1BHTA

Nk1 fragment of human hepatocyte growth factor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
176
structure length
176
Chain Sequence
RRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPATOCYTE GROWTH FACTOR
publication title Crystal structure of the NK1 fragment of human hepatocyte growth factor at 2.0 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Heparin-binding domain
total genus 45
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00024 PAN_1 PAN domain
A PF00051 Kringle Kringle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.20.10 Mainly Beta Beta Barrel Plasminogen Kringle 4 Plasminogen Kringle 4 1bhtA02
3.50.4.10 Alpha Beta 3-Layer(bba) Sandwich Hepatocyte Growth Factor Hepatocyte Growth Factor 1bhtA01
3SRIA 2HPQP 4R1CA 1B2IA 3LAQA 1KIVA 2PK4A 5CS3A 2SPTA 2LL4M 2J8LA 1URKA 2Q8BA 4BV5A 3HMTA 5CP9A 3SRJA 2DOHX 4Z0FA 2I9AA 4A5TS 1KDUA 1PMLA 5CT3A 2FEBA 3KIVA 4BVWA 1CEBA 4KIVA 1BHTA 5CS5A 4Z0EA 4BVVA 3HMSA 1Z40A 2Z8VA 1HPJA 1A0HA 2J8JA 1PMKA 2PF2A 2YIPA 2Z8WA 1HKYA 4R19A 2K4RA 1W81A 1I71A 4CIKA 1I8NA 1NK1A 5CS9A 4R1AA 5CSQA 2KNFA 2I9BA 2Y8RA 3SP8A 5HPGA 3HMRA 2FD6A 4APLA 2K13X 2X2ZA 5EODA 2YILA 1GMOA 3ZWZA 1GMNA 4IUAA 4R1BA 2KJ4A 4NZQA 5EOKA 1PK4A 1I5KA 2QJ2A 3K65A 1KRNA 4UAOA 4Z0DA 1KI0A 5CT1A 2LL3A 4APMA 1NL1A 1NL2A 3E6PL 2DOIA 3MKPA 4HZHA 1HPKA 2PF1A 3BT1A 3BT2A 1CEAA 3HN4A 4BV7A 1YXEA 2HGFA 5CT2A 5COEA 2YIOA 5I25A 2F83A 4Z09A 4BVCA 2HPPP 4DURA 3ZLEA 4BVDA 2L0SA 4UV6A 4D3CA 2K51A 1JFNA 1PK2A 1TPKA 3U73A 5CS1A 1GP9A 1W8KA 3NXPA 1PKRA 2QJ4A 2Q8AA 4O03A
chains in the Genus database with same CATH superfamily
3SRIA 2HPQP 4R1CA 1B2IA 3LAQA 1KIVA 2PK4A 5CS3A 2SPTA 2LL4M 2J8LA 1URKA 2Q8BA 4BV5A 3HMTA 5CP9A 3SRJA 2DOHX 4Z0FA 2I9AA 4A5TS 1KDUA 1PMLA 5CT3A 4YIZA 2FEBA 3KIVA 4BVWA 1CEBA 4KIVA 1BHTA 5CS5A 4Z0EA 4BVVA 3HMSA 1Z40A 2Z8VA 1HPJA 1A0HA 2J8JA 1PMKA 2PF2A 2YIPA 2Z8WA 1HKYA 4R19A 2KL5A 2K4RA 1W81A 1I71A 4CIKA 1I8NA 1NK1A 5CS9A 4R1AA 5CSQA 2KNFA 2I9BA 2Y8RA 3SP8A 5HPGA 3HMRA 2FD6A 4APLA 2K13X 2X2ZA 5EODA 2YILA 4YIVA 1GMOA 3ZWZA 1GMNA 4IUAA 4R1BA 2KJ4A 4NZQA 5EOKA 1PK4A 1I5KA 2QJ2A 3K65A 1KRNA 4UAOA 4Z0DA 1KI0A 5CT1A 2LL3A 4APMA 1NL1A 1NL2A 3E6PL 2DOIA 3MKPA 4HZHA 1HPKA 2PF1A 3BT1A 3BT2A 1CEAA 3HN4A 4BV7A 1YXEA 2HGFA 5CT2A 5COEA 2YIOA 5I25A 2F83A 4Z09A 4BVCA 2HPPP 4DURA 3ZLEA 4BVDA 2L0SA 4UV6A 4D3CA 2K51A 1JFNA 1PK2A 1TPKA 3U73A 5CS1A 1GP9A 1W8KA 3NXPA 1PKRA 2QJ4A 2Q8AA 4O03A
chains in the Genus database with same CATH topology
3SRIA 2HPQP 4R1CA 1B2IA 3LAQA 1KIVA 2PK4A 5CS3A 2SPTA 2LL4M 2J8LA 1URKA 2Q8BA 4BV5A 3HMTA 5CP9A 3SRJA 2DOHX 4Z0FA 2I9AA 4A5TS 1KDUA 1PMLA 5CT3A 4YIZA 2FEBA 3KIVA 4BVWA 1CEBA 4KIVA 1BHTA 5CS5A 4Z0EA 4BVVA 3HMSA 1Z40A 2Z8VA 1HPJA 1A0HA 2J8JA 1PMKA 2PF2A 2YIPA 2Z8WA 1HKYA 4R19A 2KL5A 2K4RA 1W81A 1I71A 4CIKA 1I8NA 1NK1A 5CS9A 4R1AA 5CSQA 2KNFA 2I9BA 2Y8RA 3SP8A 5HPGA 3HMRA 2FD6A 4APLA 2K13X 2X2ZA 5EODA 2YILA 4YIVA 1GMOA 3ZWZA 1GMNA 4IUAA 4R1BA 2KJ4A 4NZQA 5EOKA 1PK4A 1I5KA 2QJ2A 3K65A 1KRNA 4UAOA 4Z0DA 1KI0A 5CT1A 2LL3A 4APMA 1NL1A 1NL2A 3E6PL 2DOIA 3MKPA 4HZHA 1HPKA 2PF1A 3BT1A 3BT2A 1CEAA 3HN4A 4BV7A 1YXEA 2HGFA 5CT2A 5COEA 2YIOA 5I25A 2F83A 4Z09A 4BVCA 2HPPP 4DURA 3ZLEA 4BVDA 2L0SA 4UV6A 4D3CA 2K51A 1JFNA 1PK2A 1TPKA 3U73A 5CS1A 1GP9A 1W8KA 3NXPA 1PKRA 2QJ4A 2Q8AA 4O03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SRI A;  2HPQ P;  4R1C A;  1B2I A;  3LAQ A;  1KIV A;  2PK4 A;  5CS3 A;  2SPT A;  2LL4 M;  2J8L A;  1URK A;  2Q8B A;  4BV5 A;  3HMT A;  5CP9 A;  3SRJ A;  2DOH X;  4Z0F A;  2I9A A;  4A5T S;  1KDU A;  1PML A;  5CT3 A;  2FEB A;  3KIV A;  4BVW A;  1CEB A;  4KIV A;  1BHT A;  5CS5 A;  4Z0E A;  4BVV A;  3HMS A;  1Z40 A;  2Z8V A;  1HPJ A;  1A0H A;  2J8J A;  1PMK A;  2PF2 A;  2YIP A;  2Z8W A;  1HKY A;  4R19 A;  2K4R A;  1W81 A;  1I71 A;  4CIK A;  1I8N A;  1NK1 A;  5CS9 A;  4R1A A;  5CSQ A;  2KNF A;  2I9B A;  2Y8R A;  3SP8 A;  5HPG A;  3HMR A;  2FD6 A;  4APL A;  2K13 X;  2X2Z A;  5EOD A;  2YIL A;  1GMO A;  3ZWZ A;  1GMN A;  4IUA A;  4R1B A;  2KJ4 A;  4NZQ A;  5EOK A;  1PK4 A;  1I5K A;  2QJ2 A;  3K65 A;  1KRN A;  4UAO A;  4Z0D A;  1KI0 A;  5CT1 A;  2LL3 A;  4APM A;  1NL1 A;  1NL2 A;  3E6P L;  2DOI A;  3MKP A;  4HZH A;  1HPK A;  2PF1 A;  3BT1 A;  3BT2 A;  1CEA A;  3HN4 A;  4BV7 A;  1YXE A;  2HGF A;  5CT2 A;  5COE A;  2YIO A;  5I25 A;  2F83 A;  4Z09 A;  4BVC A;  2HPP P;  4DUR A;  3ZLE A;  4BVD A;  2L0S A;  4UV6 A;  4D3C A;  2K51 A;  1JFN A;  1PK2 A;  1TPK A;  3U73 A;  5CS1 A;  1GP9 A;  1W8K A;  3NXP A;  1PKR A;  2QJ4 A;  2Q8A A;  4O03 A; 
#chains in the Genus database with same CATH topology
 3SRI A;  2HPQ P;  4R1C A;  1B2I A;  3LAQ A;  1KIV A;  2PK4 A;  5CS3 A;  2SPT A;  2LL4 M;  2J8L A;  1URK A;  2Q8B A;  4BV5 A;  3HMT A;  5CP9 A;  3SRJ A;  2DOH X;  4Z0F A;  2I9A A;  4A5T S;  1KDU A;  1PML A;  5CT3 A;  4YIZ A;  2FEB A;  3KIV A;  4BVW A;  1CEB A;  4KIV A;  1BHT A;  5CS5 A;  4Z0E A;  4BVV A;  3HMS A;  1Z40 A;  2Z8V A;  1HPJ A;  1A0H A;  2J8J A;  1PMK A;  2PF2 A;  2YIP A;  2Z8W A;  1HKY A;  4R19 A;  2KL5 A;  2K4R A;  1W81 A;  1I71 A;  4CIK A;  1I8N A;  1NK1 A;  5CS9 A;  4R1A A;  5CSQ A;  2KNF A;  2I9B A;  2Y8R A;  3SP8 A;  5HPG A;  3HMR A;  2FD6 A;  4APL A;  2K13 X;  2X2Z A;  5EOD A;  2YIL A;  4YIV A;  1GMO A;  3ZWZ A;  1GMN A;  4IUA A;  4R1B A;  2KJ4 A;  4NZQ A;  5EOK A;  1PK4 A;  1I5K A;  2QJ2 A;  3K65 A;  1KRN A;  4UAO A;  4Z0D A;  1KI0 A;  5CT1 A;  2LL3 A;  4APM A;  1NL1 A;  1NL2 A;  3E6P L;  2DOI A;  3MKP A;  4HZH A;  1HPK A;  2PF1 A;  3BT1 A;  3BT2 A;  1CEA A;  3HN4 A;  4BV7 A;  1YXE A;  2HGF A;  5CT2 A;  5COE A;  2YIO A;  5I25 A;  2F83 A;  4Z09 A;  4BVC A;  2HPP P;  4DUR A;  3ZLE A;  4BVD A;  2L0S A;  4UV6 A;  4D3C A;  2K51 A;  1JFN A;  1PK2 A;  1TPK A;  3U73 A;  5CS1 A;  1GP9 A;  1W8K A;  3NXP A;  1PKR A;  2QJ4 A;  2Q8A A;  4O03 A; 
#chains in the Genus database with same CATH homology
 3SRI A;  2HPQ P;  4R1C A;  1B2I A;  3LAQ A;  1KIV A;  2PK4 A;  5CS3 A;  2SPT A;  2LL4 M;  2J8L A;  1URK A;  2Q8B A;  4BV5 A;  3HMT A;  5CP9 A;  3SRJ A;  2DOH X;  4Z0F A;  2I9A A;  4A5T S;  1KDU A;  1PML A;  5CT3 A;  4YIZ A;  2FEB A;  3KIV A;  4BVW A;  1CEB A;  4KIV A;  1BHT A;  5CS5 A;  4Z0E A;  4BVV A;  3HMS A;  1Z40 A;  2Z8V A;  1HPJ A;  1A0H A;  2J8J A;  1PMK A;  2PF2 A;  2YIP A;  2Z8W A;  1HKY A;  4R19 A;  2KL5 A;  2K4R A;  1W81 A;  1I71 A;  4CIK A;  1I8N A;  1NK1 A;  5CS9 A;  4R1A A;  5CSQ A;  2KNF A;  2I9B A;  2Y8R A;  3SP8 A;  5HPG A;  3HMR A;  2FD6 A;  4APL A;  2K13 X;  2X2Z A;  5EOD A;  2YIL A;  4YIV A;  1GMO A;  3ZWZ A;  1GMN A;  4IUA A;  4R1B A;  2KJ4 A;  4NZQ A;  5EOK A;  1PK4 A;  1I5K A;  2QJ2 A;  3K65 A;  1KRN A;  4UAO A;  4Z0D A;  1KI0 A;  5CT1 A;  2LL3 A;  4APM A;  1NL1 A;  1NL2 A;  3E6P L;  2DOI A;  3MKP A;  4HZH A;  1HPK A;  2PF1 A;  3BT1 A;  3BT2 A;  1CEA A;  3HN4 A;  4BV7 A;  1YXE A;  2HGF A;  5CT2 A;  5COE A;  2YIO A;  5I25 A;  2F83 A;  4Z09 A;  4BVC A;  2HPP P;  4DUR A;  3ZLE A;  4BVD A;  2L0S A;  4UV6 A;  4D3C A;  2K51 A;  1JFN A;  1PK2 A;  1TPK A;  3U73 A;  5CS1 A;  1GP9 A;  1W8K A;  3NXP A;  1PKR A;  2QJ4 A;  2Q8A A;  4O03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...