1BHTA

Nk1 fragment of human hepatocyte growth factor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
176
structure length
176
Chain Sequence
b'RRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR
publication title Crystal structure of the NK1 fragment of human hepatocyte growth factor at 2.0 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Heparin-binding domain
total genus 45
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 1bhtA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1bhtA01
3HMSA 5CS1A 4Z0EA 3HMRA 4APMA 2F83A 4HZHA 2Z8WA 2QJ2A 5I25A 1I71A 2KNFA 2I9BA 2J8LA 2K4RA 4O03A 4R19A 2LL3A 1NL1A 5CP9A 2DOIA 1YXEA 3ZLEA 2HGFA 2L0SA 2Q8AA 1HPKA 5COEA 1PMLA 1PK4A 4R1CA 5CT2A 4UV6A 4Z0FA 3NXPA 1NK1A 3K65A 3BT2A 4Z0DA 2Y8RA 4DURA 1KDUA 3KIVA 5CS9A 5CS5A 3HMTA 1TPKA 3HN4A 1W81A 1BHTA 2HPQP 2I9AA 4KIVA 3LAQA 2J8JA 2LL4M 2HPPP 2Q8BA 1HKYA 4A5TS 4R1BA 4BV5A 5HPGA 4R1AA 3SP8A 5CT1A 1B2IA 2QJ4A 2X2ZA 3SRIA 2PF2A 2PK4A 2KJ4A 4APLA 1GP9A 1Z40A 4BVWA 1KRNA 2PF1A 3SRJA 3E6PL 5EODA 4Z09A 5CS3A 2YIPA 2FD6A 4NZQA 3MKPA 2FEBA 2YILA 1KIVA 4BVCA 4IUAA 4BVVA 3ZWZA 1GMNA 1PKRA 5EOKA 1W8KA 2DOHX 1A0HA 1JFNA 4UAOA 1PK2A 1I8NA 4BVDA 1CEAA 1GMOA 1I5KA 4CIKA 1HPJA 2Z8VA 1CEBA 1PMKA 2K51A 1URKA 4D3CA 5CT3A 1KI0A 2SPTA 1NL2A 3U73A 2K13X 3BT1A 2YIOA 5CSQA 4BV7A
chains in the Genus database with same CATH superfamily
3HMSA 5CS1A 4Z0EA 3HMRA 4APMA 2F83A 4HZHA 2Z8WA 2QJ2A 5I25A 1I71A 2KNFA 2I9BA 2J8LA 2K4RA 4O03A 4R19A 2LL3A 1NL1A 5CP9A 2DOIA 1YXEA 3ZLEA 2HGFA 2L0SA 2Q8AA 1HPKA 5COEA 1PMLA 1PK4A 4R1CA 5CT2A 4UV6A 4Z0FA 3NXPA 1NK1A 3K65A 3BT2A 4Z0DA 2Y8RA 4DURA 1KDUA 3KIVA 5CS9A 5CS5A 3HMTA 1TPKA 3HN4A 1W81A 1BHTA 2HPQP 2I9AA 4KIVA 3LAQA 2J8JA 2LL4M 2HPPP 2Q8BA 1HKYA 4A5TS 4R1BA 4BV5A 4YIVA 5HPGA 4R1AA 3SP8A 5CT1A 1B2IA 2QJ4A 2X2ZA 3SRIA 2PF2A 2PK4A 2KJ4A 4APLA 1GP9A 1Z40A 4BVWA 1KRNA 2PF1A 3SRJA 3E6PL 5EODA 4Z09A 5CS3A 2YIPA 2FD6A 4NZQA 3MKPA 2FEBA 2YILA 1KIVA 4BVCA 4IUAA 4BVVA 3ZWZA 1GMNA 1PKRA 5EOKA 1W8KA 2DOHX 1A0HA 1JFNA 4UAOA 1PK2A 1I8NA 4BVDA 1CEAA 1GMOA 1I5KA 4CIKA 1HPJA 2Z8VA 1CEBA 1PMKA 2K51A 1URKA 4D3CA 2KL5A 5CT3A 1KI0A 2SPTA 1NL2A 3U73A 2K13X 4YIZA 3BT1A 2YIOA 5CSQA 4BV7A
chains in the Genus database with same CATH topology
3HMSA 5CS1A 4Z0EA 3HMRA 4APMA 2F83A 4HZHA 2Z8WA 2QJ2A 5I25A 1I71A 2KNFA 2I9BA 2J8LA 2K4RA 4O03A 4R19A 2LL3A 1NL1A 5CP9A 2DOIA 1YXEA 3ZLEA 2HGFA 2L0SA 2Q8AA 1HPKA 5COEA 1PMLA 1PK4A 4R1CA 5CT2A 4UV6A 4Z0FA 3NXPA 1NK1A 3K65A 3BT2A 4Z0DA 2Y8RA 4DURA 1KDUA 3KIVA 5CS9A 5CS5A 3HMTA 1TPKA 3HN4A 1W81A 1BHTA 2HPQP 2I9AA 4KIVA 3LAQA 2J8JA 2LL4M 2HPPP 2Q8BA 1HKYA 4A5TS 4R1BA 4BV5A 4YIVA 5HPGA 4R1AA 3SP8A 5CT1A 1B2IA 2QJ4A 2X2ZA 3SRIA 2PF2A 2PK4A 2KJ4A 4APLA 1GP9A 1Z40A 4BVWA 1KRNA 2PF1A 3SRJA 3E6PL 5EODA 4Z09A 5CS3A 2YIPA 2FD6A 4NZQA 3MKPA 2FEBA 2YILA 1KIVA 4BVCA 4IUAA 4BVVA 3ZWZA 1GMNA 1PKRA 5EOKA 1W8KA 2DOHX 1A0HA 1JFNA 4UAOA 1PK2A 1I8NA 4BVDA 1CEAA 1GMOA 1I5KA 4CIKA 1HPJA 2Z8VA 1CEBA 1PMKA 2K51A 1URKA 4D3CA 2KL5A 5CT3A 1KI0A 2SPTA 1NL2A 3U73A 2K13X 4YIZA 3BT1A 2YIOA 5CSQA 4BV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HMS A;  5CS1 A;  4Z0E A;  3HMR A;  4APM A;  2F83 A;  4HZH A;  2Z8W A;  2QJ2 A;  5I25 A;  1I71 A;  2KNF A;  2I9B A;  2J8L A;  2K4R A;  4O03 A;  4R19 A;  2LL3 A;  1NL1 A;  5CP9 A;  2DOI A;  1YXE A;  3ZLE A;  2HGF A;  2L0S A;  2Q8A A;  1HPK A;  5COE A;  1PML A;  1PK4 A;  4R1C A;  5CT2 A;  4UV6 A;  4Z0F A;  3NXP A;  1NK1 A;  3K65 A;  3BT2 A;  4Z0D A;  2Y8R A;  4DUR A;  1KDU A;  3KIV A;  5CS9 A;  5CS5 A;  3HMT A;  1TPK A;  3HN4 A;  1W81 A;  1BHT A;  2HPQ P;  2I9A A;  4KIV A;  3LAQ A;  2J8J A;  2LL4 M;  2HPP P;  2Q8B A;  1HKY A;  4A5T S;  4R1B A;  4BV5 A;  5HPG A;  4R1A A;  3SP8 A;  5CT1 A;  1B2I A;  2QJ4 A;  2X2Z A;  3SRI A;  2PF2 A;  2PK4 A;  2KJ4 A;  4APL A;  1GP9 A;  1Z40 A;  4BVW A;  1KRN A;  2PF1 A;  3SRJ A;  3E6P L;  5EOD A;  4Z09 A;  5CS3 A;  2YIP A;  2FD6 A;  4NZQ A;  3MKP A;  2FEB A;  2YIL A;  1KIV A;  4BVC A;  4IUA A;  4BVV A;  3ZWZ A;  1GMN A;  1PKR A;  5EOK A;  1W8K A;  2DOH X;  1A0H A;  1JFN A;  4UAO A;  1PK2 A;  1I8N A;  4BVD A;  1CEA A;  1GMO A;  1I5K A;  4CIK A;  1HPJ A;  2Z8V A;  1CEB A;  1PMK A;  2K51 A;  1URK A;  4D3C A;  5CT3 A;  1KI0 A;  2SPT A;  1NL2 A;  3U73 A;  2K13 X;  3BT1 A;  2YIO A;  5CSQ A;  4BV7 A; 
#chains in the Genus database with same CATH topology
 3HMS A;  5CS1 A;  4Z0E A;  3HMR A;  4APM A;  2F83 A;  4HZH A;  2Z8W A;  2QJ2 A;  5I25 A;  1I71 A;  2KNF A;  2I9B A;  2J8L A;  2K4R A;  4O03 A;  4R19 A;  2LL3 A;  1NL1 A;  5CP9 A;  2DOI A;  1YXE A;  3ZLE A;  2HGF A;  2L0S A;  2Q8A A;  1HPK A;  5COE A;  1PML A;  1PK4 A;  4R1C A;  5CT2 A;  4UV6 A;  4Z0F A;  3NXP A;  1NK1 A;  3K65 A;  3BT2 A;  4Z0D A;  2Y8R A;  4DUR A;  1KDU A;  3KIV A;  5CS9 A;  5CS5 A;  3HMT A;  1TPK A;  3HN4 A;  1W81 A;  1BHT A;  2HPQ P;  2I9A A;  4KIV A;  3LAQ A;  2J8J A;  2LL4 M;  2HPP P;  2Q8B A;  1HKY A;  4A5T S;  4R1B A;  4BV5 A;  4YIV A;  5HPG A;  4R1A A;  3SP8 A;  5CT1 A;  1B2I A;  2QJ4 A;  2X2Z A;  3SRI A;  2PF2 A;  2PK4 A;  2KJ4 A;  4APL A;  1GP9 A;  1Z40 A;  4BVW A;  1KRN A;  2PF1 A;  3SRJ A;  3E6P L;  5EOD A;  4Z09 A;  5CS3 A;  2YIP A;  2FD6 A;  4NZQ A;  3MKP A;  2FEB A;  2YIL A;  1KIV A;  4BVC A;  4IUA A;  4BVV A;  3ZWZ A;  1GMN A;  1PKR A;  5EOK A;  1W8K A;  2DOH X;  1A0H A;  1JFN A;  4UAO A;  1PK2 A;  1I8N A;  4BVD A;  1CEA A;  1GMO A;  1I5K A;  4CIK A;  1HPJ A;  2Z8V A;  1CEB A;  1PMK A;  2K51 A;  1URK A;  4D3C A;  2KL5 A;  5CT3 A;  1KI0 A;  2SPT A;  1NL2 A;  3U73 A;  2K13 X;  4YIZ A;  3BT1 A;  2YIO A;  5CSQ A;  4BV7 A; 
#chains in the Genus database with same CATH homology
 3HMS A;  5CS1 A;  4Z0E A;  3HMR A;  4APM A;  2F83 A;  4HZH A;  2Z8W A;  2QJ2 A;  5I25 A;  1I71 A;  2KNF A;  2I9B A;  2J8L A;  2K4R A;  4O03 A;  4R19 A;  2LL3 A;  1NL1 A;  5CP9 A;  2DOI A;  1YXE A;  3ZLE A;  2HGF A;  2L0S A;  2Q8A A;  1HPK A;  5COE A;  1PML A;  1PK4 A;  4R1C A;  5CT2 A;  4UV6 A;  4Z0F A;  3NXP A;  1NK1 A;  3K65 A;  3BT2 A;  4Z0D A;  2Y8R A;  4DUR A;  1KDU A;  3KIV A;  5CS9 A;  5CS5 A;  3HMT A;  1TPK A;  3HN4 A;  1W81 A;  1BHT A;  2HPQ P;  2I9A A;  4KIV A;  3LAQ A;  2J8J A;  2LL4 M;  2HPP P;  2Q8B A;  1HKY A;  4A5T S;  4R1B A;  4BV5 A;  4YIV A;  5HPG A;  4R1A A;  3SP8 A;  5CT1 A;  1B2I A;  2QJ4 A;  2X2Z A;  3SRI A;  2PF2 A;  2PK4 A;  2KJ4 A;  4APL A;  1GP9 A;  1Z40 A;  4BVW A;  1KRN A;  2PF1 A;  3SRJ A;  3E6P L;  5EOD A;  4Z09 A;  5CS3 A;  2YIP A;  2FD6 A;  4NZQ A;  3MKP A;  2FEB A;  2YIL A;  1KIV A;  4BVC A;  4IUA A;  4BVV A;  3ZWZ A;  1GMN A;  1PKR A;  5EOK A;  1W8K A;  2DOH X;  1A0H A;  1JFN A;  4UAO A;  1PK2 A;  1I8N A;  4BVD A;  1CEA A;  1GMO A;  1I5K A;  4CIK A;  1HPJ A;  2Z8V A;  1CEB A;  1PMK A;  2K51 A;  1URK A;  4D3C A;  2KL5 A;  5CT3 A;  1KI0 A;  2SPT A;  1NL2 A;  3U73 A;  2K13 X;  4YIZ A;  3BT1 A;  2YIO A;  5CSQ A;  4BV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...