1AE1A 1ONBA 5LWQA 3AEKB 4EATA 2JG3A 2B8NA 3PI7A 3ORQA 5NLLA 2FFBA 3MVEA 2UZ0A 2ZJOA 4X7PA 4R9UC 3IJ5A 3LU1A 1MOQA 3D0QA 2QTAA 3JAMA 2PKXA 3FTDA 5FUVA 1L7EA 4O4JB 4ARAA 4QX6A 3E9DA 2O5EA 3KZNA 4AK9A 1CR6A 3AM3A 3NT4A 3L8MA 2G7MC 2H00A 3VSDA 4OQMA 5CW1A 3QVJA 2ZT5A 4X1OA 2Q9CA 3EA5A 1T24A 1YZNA 4GX1A 1I8TA 5EHXA 2IF0A 1XUOA 1JU4A 1SXGA 2L19A 3G9QA 4P35A 3NHAA 4MVJD 5EP3A 5EWJA 5LQUA 1CYEA 2J3EA 3SF8A 2Z43A 4D7AA 1IRXA 2I71A 2O2JA 1R0YA 1ICIA 4O0LA 1A5AB 5IM4A 4XYGA 4L9WA 2ZIVB 3I2YX 1ISSA 1QJ4A 2LE0A 4P54A 3E5RA 3PQ3A 4E6EA 2A58A 3IT3A 4KREA 1QFMA 1U0JA 1YZTA 3AFOA 3KL2A 1E5LA 4Z99A 2ZI6A 4H1UA 4MV8A 5AVVA 3RVNA 3PF9A 3UNXA 1QYCA 4AC9A 5CLLA 5CIYA 2X4IA 3QP9A 4RGVA 1BKSB 1PBNA 1DT5A 3IRVA 3UJDA 3ZJVA 5ADHA 5EE1A 3MWDA 2JLCA 2AN5A 5C52B 3T1YB 4FNGA 3SQWA 2NW6A 1DQYA 2DFDA 3MBIA 3WIVA 2XF8A 4O1HA 4YAKA 5I9TA 4H3VA 2Y3IA 2VRNA 5ALUA 3IMFA 3X44A 4F4UA 2PT5A 1L8QA 3OPMA 1XU4A 1FEZA 5DGHA 2DF8A 2FPUA 1QGAA 4AW9A 3VR4H 1SHLA 1ZYUA 1E4EB 3MUNA 1GTL1 2FMFA 1MB2A 4JKYA 1YRQA 5JSYA 3WMFA 2A9QA 2SICE 3IPLA 3HDYA 3ISTA 3UGQA 5JQGA 2NSHA 2P0AA 4LYDA 4RE5A 2HRRA 2NPFA 3DQPA 5E6RB 3R9XA 2QZ4A 5L4NA 2BRUC 1P2FA 3HRIA 4KR3A 2O2GA 2WAOA 4RFLA 1NONA 4WFQA 2C84A 2CHFA 2CLFB 2XCLA 3TUIC 1ADJA 3ZQ6A 4DQKA 4ZDJA 2XX3A 3FFXA 4LE2A 3ROTA 1KDVA 3CS3A 1KO5A 1XEFA 3IB3A 4MVJI 3RBAA 5HZGA 2JARA 2P2LA 3G85A 5LZ9A 1JR2A 4AO7A 1G6KA 4GNRA 4B44A 1CY0A 1IN7A 2V58A 4BQQA 4HLUC 2P6UA 4P3OA 1QX3A 3WV5A 3EMBA 1P75A 3DV9A 4PPGA 4YMSA 4O2AA 5A6SB 3RHFA 5BV0A 2FCRA 3UQZA 2WIKA 2QRMA 1XDUA 3EC7A 4BGUA 2HY7A 2A7QA 2YXDA 1ZD1A 4KSBA 3DE3X 1FW8A 2OHXA 3PJDA 1MBZA 4FC6A 1KAGA 2IS6A 5B2FA 4MMXB 4XRRA 2DBYA 3NYWA 5F2KA 3U4DA 3A36A 1SCBA 1U65A 3RJMA 1OWPA 2D8AA 2QF7A 3KXKA 1HT2E 3C85A 4JOQA 4M21A 2ZYTX 3TL6A 2VATA 3MD9A 1WXXA 4LPSA 3CLTD 4RTMA 1NX9A 2BPOA 3E1GA 4QUJA 5LKRA 4ZDWA 4Z86A 4QZVA 3EAQA 2FCAA 4C6TA 1E9BA 1EDDA 1ZNWA 2VP9A 2G8NA 5E9JA 2QQ5A 3IERA 1KORA 3RF6A 4LX8A 5EXXA 3ZY5A 4IIJA 2O7VA 1O94C 4OQPA 2BJHA 2EFJA 2WWFA 1X7DA 2VHUA 2NZYA 3BDIA 1T9ZA 3PXCX 4GMDA 1O1YA 2WQ6A 3CZ9A 1CBUA 2XXBA 3F6SA 2GZRA 3AEYA 3AERB 3VTZA 3AJAA 4BV9A 5J2UB 3SXUB 2F1KA 1U8UA 5L53A 1XPRA 2HQ1A 5JZBA 4TLCA 1LLDA 3BE4A 1FA9A 2QJFA 2SKDA 5KJEA 4DGSA 5BPHA 3LUPA 1HYEA 1A4IA 1DZIA 3HO8A 2E21A 2X1VA 3NAQA 3QENA 4IJUA 1P33A 1HDRA 4PAQA 2UZ1B 2Y6UA 1TLTA 1V5FA 4HADA 4BO2A 1CEYA 4MA5A 3V4SA 5A3VA 3WLEA 2ZIZA 2FHSA 3G0IA 1OKKD 2ZQYA 3K1AB 3LE8A 5H1YA 3RSHA 4PS0A 1BW9B 2XDWA 1Z4MA 4CIVA 1R5BA 2BE7A 4G1FA 1OE0A 1QLHA 3AU9A 3HB5X 1V8PA 3RU9A 3CUKA 3ZXIA 4XDGA 1C2TA 1C9EA 2AI1A 5A9TA 4IR7A 3OUUA 4FYWA 2UVPA 2UAGA 4MDEA 2D6FA 1L5SA 4OQ4A 3OC6A 4KX3A 1G9SA 1SAYA 2GRAA 5TQ0B 2R8BA 2GK7A 4U2KA 4MI1A 4EX6A 2FR0A 2DLCX 3ZGVA 2GPSA 1YU6A 1JRLA 1AN9A 3AUJB 3STWA 3FBWA 3W9BA 3BJZA 1OIVA 3OG9A 4UTXA 2F43A 3FDIA 5KNCD 4XX0A 3SAJA 4F5EA 4RCYA 4WZBA 4K1LA 2F1HA 1P0CA 2QYSA 1PR4A 5B7PA 3DB2A 3FJYA 1NA5A 1OLUB 4Q5IA 2PLFA 4CDRA 4O63O 3JPWA 4JL6A 2ZRNA 4CF7A 1YT5A 2NPOA 3TMAA 5JAQA 1U2QA 3WBKA 1KI9A 3NTOA 1RQ7A 1ZKMA 1BX0A 2C7OA 1NXTA 4C3ZA 1LQTA 1F2DA 1CTQA 1P2BA 3PQFA 1JALA 2XQGA 3CUWA 5LDGA 2QI9C 2XI4A 3TL3A 5K3OA 3FGPA 4FX2A 1P72A 2C07A 3QMWA 4JJ7A 3ANXA 1XJWA 1ODSA 2QMHA 2Q2QA 2IE8A 3T0IA 3O8LA 3TIXB 4AYTA 4D9BA 1T5SA 2ZJ5A 1T9BA 1J56A 2BFWA 2PH7A 2QLJA 4G09A 5EA2A 3ZBTA 3M49A 3L02A 1WCWA 3K30A 4D02A 1KA9H 5JXJA 5J2TB 2P1ZA 3M8KA 2CLCX 3NHFA 5IJ0B 3PQDA 1KJ9A 1E2NA 2GILA 3JPYA 3TTYA 1YUNA 5FR1A 5LBTA 4BUCA 3OOHA 2Z8XA 8LDHA 2V5AA 5DNDA 2Q5JA 1EVEA 2CV1A 4DJDC 2WWRA 1SIUA 4ENUA 5LDDC 3T3DA 1Y42X 4G5SA 2P6MA 3FH0A 5KVAA 1TLLA 2HQBA 4YJ3B 1XTBA 2JGIA 4KQHA 4RELA 3F46A 1OQAA 3AFHA 5JI2E 4YRLA 1OT3A 5DBOA 3WIEA 4C0KA 1BDBA 1JJ7A 3WFIA 4BO6A 4QDUA 2CBGA 5EKTA 2NUBA 5K0SA 2E4UA 3N0XA 2EJTA 1NURA 2C96A 1B74A 1GCAA 2PSJA 3EZ9A 5LUBA 1BXRA 2FEPA 3DL2A 4R5HA 3N3AC 4S3MA 1LRKA 2J9ZB 2XKBA 1EX9A 3CB2A 1N4AA 4YDRA 3I61A 1I1NA 5L3VA 2B8EA 2G9QA 2GCIA 3CHYA 2YNMA 2CLOB 2ZUWA 1CZLA 2QUJA 3W5UA 4D42A 1JPNA 1PJCA 1QAMA 2C29D 1BKYA 3C74A 2NTEA 3E4DA 1O4VA 3GT0A 4BN4A 4G85A 5CITA 3E22A 1N1GA 3M6UA 5CH8A 1XVVA 3I6BA 1M6HA 1G8PA 2DFPA 4YPOA 2DHRA 2GN0A 3UH1A 2HTEA 1UT5A 2FPSA 3GW8A 3ZDFA 2HMAA 3ROKA 4NBWA 4WLUA 4WXHA 4D8YA 1XWWA 1O97C 5A2QA 2AS0A 3RTCA 2QVLA 5BXQC 1IXZA 3QJ5A 3KKMA 3AUKA 4X1KA 3DOJA 5EKSA 3ESAA 3MG9A 3WZMA 2A57A 4BZWA 4HAZA 1PSDA 2Q21A 3DOHA 3IEMA 1LKZA 4G1VA 3EQ6A 3WDMA 1MHTA 2P9TA 1HF3A 1KY4A 1PZMA 4GXTA 4F1JA 5DI3A 2FEWB 3WWYA 3O8BA 1G2QA 3DONA 2QN9A 4QQRA 7ABPA 2Y67A 3FJ1A 4AG5A 1NPYA 1U0TA 2O5VA 4QTYA 4OH7A 3DJYA 1F2TA 1OLXA 4ZVRA 3U1VA 1C7RA 1GRNA 1Z7BA 5AD1A 5FLXA 5AI4A 4OI0A 3RIGA 2Z9DA 4DDTA 1NKSA 1SA0A 3PVZA 3WV4A 3BHNA 3QYPA 4HDQB 2BJWA 1WAMA 2R4TA 3LPLA 2VNAA 4CGZA 3IBYA 2P9JA 2ZSDA 1NFFA 2WSYB 3A6LA 5E9QA 2PRSA 2DKFA 3U3KA 4Z1MD 2DFTA 2CF5A 3CKYA 2G88A 2XCIA 1C0KA 3MWGA 3NONA 4TMXA 4P0TA 5L6MB 3BFVA 3KEMA 5B6PA 2HA5A 4MA4A 4ZI7B 3LA6A 3A7EA 2DUJA 2VF7A 4C07A 3D1LA 1ZJWA 1PFYA 1WVGA 3RYIA 3UWSA 3HACA 2ZPTX 3BAZA 1EEHA 4RZSA 5DIZA 2Y27A 4EJSA 1YIOA 1BMDA 1TK2A 2I7CA 4UKDA 5DXFA 1ZVVA 4GMKA 5BV7A 1XDWA 2OOKA 4Q05A 2AFHB 3L7AA 5F12A 3URMA 2B8JA 1XVLA 1PG0A 1PWZA 5FPTA 5FULA 4XTRA 5C1DA 5JRZA 2ONYA 1CDZA 1OXUA 3AUYA 4CDNA 3GFOA 1C1DB 3JR3A 1RYHA 1J49A 3EVNA 4YO8A 4LDJA 5AJXA 3D1JA 4IV0A 5HMLA 2JFOA 1D6JA 2P7HA 1EVZA 2ZWAA 3BQMB 4K2HA 1EINA 3NIDB 3S27A 3OZDA 2EP5A 1D2CA 3LPMA 4UZEA 3KC2A 1V6AA 1X1AA 4FXPA 4MZDA 3V97A 4BFXA 3BXGA 3HV0A 3KKZA 3Q3JB 3LKZA 3GVXA 2X9GA 3RUEA 3ZJTA 1MR3F 1YDEA 1L3BA 3IL2A 1PG5A 2PCLA 2QMYA 3BH0A 1R1DA 4FINA 3ABIA 3K32A 4BO3A 3N05A 3V6LA 4U7GA 1HDOA 3RS2A 4BO7A 1J2UA 3R75A 1QH1B 3P9NA 5IC4A 3E2PA 1DADA 2QSJA 4ZANA 1DC5A 1SVLA 4RHCA 3NAZA 3MWKA 2PSFA 3OAAA 2EX4A 1P74A 3JY6A 3KSZO 2K6GA 1IY9A 5DVZA 1T91A 1TW2A 2BMVA 3FETA 1UQTA 4U3JB 3R8XA 1N6NA 1MOSA 2CZGA 4BQOA 4GAEA 5BVHA 2ZR7A 1N36B 2O54A 2PMCA 4R54A 1DFGA 1QGOA 2JI9A 3Q9UA 2J4DA 3HO6A 4LNUA 3WIDA 4FSXA 3TIFA 2QKYA 3NWOA 2I4LA 2W6CX 4L73A 1XJCA 3P8ZA 2NXCA 4MLCA 1T5OA 1Y9JA 2AB0A 5ALEA 3RUIA 2IDKA 1DQPA 3HKEA 4UMFA 5FNVA 4QYWA 2R65A 3DAPA 3NXSA 1U7WA 1NF8A 2O4CA 3PDCA 1R5NA 3VBEA 4UMEA 4B4DA 2VN8A 4LYYA 4Q21A 5JZSA 2D06A 2WWGA 3AUTA 3F5DA 3IALA 3NHLA 2C00A 4FB4A 5HPYB 3W2HA 5IG2A 1O0BA 1YE8A 3Q12A 4KU4A 5AHRA 4GNKA 4OA5A 2C7RA 2YXEA 1PJZA 3ZKWB 1B93A 3C3DA 4J4HA 3ROGA 1WMFA 1B42A 2HBYA 1O9GA 1HNXB 2WWTA 1QZZA 4MV0A 5C8ZA 3ZGLA 4CG2A 2RGBA 5U4QA 5BPFA 4MKRA 1W5EA 3KOYA 3SKYA 3UW3A 2FI1A 4N3GA 3ES9A 2PPLA 5JROA 2YY5A 2YWEA 1HLPA 2WAAA 3O4RA 4RTQA 3V7UA 2KQUA 4YO7A 3HGTA 1P2VA 4PNPA 1U2GC 5BNIA 2CXOA 1DUIA 4Q1EA 4FFOA 1CZRA 2ZI4A 5F2NA 1HR0B 2Q27A 3RFXA 3ZCQA 4RMJA 3VU8A 1F20A 3ZYZA 2B2NA 2FW9A 4MV7A 4BMOB 1U2RA 1GT6A 1IK6A 1E32A 2FQXA 3CF4A 1SD1A 2FYTA 2WJPA 1X8JA 2WTNA 3E27A 3ROPA 2W6JA 4CM7A 1CR1A 5TQ2B 1M3SA 3DMTA 4J76A 4DW8A 5BMVB 2LV8A 3G1TA 1CUJA 4E70A 3TAXA 2F59A 3HS3A 1ECBA 1WY7A 2ORIA 3QEKA 4FUQA 4G26A 4UJ5A 3RHSA 2B3TA 5AKIA 3ZWWA 2ZRMA 5I8WA 4MW6A 1N1DA 1SWWA 3JVDA 3K96A 3WRYA 2XCUA 3WK8A 3I9NA 3R3VA 5AVZA 3RVPA 3LZDA 1KAMA 1UL1X 3X1KA 4MQUA 3UW1A 4W9NC 1F48A 2VBFA 1NW4A 2JGDA 5CH3A 4KN5A 3TTTA 3SOZA 4AKGA 2FJUA 2VQSA 3ZLUA 3S8YA 1MC5A 4BNLA 3UAOA 1JEQA 4P58A 2PRJA 5HF8A 1WXHA 4R2MA 3BXPA 2PUBA 1YQXA 4RIGA 5EPUA 4PO1A 1QDEA 2VXBA 1UJMA 2UUCB 1VIAA 2J9YB 1Q74A 1P2DA 2OV2A 2ZIXB 4WUTA 1YOVA 4FNAA 3I1YA 1K5GA 4M1OA 4BNJA 5MGBA 2E0IA 3PEVA 4B3GA 2QSZA 4YRFA 4U2CA 4RD6A 2C4VA 4JJGA 3VOTA 4E30A 1E1YA 1D6MA 1NP6A 1XZ8A 3CWZA 2DP4E 1NUHA 3O3OB 3Q5EA 3Q3EA 4BFYA 4D4HA 4LMAA 1BEUB 3WX0A 4FE7A 2Q1WA 3TKLA 4RL4A 4A0GA 2KJQA 3Q0IA 4M7OA 4B6SA 3AKCA 2WTBA 3GPBA 3GBSA 4I55A 3LRTA 2C9ZA 4NG4A 4N7RA 5CT8A 1MO3A 3ITNA 3W77A 3DKPA 4DOMA 3SSOA 3TOZA 1SXQA 1URPA 3EIHA 1GTJ1 3IA7A 1O0SA 4RVGA 1MB0A 2FN9A 3OHMA 3LO5A 3S5JA 1AMNA 1VA4A 1ZJ6A 4J2OA 3SYLA 1G4UR 2H1SA 2B21A 2AN3A 2P1RA 1EGMB 4JBWA 1PF7E 3E8XA 3EEBA 4ZTUB 2PD6A 5K8IA 3K09A 4HEA1 2CNNA 1A04A 2O8FB 1NQOA 1N6OA 4JU8A 4K6CA 4N82A 2V6IA 1NNI1 2G6BA 2PNFA 4YJ2A 1YQ9A 2B83A 2BFNA 1DQRA 4NU0A 5FYDA 4HDRB 5JRJA 1M0TA 2JDIA 2V3CC 3V1KA 3F6YA 4BMDA 2WT8A 1QSGA 2R25B 2YR0A 1CR0A 1P5JA 2Z30A 1YRAA 2RJNA 5K2MA 3C4JA 4QTXA 3SR4A 2GEJA 1OUMA 2IU3A 2X2EA 2ZCUA 1GSAA 1Q0UA 4OM8A 5ALZA 4EHDA 2P7IA 2CDAA 4OJKA 2QXTA 3BE5A 2A5FA 4OMFG 3EDYA 5FV7A 4AM8A 3G2HA 2UUAB 2VSOA 4CCAA 4FCWA 4DILA 2V1UA 2D1TA 1AO0A 3X1ZA 3QKSA 2OECA 3H0KA 2Q6OA 5IVDA 1L4EA 4D8XA 5DCUA 1MXFA 4X62B 1KBZA 2HLDD 1OZHA 1JT2A 1M5TA 4X6LA 5AOVA 4R7GA 3KSDO 2XCOA 1ZOIA 1HDIA 2NXEA 1YR9A 2OR3A 2V96A 4RVFA 4FNOA 4LXUA 2R8PA 1ZU4A 4R71A 4XJTA 5CDHA 3S2ZA 3V80A 1HE3A 1YK0A 5FOTA 3T3HA 4X92A 1A3CA 2JB9A 2RKOA 2FP4A 1XXLA 3FR8A 4AP9A 1SQ0A 1J1IA 2C5AA 4V0SA 2FE1A 1EFKA 2XW6A 4AJIA 1UIMA 1UXIA 4DR2B 4Y6QA 3W2GA 5GONF 4GOKA 3TH5A 2YWHA 3BXZA 3FKSA 4MP8A 5EIOA 4FHCA 1Z0UA 4ZALA 5KQLA 4W1PA 2OUIA 3FOCA 3IR5A 2YQ4A 4RKWA 1BA2A 4XM0A 1PN3A 3KO8A 4MUHA 3UWKA 2AR7A 2EWWA 2YUTA 1Q0TA 1E2DA 1PWHA 3DEAA 5CFRA 4K3UA 1AMOA 1ZGGA 2YHAA 3PL5A 1T8WA 3DVAA 1W36D 1PK8A 3AHJA 1E3DA 3KAJA 1NJ6A 5EKXA 5CJJA 3T5AA 1XK7A 3P2IA 3ZQUA 1PDOA 4HFMA 2D5AA 3BL8A 4BKMA 1KARA 3T9CA 1CEQA 3OEYA 1P2TA 2NZVG 2O5RA 5IVPA 4DR1B 4UEKA 3OQBA 5EJ2A 4GG1A 4WLVA 3R3UA 2W00A 3TMKA 2IHBA 2I03A 4JXJA 4CN8A 3R3ZA 3TMYA 2VP2A 4MRVA 2EZUA 3R7BA 3GD5A 4B8WA 1H0SA 4DCVA 4PRYA 2OXTA 5JJ5A 3C6YA 2WTMA 3OU6A 1GYPA 4UM5A 4N3CA 4QPPA 3U44A 2IZ7A 1C1HA 4F2PA 3IVXA 1I2BA 2VT7A 4O33A 1FFAA 5ALQA 2IV3A 1FS5A 1XWIA 1KDYA 3SSMA 4CU5A 2E5WA 2GNPA 1Z9BA 4Y1GA 5C1BA 1ODIA 4UAUA 1ATZA 5A06A 5DASA 1RZVA 4MQ6A 2PH1A 2QLTA 1CLEA 3V2GA 1E0AA 3EPRA 3S7TA 3A1TA 1YDGA 3NXKA 1MKYA 4I1SA 3BEDA 1VJDA 4PS1A 2H2AA 2EKLA 1E1CA 1SCQA 1RYFA 2G9UA 2CZQA 3L77A 4GX0A 3MA0A 3Q3HA 3ZQKA 3HR8A 2C4UA 4O4IF 3CNQS 5IARA 3WNQA 4EO9A 4YRCA 1XPJA 1RVV1 4JSYA 2H7XA 1XZQA 4LBZA 4FU0A 4BLWA 5IWCA 1GG2A 3EZFA 4WCFC 2GX6A 1XZEA 4F9GA 4F6RA 3PX7A 3MFYA 1NP7A 1XKLA 4J1NA 3PT9A 3H11B 3HY4A 1P9OA 2ONCA 3LTNC 4X5OA 1TRHA 4QG7A 3UFBA 4ER6A 1P3JA 2IGBA 2QNIA 3FPAA 4N18A 3L7IA 4BNUA 1ZCAA 2XNJA 5H70A 3GZTB 3RYHA 1L7NA 4M7WA 4B40A 2AMLA 2Y0EA 3AR6A 4BFTA 1U11A 2FEKA 5BR1A 5IKOA 2FMXA 3BWXA 4UFNA 2R9VA 4E7OA 1STOA 2HU7A 2ZUCA 3HUUA 4XWTA 2DXIA 1CKEA 2EDAA 2CNBA 2EWMA 3L7MA 5FUWA 2NZJA 3P4XA 2P4HX 1Z22A 1ZH8A 2RBGA 1UK9A 2O1WA 4G6ZA 2PRYA 2YBEA 1TIPA 1ISHA 1SOWA 2O52A 4ZJZA 3KE9A 2RHJA 2A5LA 3O47A 1G38A 5C8YB 4L4UA 1MEOA 3W5BA 1P7PA 1T10A 4EFDA 2FEMA 3BZWA 3PRJA 1QQ6A 1WXIA 1YBVA 4ACBA 3H9JA 4DBZA 3PNQA 1U9YA 3M5PA 3P9CA 1JSCA 3ONNA 4RQAA 3I6IA 4U2BA 2CYCA 3F3KA 3LX6A 1R16A 3O8DA 1G55A 4WA8A 2Q50A 3T1QA 4I4TA 1D1SA 1LV7A 2GRUA 5KX5F 3AESB 4HQFA 2DUUA 2AZDA 2H7VA 5D8DA 5D3KA 2O48X 2DSTA 5D1HA 1R3DA 1DXQA 2IPNA 3ZS9A 4BLOA 4PBRA 3K1ZA 3GO4A 3H2GA 4FFMA 1HC7A 1Q77A 3KS9A 3F7NA 1JT9A 4TMTA 4KZKA 1A7AA 1O89A 1EG7A 1PZFA 1KNXA 1ULAA 2BKAA 3MMXA 3WLRA 4D46A 4CUJA 3OJEA 1X38A 1RTKA 1LF0A 1YQWA 2FGKA 2QYTA 4QC2A 5DGTA 4KXYA 2G63A 4BIMA 1MW8X 1V7PC 1BRTA 1NC1A 1ZJ4A 5E6SB 2C5SA 2DWQA 2VA8A 1BN7A 1K8ZB 1K6JA 2P6PA 3K5HA 2FHPA 1MVLA 3MTIA 4PTZA 5CLGA 1TKAA 2EXXA 1PT9A 3KEOA 1R6BX 3WHLA 2Q6KA 3VYTB 4M1YA 1OH7A 1VMKA 1UZAA 2YYAA 3HLYA 3D4BA 3OLYA 2O8VA 4AQDA 1EG2A 1O08A 1GP2A 3FCEA 1IJFA 4W5OA 1QORA 1XLWA 2JFPA 3L49A 4P4GA 3RI3A 2IEGA 4I36A 4D79A 1O03A 3ND5A 1WA5A 3RAJA 1MX3A 5BRJA 4XWOA 3LW7A 3EXHB 1E92A 3MOIA 3EVEA 3N07A 2PZBA 3OQ1A 2CMGA 1MC4A 4LZNA 2ATEA 1SXJA 1DC8A 3ICVA 1MOZA 4ZU3A 5GVRA 4BQIA 3RIHA 3S8EA 3UMJA 3ZHYA 1N34B 3DOIA 3NDIA 4WY2A 2BKUA 4YK7A 4WKBA 3BWVA 4JV5B 1V96A 3EIXA 3WLOA 1N77A 1CUXA 2VJOA 4FFBB 5CT9A 1G0NA 3AI3A 1EVIA 1SEVA 1UDCA 3ADKA 2C8KA 3I83A 4MW5A 4NI5A 3OPNA 4YACA 1JBKA 3HCAA 1RC8A 2HIGA 4YAOA 4OBEA 3KPJA 3WWPA 1Z18A 4ND8B 3KXDA 4CZ2A 3UMGA 1VBKA 3KKEA 3T99A 2QRNA 5ARBA 4MKIA 1IBCA 2HJ9A 2P9HA 3MGGA 3Q6IA 4KBFA 4XASA 5CA0F 5F23A 2C4TA 3MSCA 1MAHA 4U0KA 4G5FA 3JVVA 4LWOA 4X84A 4NCXA 3TCXB 4QUBA 3Q88A 2ZIEA 2JK1A 5AM1A 1W2HA 5E4YA 2BI8A 3G0DA 4C04A 3OZTA 1UP6A 2WZBA 1KY5A 1Z0KA 1SRRA 4MVJG 2BGNA 4KDEA 3CZCA 4KO8A 3TYXA 1FNDA 2NAFA 4QRIA 3ZWBA 4N1AA 4RESA 4LFCB 3SZ3A 2ZB3A 1W5AA 1C9JA 1U0GA 3HVJA 1T2NA 1DBSA 1Y37A 1FYXA 3I6YA 4YDSA 3ZTWA 3JZMA 2CMDA 1V1RA 1QYVA 2OG2A 2X41A 1Y3IA 4RWEA 4ZMRA 1M1NA 1ONSA 2CFOA 1WG8A 2I3GA 4KQ9A 3EARA 3RVLA 4RTNA 4S0ZA 2ZT7A 1WO8A 3Q7TA 3HM2A 4YDQA 3AJ8A 3A6EA 2HI0A 1QU3A 1TAQA 4ZHQB 5BSHA 1CULC 5A62A 3HKDB 4WNCA 4UU0A 4HT3B 5PNTA 3RVQA 3RARA 3ZDYB 3NUZA 3OZXA 1G4AE 2B4TO 5JZMA 1R6UA 3OQIB 1GQQA 2D2XA 3PFGA 2JLBA 1SVKA 4DJEC 2AR9A 1BE8A 1Y8QB 4UDNA 5BN1A 4KNYA 2JLUA 2OHHA 3B9RA 2XOEA 1UKVY 3DFMA 4KTTE 3PHHA 4PM4A 4QODA 1O8BA 4PLZA 5AK4A 1U2DA 3EOZA 1NVWQ 3PUJA 5E6UA 3AR3A 1ECPA 3OQNA 2IYFA 1BGVA 3B6JA 2JI4A 3DR5A