1BHXB

X-ray structure of the complex of human alpha thrombin with the inhibitor sdz 229-357
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
147
structure length
147
Chain Sequence
b'IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA THROMBIN
publication title Rational design, synthesis, and X-ray structure of selective noncovalent thrombin inhibitors.
pubmed doi rcsb
molecule tags Serine protease
total genus 22
structure length 147
sequence length 147
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 1998-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1bhxB00
1RIWB 2VWMA 4X1SU 2AIQA 1TA6A 3ZVGA 4BTUB 2Q6GA 4Y6DA 2XWAA 5FCKA 1QRZA 7ESTE 2ZHQH 3EGKH 2A4QA 2I6SA 3A8DA 4R8TB 5C1UA 1FV9A 3TJVA 1P06A 2EI8A 1PFXC 2V3HH 4WXVA 1GMDG 1GJ4H 2VGCB 3L6PA 1IQFA 3M7TA 1C5YB 1F2SE 2BDIA 3AASA 5T6FA 3SQHE 3P95A 1F5RA 1K22H 3ZZAA 3SUFA 3W94A 1PPZA 1PPBH 2OXSA 7GCHG 1ZHRA 4Z0KA 3BTWE 1O2MA 3LKWA 2DUCA 1Y3XA 1V2PT 1C1PA 2J34A 2R0KA 1QL7A 1LO6A 3ENSB 1L4ZA 1W7XH 1V2QT 2F9PA 1VGCC 2GCTC 2ZU5A 4X1PU 1EUFA 3RP2A 3RU4E 3A89A 2OLGA 4XE4A 2QA9E 3KQEA 4CRBA 2Q1JA 3RXBA 4Y0ZE 1RTFB 2SNWA 1NO9H 4YO9A 3B8JA 3C27B 1C2DA 2PLXA 8GCHG 2QF3A 4X6OA 2P94A 2EEKA 2BXTH 1DUEA 1XUFA 1SGIB 3RXGA 1O3FA 3PB1E 4LXBH 1S84A 1TPAE 1YBWA 1O2WA 1TNIA 3TJOA 1A5HA 1OP2A 3BIVH 3LH3A 4Q2KA 2TPIZ 4KTCA 4FVBA 2FEQH 2Y81A 5DG6A 1G2MA 2WV4A 2C90B 1O2UA 2XRCA 4X6PA 1GBCA 5AHGH 2A0QB 4GSOA 5HYOA 1HFDA 4K60A 4AGJA 4TY6A 2Z9JA 3SU5A 1Z7KA 4BTTB 1BRCE 1XVOA 3GISB 3RXQA 3RMOH 2FOAA 3BN9A 2XXLA 3KIDU 1GBJA 3LONA 4MPVA 1CO7E 1IQHA 1QBVH 3AAUA 1HAVA 3EA8A 4CR9A 1EB2A 8LPRA 2BLQA 2RCEA 1O2IA 2QCYA 5FBEA 4ABJA 1YF4A 3Q3YA 3MNCA 3MH6A 3TH2H 4CH8B 3T28A 2O8MA 5JBCS 1C2MA 3K9XB 2SGPE 4ABIA 2FESH 1TMBH 2FS8A 3T27A 1YPLH 1L1JA 5E2OA 1OOKB 1VCPA 5C67A 4ZHMU 4B76A 1V2MT 2QN5T 4UFFH 1O3EA 1P9UA 2XWBI 4AORA 2NU4E 2FI3E 1P0SH 3VB5A 3VB3A 5GCHG 1ESAA 1A2CH 1DS2E 5EGMA 4ZHAA 1ELFA 4RKOB 1PQ5A 2PKSC 4B2BA 1WSSH 5LGOA 1C5PA 1DWDH 1Y59T 4GHTA 3BIUH 2FI4E 1FY3A 5DK1A 3V7TA 1P8VC 1D6WA 1ZSKA 1D3DB 1N1LA 3LOXA 4SGAE 1SQTA 2JKHA 1ZYOA 5HXFA 2J94A 1ARBA 2NU1E 2B7DH 2BZ6H 1O2HA 1OX1A 1GBEA 1GDNA 2FLRH 1D3QB 4BTIB 4OGXA 4JK6A 2P59A 2A5AA 5ABWA 4IMZA 2WUBA 1P3CA 3ZZBA 1NROH 2PTCE 3S69A 3TNTA 2ZHEH 1O2TA 3F9FA 3SNCA 1KXFA 1O3MA 1PQAA 1S6FA 5EQQA 4MTBA 1ZJDA 1O3LA 1BMMH 2CV3A 5DP3A 4AG1A 3BF6H 3LT3A 2ZCLP 3GDUA 1AU8A 5G4BA 3U1IB 3MO9A 1TB6H 2AYWA 1MKXH 2WYGA 3I29A 1ZR0A 5JBTA 2A2QH 3SU4A 5LPFA 1PPFE 4YT7H 2OCVB 4D9QA 1D9IA 4AOQA 3PWBA 3SHAH 3E0PB 4NIXA 1O3OA 4ZKSU 4O3TA 4JK5A 1LVYA 1K1IA 1BJVA 2H6MA 1O3PB 1UTPA 2A7CA 3RDZA 3M5LA 3QN7A 2QAAA 4I31A 5C1XA 4E7RG 1G3DA 4CRAA 1Y3WA 1WQSA 1AWHB 3SU2A 1GHBG 4XDEA 1AFQC 2OTVA 3ZV9A 2THFB 1U6QA 3FZZA 1MAXA 4YOGA 5A0CA 2FPZA 3RXAA 2ZU1A 4J2YB 1MZAA 1AVWA 4BAOB 4NCYA 4D76A 1E38B 2ZDAH 2IN2A 1GJDB 1O32A 2AMDA 1BT7A 2AEIH 2ZGBH 2ILNA 3MYWA 4INLA 1C5ZB 1HAHH 4O3UA 4HZHA 3ITIA 1G36A 1GBAA 1QBOA 2CMYA 1O3NA 1QCPA 1EZQA 3F1SB 1GHAF 1BIOA 3UY9A 1BMAA 1GGDC 2VWNA 4JZFH 1W13U 2J9NA 3SNEA 8KME2 2ZHDA 3F68H 2UWPA 2BOKA 4NA8A 5A0AE 5K0HA 2FOFA 2G55A 4MQAA 1S85A 2Z3EA 5DGJA 4F49A 1GHWH 1AUTC 1VITH 1VCWA 3T5FH 1G3BA 1P2IA 2FOCA 1C5OH 1SLWB 1GJBB 1Q31A 4UD9H 1KDQA 3ATWA 3BEIB 5I46H 1O2KA 1CHOG 1VJ9U 1WTHD 2FX4A 4U2WA 1S81A 4BAQB 1DUAA 1EOLA 1G30B 5BRRE 3MNXA 1F0RA 1L2EA 2UUFB 5EPNA 1P2JA 1LPZB 4A92A 3DA9B 4UFGH 3K2UA 1AFQB 2ZF0H 1AKSB 3KN2A 1TPSA 2PGQB 1FQ3A 2FX6A 1FPHH 1DXPA 2BQ6B 1QY6A 2J38A 1NC6A 3KL6A 2CJIA 3SHCH 1O38A 2ANWA 2PV9B 1NM6A 3EA7A 1A0LA 4WXIA 1O5CB 2JH6D 1MD8A 1AHTH 2GT7A 1AE5A 4LZ4B 4CHAC 3MWIU 4FUCA 2GT8A 1RTKA 4J1YA 1C2FA 3A7VA 2ZFRH 4UFDH 1HJAC 5EG4A 2PUQH 3FP7E 1HNEE 4WMFA 3UNQA 3SV6A 2ZFSA 1BOQA 2F9OA 1GDQA 2P3TB 1O2OA 3R0FA 2TBSA 1ZZZA 1A3BH 4D8NA 3ZYEA 3QDZB 1MAYA 3GYMA 5E0JA 3EE0B 2WPMS 4B71A 9LPRA 3UIRA 1C9PA 2O8LA 1G37A 1D4PB 1PYTC 2PKAA 3RXOA 1SGYE 1KY9A 3MHWU 1IAUA 5EU8A 3LH1A 3SI4H 3P8OA 1C1MA 3FZDA 4OS4A 2OC0A 1EAIA 1SGDE 4XFQA 3ZVAA 1GPZA 3LGIA 3LC3A 1SMFE 5JDUB 3SUEA 2QF0A 4I8GA 1IHSH 1GI0A 3KQDA 2BD7A 1TGTA 4NIYA 1GWAA 1TX8A 2A45B 2FTMA 5CHAC 1AVXA 4FUFA 1YM0A 2BD2A 3RMMH 2W5EA 3D62A 2VIQA 3QO6A 4ABGA 3OY5U 3SNDA 1JBUH 5A09A 5SGAE 2PUXB 5EW2H 1N8OC 1YKTA 4XOJA 4CHAB 5DP6A 1P11E 1KLTA 2J4IA 3SI3H 3FFGA 3RXIA 3P8FA 2AH4X 4Q7ZA 1XMNB 1IQMA 4GPGA 3RC6A 1HJAB 1CA0B 3GY3A 2A1DB 1GVZA 2G4TA 1T8OA 1XUKA 2A31A 1H4WA 1LCYA 3K6YA 1F5KU 4Y0YE 3F6UH 1UVUH 2SGDE 1B0FA 1FAKH 3QLPH 4X6MA 4ZXXH 2GV7A 3K6ZA 1HAYB 2HOBA 4NIVA 1KTSB 1LHGH 1GL0E 4NWLA 3ATKA 3SORA 3BTME 3NKKA 3PLKA 3TVJB 3I77A 3TGIE 3H7TA 5EOKA 3NCLA 4X1RU 4KELA 1BITA 1MD7A 1GDUA 5A8XA 2ZQ1A 2AIPA 1TNGA 1SHHB 1TMUH 3STIA 1ZPCA 3SBKA 2A4GA 2H9EH 4WMDA 3CS0A 2ZFFH 1QNJA 3T25A 4GCHF 1BHXB 2HNTF 3VXFH 2HNTE 2FYRA 2ZDKA 5C2ZA 1K9OE 5E0GA 3LIWA 4NFEA 1HGTH 1OPHB 2BQ7B 1W0ZU 2VWLA 4TPIZ 4KP0A 5CHAB 4CREA 3RXUA 3DUXH 2XCNA 1MCVA 5HM9A 1Y8TA 4MNWA 2ODQA 5FPSA 3RXLA 3ZVDA 1TA2A 3AW0A 2PSYA 1BMNH 2F9VA 3RXDA 7KMEH 4JYTA 1N8OB 4D7GA 1MQ5A 1A0HB 2PHBA 1K1OA 1YLCA 2EA3A 1GCDA 3PMJA 3PTBA 1O3HA 2FODA 1UTJA 1E35B 1UTOA 1NY22 2ZFPH 3T2NA 4OS7A 3W95A 1ELCA 1SC8U 4AB8A 4Q80A 1PYTD 1TRNA 1RD3B 2ZA5A 3PO1C 3MU1A 1V2TT 1O3GA 3TJUA 3UNSA 3VGCB 1AI8H 1BTWA 2GCHF 1SLUB 1C5RA 1Y3VA 1HAIH 1C2LA 1TFXA 3TGJE 3SU6A 1WBGB 3OY6U 2BY8X 1AN1E 5HMAA 4TWWA 1Y5BT 1CSOE 3S0NA 1FY8E 2WPHS 3M35A 1HB0B 1UJ1A 4ZHLU 5PTPA 1SPJA 3MH7A 1CA8B 3BTKE 4IS5A 2OC7A 3SU3A 1TBZH 1VITG 1KXEA 1UVPA 2ZDLA 3QGNB 5DPAA 4I8JA 4Y7AA 1F7ZA 1GBLA 3V0XA 1XKAC 2VIPA 4FU7A 4UFEH 2HLCA 2BD9A 2VNTA 5FCRA 3TH3H 1KLIH 4KTSA 4DT7B 5A8YA 2Y5FA 2R9PA 2O8TA 1YPHC 3DHKH 3EYDA 2BOHB 4OS6A 2D26C 1ARCA 1CGIE 2GVFA 2W3KA 4AFQA 2Z6BD 3RXHA 4I32A 2ZPRA 1OSSA 3CP7A 3RXCA 1DDJA 4CRCA 4YTAA 1NRNH 4QT8C 2J95A 1IHTH 1ZRBA 3K65B 4U30A 2CGAA 5F03A 2OC8A 1J9CH 3DD2H 1Y5AT 2WPLS 1CT2E 4GLYA 5B6OA 1O39A 4LZ1H 1FIZA 5HGGA 4DVAU 1KTTB 1SGPE 3NK8A 3UFAA 3PO1B 3BTHE 2OQ5A 2Y6TA 4H42U 1KSNA 4I7YH 2QXGA 4Y8XA 1AWFH 4AYVB 4XBBA 1V2JT 4Y79A 1W2KH 1YPHE 2ZU2A 1EATA 1ETRH 1D3PB 3LU9B 1GMCF 1NTPA 2B5TB 1HRTH 1Q3XA 1O3AA 2ZGCA 3KQCA 1O3JA 1QURH 1UK4A 1C1RA 1XXDA 1SGFG 4Y11E 4YOJA 1W11U 4PROA 4WH6A 1P3EA 1VJAU 1C2HA 1H8IH 1JOUB 1WCZA 4Y7BA 1C5SA 1L1NA 4X6NA 1L4DA 1C5WB 1KXDA 1IOEA 1J8AA 1BRBE 1UVSH 2BZAA 4K69A 3TU7H 1O2ZA 3FP6E 3GCOA 3B23B 1F0SA 2IPHA 4YZUA 1BRUP 1GI2A 1PJPA 2SGFE 1Z1IA 1SSXA 1DITH 1ZHMA 1Z8GA 1JXPA 4FU8A 4K1SA 1TE0A 3TITA 1E0FD 2NU2E 1TGNA 5DP5A 4UEHH 3P70B 4ABBA 4RN6A 1HCGA 3KF2A 1RRKA 1KDQB 2BQWB 2Y7XA 1EPTB 1SGRE 1TWXB 4FVDA 4YLUA 2HWLB 1TLDA 4CRGA 4B74A 2Q6FA 1V2OT 2FTLE 4ZUHA 5A0BA 2P93A 3O8BA 1BMLA 1GMHG 3QGJA 1TMTH 1V2UT 4BOHA 4LK4A 3P17H 3SGQE 2ZU3A 3TGKE 4MPXA 1GBTA 1OWDA 2EC9H 3SJ9A 3ZZCA 2GTBA 4AX9H 4I8LA 2AFQB 4NSVA 1TALA 5F6MA 1W12U 6GCHF 3RXRA 1O2NA 3HATH 4FUEA 2KAIB 1TOCB 3LGUA 1UTLM 1LVBA 2FS9A 2F9UA 3ATLA 1NFWA 1AZZA 2XBXA 1GL1A 1CQQA 2WPJS 1DM4B 4IMQA 3Q76A 4NZLA 1FUJA 2IJOB 3DFJA 3QZRA 5ESBA 3N7OA 4FXGH 2BD4A 3BSQA 1ELEE 1ELAA 2H5CA 3A7YA 1ANDA 4ESTE 1DICA 2JH5D 1F0UA 3A8AA 4TPYA 1VCQA 5EQRA 1UVTH 2BB4A 1BRAA 1NFXA 2GP9B 4I8HA 2GDDA 1GBBA 4Q7YA 1V2KT 2WPKS 3A8BA 4IGDA 1SHYA 1T8MA 1KLJH 2ZP0H 1QRWA 4B1TA 1K21H 1LHDH 1ABIH 1DOJA 1Z8IB 3EAJA 1ZTLA 1HXFH 4K1EA 4Y71A 4IN1A 1K1LA 2PKAB 1WUNH 1EOJA 4ABAA 2P8OC 3KGPA 2FOMB 2G5NA 3SOSA 4X8SH 1OP8A 2K1QA 5DP8A 2G81E 3RC5A 1H9LB 3Q77A 1O2VA 2J2UA 1GBDA 1UCYE 2TGDA 2BVXH 1YC0A 4IC5A 1OYTH 1CBWC 4MNVA 3P8GA 4FUJA 3Q00A 3RLYH 2G4UA 3U9AH 2CXVA 2FLBH 1AMHA 2STAE 5DP9A 1EX3A 2A2XH 1LKBA 3M7UA 1C5TA 3ZVEA 1QIXB 2ZDVH 5EW1H 2GDEH 2ZIQH 3KQBA 3RXMA 4CRFA 1QFKH 1MBMA 1FN8A 1O37A 3RUOA 2C4FH 2PTNA 3MMGA 1O2JA 5FX6A 2ZO3H 5I25A 1V2ST 2V3OH 1WU1A 4X8TH 1SLXB 2BLWA 2Y82A 1EASA 4AFSA 1NRQH 2OINA 4HI3A 2Q6DA 4FUGA 3P8NA 1ZMJA 1QQ4A 2BDBA 1TIOA 5GDSH 1CT0E 2EI6A 1C2IA 1T8NA 2ZGJA 3RMLH 5AF9H 3ZZ4A 1C5VA 1DANH 4K2YA 1PQ8A 5DP4A 2BY9X 5TCAA 3GCHC 4UDWH 2BYAX 1IQGA 3S7HB 2VH6A 1GBIA 3ZVFA 2OBQA 1GBKA 4THNH 1SQAA 2H2ZA 1FJSA 4X2VA 2P8OB 4MDSA 3TJNA 3FANA 3AVZA 1MZDA 1F0TA 2W3IA 1P2NA 1C1TA 1WQVH 1CGHA 3SJIA 3RXJA 3F9EA 2F3CE 3DFLA 1SBWA 1PQ7A 3A81A 1CBWB 1QA0A 4YM9A 1NRSH 1O5GH 1QRXA 3VFEA 3ZZ6A 2R3YA 3GCTG 2A4OA 1ABJH 2B8OH 1W14U 4F4OC 4E06H 3S9BA 1UMAH 1LVMA 1C5MD 4XBDA 2ZDNA 2BXUH 3UQOA 4INKA 3Q3KA 2OUAA 1BA8B 1GMDF 1QTFA 1S5SA 1C1UH 2VIWA 3M3VA 3RM0H 3UR9A 4BNRA 1FXYA 1EPTA 4WVPE 4SGBE 3OX7U 1NU9A 1ZSLA 3BTTE 3H5CB 1LKAA 3RU4T 4YESB 5C20A 1YCPK 3KCGH 3GY7A 4O9VA 5EQSA 4DW2U 5GIBA 4BAKB 7GCHF 1FLEE 1BTYA 2BX3A 1GBFA 3MOCA 1YPEH 3TLOA 1NESE 1FONA 1DWEH 2QV1A 4MNYA 1T7CA 2BY6X 2Y7ZA 3NUMA 1NRRH 3I78A 3GCHB 1SVPA 1MBQA 2KAIA 1PPEE 1UTQA 2VJ1A 3JZ2B 2ZTYA 1GI5A 1MTWA 1THRH 2ZQ2A 3V12A 2ZU4A 1RXPA 3ESTA 5JB9S 3MU4A 8GCHF 1GJ8B 1MU6B 2BHGA 2STBE 2WINI 5ESTE 1GJ6A 5DO4H 5GXPA 3PLBA 1ZGVA 3R3GB 1SOTA 4Q7XA 5TCCA 2ZWLH 4DOQA 5C5NA 5JYIA 3O8CA 9ESTA 1CA0C 2GX4A 4E7NA 1EKBB 1HYLA 1P05A 1ZMNA 4AB9A 1H1BA 3MH5A 2HPQH 4BANB 1B0EA 1LHCH 4OGYA 3ZZDA 3A86A 2BLOA 1XUJA 2D1JA 1OWJA 1QR3E 3SUDA 4X2YA 1GMCG 1A4WH 1AUJA 4DCDA 1GI7B 3S9AA 1TQ0B 1YPGH 4YT6H 3E0NB 3QUMP 2F9NA 1GI3A 4Y10E 5CE1A 1Z1JA 1GHYH 2VVVA 1C5QA 2R2WU 3KHVA 4H6TA 1HAXB 1BBRE 1LQEA 4ISNA 3SZNA 1TX7A 1DE7H 3M3SA 3HGPA 4OS5A 4TY7A 5K7RA 2R0LA 2ULLA 3LJJA 2Z9LA 2YNBA 2G8TA 4WY3A 3ZVBA 1WTGH 3LGVA 4ISLA 1WOFA 4D7FA 1GI1A 2BMGB 3UR6A 1A3EH 2Y5GA 5GCHF 4O97A 1A46H 2P3UB 4JYVH 3M5MA 1ZPBA 2VIDA 3A82A 2BD3A 5A8ZA 2FOGA 2AMQA 3P92A 1UK2A 3SJ8A 1P9SA 2PGBB 2ANYA 3U8RH 1H9IE 3A7WA 2C8WB 5J4SA 2FXRA 2ZPSA 2RG3A 1HAPH 3TK9A 4A7IB 2BM2A 1KIGH 5A2MH 1TABE 3LC5A 3G01A 3ZZ7A 2ZFTA 1AGJA 2EI7A 3A85A 1AZ8A 2D2DA 3VB7A 1BHXF 3PM3A 3SU1A 4VGCC 4NWKA 2FO9A 1DLKB 4I33A 3VGCC 1C4U2 2M5TA 3FP8E 4ASHA 1C4V2 1P04A 2B9LA 1E37B 3RC4A 3MU5A 1EP5A 3L33A 1FPCH 1F5LA 3UUZA 1OWIA 3MH4A 2G52A 3SJOA 1GI9B 4JZ1A 1O2QA 2QIQA 2DE8A 3MU8A 1EP6A 2FM2A 4B73A 1G32B 4I8KA 2FI5E 1TPPA 3AW1A 4DURA 4AN7A 4INHA 1AIXH 3RM2H 2ANMH 5F8TA 3ZZ9A 1V6DA 1MUEB 2OP9A 1RTLA 3M61U 1SQOA 5DKMA 1W7GH 2BD5A 4KKDA 3TPIZ 3ZZ5A 1MTSA 2AGEX 2Z94A 1O2LA 3NWUA 5E2PA 1FN6A 1IQLA 1TNHA 1ZHPA 1SI5H 1N6YA 1TX6A 1SB1H 1AFEH 1SFQB 3BEFB 4XSKU 2BDCA 1BJUA 1GHBF 4RSPA 1O5DH 1SGNE 3O8DA 1OWHA 2XBYA 1GVLA 1P10A 4TYDA 4A1VA 3F9GA 1PPHE 1QB6A 2ZPQA 1JRTA 3HKJB 1ZSJA 4DIIH 2P95A 5JBAS 4XBCA 1MKWK 2PSXA 2G5VA 5T6DA 3LGWA 1GG6B 2OD3B 2XC4A 2Z7FE 2ODPA 2AGGX 2GD4B 1UTNA 1CT4E 4CBNA 1LVOA 1O30A 3B9FH 2P3FH 1HJ9A 5CMXH 4VGCB 5HM2A 2C3SA 1O33A 3HK6B 3UOPA 7LPRA 2VH0A 5FAHA 1QL8A 4X2XA 1ESTA 3SQEE 1ETSH 1GCTB 1HDTH 1NRPH 2QXIA 1BQYA 2OQUA 1DWCH 4FUIA 1S0RA 1MTUA 4JZIA 1G3EA 1NZQH 3E1XB 1W3CA 2QC2A 4BXWA 3OU0A 3E6PH 1GVKB 3A7XA 1JWTA 2XC0A 1LPGB 2NU0E 1TOMH 2GZ8A 1LPKB 1HLTH 2AMPA 1Y3UA 1ETTH 1EJAA 2GGVB 4MPWA 1P02A 1F92A 1G2LA 3MO6A 1P12E 5AFYH 1CHOF 1SOZA 3GDSA 1SGFA 2TGTA 1ORFA 1ZGIA 2HPPH 1FY5A 3HPTB 1BTHH 2H5DA 5F8XA 1NPMA 5EXNA 1P2OA 1ELDE 2A32A 1P09A 3MU0A 3EQ0H 3M36A 2QXJA 1TNKA 2CF9H 1EPTC 3STJA 1GJ9B 1KXAA 1B7XB 4IW4E 4GVUA 1DVAH 1LHEH 4AFUA 2QY0B 3A84A 4A1TA 1SGQE 5EXLA 4WH8A 4GUXA 3RXTA 1SR5C 3E91A 1A5IA 2NWNA 1XUHA 2JETC 1QBNA 1GHAG 1TGSZ 1UCYK 1TBRH 2HGTH 1XM1A 1C1NA 1DWBH 1NT1A 5LPRA 1AB9B 3IITA 1O3KA 3KNXA 1O2PA 1UHBB 2QXHA 2VVCA 3UTUH 3GY4A 3LGTA 2SGEE 4CR5A 2HALA 1MU8B 3L3TA 1QB9A 4K3JA 1RGQA 3U8OH 2BY5X 2FDAA 3O8RA 1Y5UT 2TRMA 1XUGA 1HV7A 5EODA 1IQEA 1J14A 4IBLH 4ZROA 1BTXA 2ASUB 4Y8YA 1DT2A 4M7GA 1BCUH 4JCNA 2IOTA 1J17T 1CGJE 1LTOA 3EA9A 2CHAC 3A88A 2V35A 4JMYA 1G3CA 2LNCA 3GY8A 3C1KA 5C5OA 1VZQH 1AE8H 5FPYA 1OWEA 3MTYA 1T31A 5FBIA 1ZJKA 2CF8H 3S7KB 1XX9A 2FP7B 1SLVB 3UWIA 1JIMA 2TIOA 1V2LT 3VB4A 2ANKH 3ATIA 4X1NU 3A83A 2P16A 1T8LA 1MTNC 1MMJN 1YGCH 3HK3B 4U01A 3RMNH 3UQVA 1K1PA 3FVFB 3TIUA 3H7OA 1YYY1 3GDVA 3RXKA 1FY4A 2F83A 2PWXA 1O35A 2JETB 2PW8H 4X8VH 1INCA 4HFPB 3A80A 1MQ6A 1GBMA 1TBQH 3ZZ3A 1W10U 1AO5A 1EQ9A 1TGBA 1V2WT 3GY2A 1ESBA 3QK1A 5TJXA 1K1NA 4FUHA 4MG3A 3BV9B 5IYTA 1GJ5H 1UTKA 1PPCE 3RXPA 1HIAB 2FMJA 3ATMA 2BDHA 2BDYA 1V3XA 4Y8ZA 1MKWH 1J16A 1OWKA 2GZ9A 6LPRA 3GY5A 2CHAB 1NS3A 1YPJH 3SNAA 2W7UA 2AGIX 1KXBA 2NU3E 5JPMH 1VGCB 2GCTB 1ZOMA 4HTCH 3GCNA 1XVMA 4FUDA 1AD8H 2WYJA 3GY6A 1ZTKA 2UUYA 2FZZA 4KTUA 2XTTB 1TGCA 1FY1A 1PPGE 4CBOA 1LQDB 3OTJE 4Z6AH 3EDXB 3RU4D 1O34A 1QQUA 4B2CA 1DPOA 1MTNB 1XXFA 2OBOA 3URCA 5L6NH 1H8DH 3PMAB 3TK5A 1V2VT 5AVDA 4MNXA 2A7JA 3RXVA 3M7QA 1O2SA 2BX4A 4A1XA 1RJXB 2Z3DA 1A7SA 2Z9GA 3PMBB 1ELGA 1QJ1B 1QJ6B 4X1QU 2ZG0H 3UOUA 2XCFA 4ABHA 3CS7A 1C2GA 1FNIA 3JZ1B 4DGJA 3PWCA 5L2ZH 1EB1H 3BG4C 3PV4A 2GMTC 2ZTZA 2BY7X 2FOHA 3E3TA 1RFNA 2QYIA 1OP0A 2VB0A 2WUCA 1Z6EA 2C93B 1GJCB 2ZHWH 2C8XB 2YNAA 3TH4H 1V2NT 5EPYA 1L0ZA 3PMHB 4ABDA 1FDPA 3MI4A 4X0WU 2FYQA 1JMOH 4GCHG 3SV9A 2A7HA 3KEEA 4U32A 1IQNA 2Y80A 4MVNA 1MTVA 1BBRK 1EAXA 2ZEBA 2C8ZB 3OSYA 1DSUA 2ALPA 3AAVA 3LJOA 4E05H 1VITF 3CENA 1C2KA 1QJ7B 4A5TS 1UHBA 1ZRKA 1UCYH 1ZTJA 3ZYDA 1TAWA 1HAOH 1HUTH 1HJ8A 2ZKSA 3A8CA 1A61H 4YLQH 1O2XA 4ZH8A 5L2YH 4CH2B 2PKSB 1M9UA 3FAOA 4K8YA 1A1RA 2C8YB 4ZMAH 2ZDMA 1EZUC 1OKXA 2AS9A 2ZGHA 1GHXH 2Z9KA 2O8WA 1EJMA 2FOEA 8ESTE 1D6RA 1WYKA 2VVUA 2AERH 4NZQA 1DY8A 2F91A 3GYLB 3GICB 3BTDE 4ZKRU 1P2QA 1GI8B 1SL3A 2GCHG 1G9IE 2ALVA 2G51A 2TGPZ 2ZFQH 3Q3XA 3MNSA 1EZSC 1MCTA 1T32A 3BG4B 3PYHA 5F8ZA 1Z8RA 1ZPZA 2GMTB 1TRMA 1NN6A 3VXEH 1ELBA 2XNIA 1YCPM 3SN8A 2QGRA 2R2MB 3RXSA 1LDTT 1O2YA 2ZNKH 1DLEA 1C1WH 4B75A 1Y3YA 3NPSA 3V13A 2TGAA 3PROA 1BB0B 1K1JA 1O5FH 2RDLA 2W7SA 4WWYA 2ZTXA 1DY9A 1QL9A 1KXCA 3F9HA 1S0QA 1BZXE 2SFAA 2A5KA 2GKVE 1O36A 2BLVA 2F9BH 4ISIH 5JB8S 2BTCE 3SV8A 1AY6H 2OC1A 1THPB 3TK6A 4GAWA 3T62A 1ID5H 1IQIA 1N6XA 3BTEE 1LHFH 4IN2A 5GJ4B 1T4VH 3ZV8A 1L1GA 4OS2A 4X8UH 5LH8A 1C5LH 3DT0H 3T26A 4NG9H 1GHZA 1ACBE 3BTGE 3VEQB 3E16B 1HIAA 3VB6A 3SV7A 4R0IA 4A6LA 5GWZA 1C2JA 1J15A 3MO3A 1NFUA 1H9HE 4BXSA 1AQ7A 4JYUH 1EZXC 2I6QA 1WV7H 4X2WA 3IG6B 2RA0A 3M5OA 3NZIA 4WJG2 1SGEE 5IDKA 1WAYB 3BEUA 1FIWA 2B0FA 4H4FA 3M37A 3PTNA 4AFZA 2BDAA 3QZQA 4B2AA 6ESTA 1EXFA 3MFJA 4RKJB 2W26A 1TNJA 1GMHF 4D9RA 1YPMH 1GGDB 1QB1A 1O3IA 2WPIS 4NSYA 1O31A 1ANEA 4NIWA 4AYYB 1P2MA 1TQ7B 1GJAB 5E0HA 5J4QA 4LOYH 1NU7B 4ZXYH 2VINA 5C3NA 1SGCA 1C5NH 1K28D 1E34B 2ZGXH 3OYPA 3SGBE 2XBVA 5LPEA 3M3TA 5FX5A 3A7ZA 6CHAC 2A4RA 3VPKA 1DXWA 1P2KA 2XYAA 1P01A 5ETXA 4AZ2B 1CU1A 2ZCKP 2LPRA 2A5IA 3UWJH 4DY7B 5DP7A 3LGYA 1TPOA 2VIOA 2RA3A 1W8BH 4CRDA 3U1JB 2ZHFH 4MLFB 2CN0H 3QTVH 1D3TB 2HRVA 1CE5A 1CHGA 4Y76A 1HBTH 4DG4A 1GJ7B 5JBBS 1A5GH 2YOLA 3A7TA 1SG8B 1GG6C 1C1VH 4AG2A 1W0YH 2ZZUH 3T29A 3D65E 3ZVCA 1O3DA 3GOVB 1QHRB 2JH0D 1BTZA 3U98H 1S82A 4BAHB 1FMGA 3SU0A 1IQKA 2UUKB 3HGNA 2BVRH 2UUJB 3RXFA 2G00A 3ODFA 1O5EH 5E8EH 2ZC9H 6GCHG 1T4UH 3SNBA 5FXLA 1JRSA 1NFYA 1GCTC 4K1TA 4O03A 4GHQA 5EXMA 1BBRH 1DX5M 5FHTA 2O8UA 2UWLA 2HNTC 1UVOA 1XKBC 4K5ZA 3ZZ8A 2GZ7A 3URDA 5GPIB 1C2EA 3SV2H 1ANBA 5DJ7A 1V2RT 1K1MA 1QGFA 1UO6A 2FWWA 4FUBA 2FIRH 4JZEH 5T6GA 3RLWH 3E8LA 3E90B 4NA7A 3SO3A 1DFPA 2PR3A 2SGQE 1THSH 1O5BB 1YP9A 4ZAEA 1O2GH 4IC6A 6CHAB 1QA7A 1C1OA 3QX5H 4ZKNU 1FI8A 1EJNA 2ZECA 4MPUA 2R3UA 3BTQE 2BD8A 2D8WA 1Q2WA 4H6SB 1S6HA 1GBHA 1O3BA 2FOBA 1FZZA 2BVSH 2H9HA 1C5UA 4ISOA 3LDXH 5T3HA 2VIVA 1P57B 1O2RA 1BDAA 1SGTA 4BAMB 1AVGH 2XW9A 3ELAH 2SNVA 1HAVB 4AGKA 2ZCHP 1TRYA 5AFZH 1VR1H 1ZLRA 4DJZB 3BTFE 1O3CA 3PLPA 3MNBA 4UE7H 3D49H 4K8BA 1C9TA 2WV5A 1OS8A 3BG8A 3QWCH 2HVXA 1HAZB 1RIWC 3LPRA 2ODYB 3WY8A 4FU9A 3P6ZB 1YCPH 3TNSA 3UREA 4ZKOU 3SJKA 2UWOA 3U8TH 1LMWB 1AB9C 1TYNA 3UNRA 1IQJA 1UK3A 3HKIB 1ELTA 2V6NA 5H4IB 1TONA 2GV6A 1BTPA 1X7AC 4TWYA 3GCTF 2VU8E 2XC5A 3V3MA 1DSTA 1A0JA 2Y5HA 4NA9H 3SUGA 2VGCC 3S9CA 4DIHH 1C1QA 1KYNA 2H9TH 4WMEA 1AKSA 4ABFA 1TNLA 2SGAA 4NGAH 1C1SA 1EAWA 1GI6A 4KGAA 1YLDA 3SGAE 3QTOH 1JIRA 2O9QA 4JZDH 1BTUA 1HPGA 1OYQA 1S83A 1B5GH 2J92A 3NXPA 4YOIA 2Z3CA 3UPEA 1HXEH 3SW2B 4ABEA 2V0BA 1BUIA 3M5NA 1EAUA 1Z8JB 2H1UA 1YPKH 5C1YA 1MH0A 2ESTE 4OS1A 1Z71A 2BDGA 1UTMA 3RXEA 1E36B 1OXGA 1C4Y2 1Z6JH 1SFIA 2PFEA 4UONA 4ISHH 3D23A 4WF8A 3U69H 1P03A 1K2I1 1GI4A 2ZI2H 2XBWA 4HGCA 1MKXK 5L30H 3ODDA 1C5XB 2Z9IA 3IWMA 1RS0A 5BPEA 1CVWH 1FAXA 1GHVH 3A87A 1ZMLA 4NFFA 2VWOA 1O0DH 1O5AB 1HAGE 1ELVA 1XUIA 5FPTA 1ANCA 2DE9A
chains in the Genus database with same CATH superfamily
1RIWB 2VWMA 2V7QD 4X1SU 2AIQA 1TA6A 3ZVGA 4BTUB 2Q6GA 4Y6DA 2XWAA 5FCKA 1QRZA 7ESTE 2ZHQH 3EGKH 2A4QA 2I6SA 3A8DA 4R8TB 5C1UA 1FV9A 3TJVA 1P06A 2EI8A 1PFXC 2V3HH 4WXVA 2KFWA 3KYGA 1GMDG 1GJ4H 2VGCB 3L6PA 1IQFA 3M7TA 1C5YB 1F2SE 2BDIA 4ASUD 3AASA 2WPDD 5T6FA 5T1VA 3SQHE 3P95A 1F5RA 1K22H 3ZZAA 3SUFA 3W94A 1PPZA 1PPBH 2OXSA 1VKYA 7GCHG 1ZHRA 4Z0KA 3BTWE 1O2MA 3LKWA 2DUCA 1Y3XA 1V2PT 2KCPA 1C1PA 2J34A 2R0KA 1QL7A 1LO6A 3ENSB 1L4ZA 1W7XH 1V2QT 2F9PA 1VGCC 2GCTC 2ZU5A 4X1PU 1EUFA 3RP2A 3RU4E 3A89A 2OLGA 4XE4A 2QA9E 4RI0A 3KQEA 4CRBA 2Q1JA 3RXBA 4Y0ZE 1RTFB 2SNWA 1NO9H 4YO9A 3B8JA 3C27B 1C2DA 2PLXA 8GCHG 2QF3A 4X6OA 2P94A 2EEKA 2BXTH 1DUEA 1XUFA 1SGIB 3RXGA 1O3FA 3PB1E 4LXBH 1S84A 1TPAE 1YBWA 1O2WA 1TNIA 2KM0A 3TJOA 1A5HA 1OP2A 3BIVH 3LH3A 4Q2KA 5KGOA 2TPIZ 3MQKC 4KTCA 4FVBA 2FEQH 1WDIA 2Y81A 5DG6A 1G2MA 2WV4A 2C90B 1O2UA 2XRCA 4X6PA 1GBCA 5AHGH 2A0QB 4GSOA 5HYOA 1HFDA 4K60A 4AGJA 4TY6A 2Z9JA 3SU5A 1Z7KA 4BTTB 1BRCE 1XVOA 3GISB 3RXQA 3RMOH 2FOAA 3BN9A 2XXLA 3KIDU 1GBJA 3KYFA 3LONA 4MPVA 1CO7E 1IQHA 1QBVH 3AAUA 1HAVA 3EA8A 4CR9A 4FOUC 1EB2A 8LPRA 2LP6A 2BLQA 2RCEA 1O2IA 2QCYA 5FBEA 4ABJA 1YF4A 3Q3YA 3MNCA 3MH6A 3TH2H 4CH8B 3T28A 2O8MA 5JBCS 1C2MA 3K9XB 1WXRA 2SGPE 4ABIA 2FESH 1TMBH 2FS8A 3T27A 1YPLH 1L1JA 5E2OA 1OOKB 1VCPA 5C67A 4ZHMU 4B76A 1V2MT 2QN5T 4UFFH 1O3EA 1P9UA 2XWBI 4AORA 2NU4E 2FI3E 1P0SH 3VB5A 3VB3A 5GCHG 1ESAA 1A2CH 1DS2E 5FL7D 5EGMA 4ZHAA 1ELFA 4RKOB 1PQ5A 2PKSC 4B2BA 1WSSH 5LGOA 1C5PA 1DWDH 1Y59T 4GHTA 3BIUH 2FI4E 1FY3A 5DK1A 3V7TA 1P8VC 1D6WA 1ZSKA 1D3DB 2WZQA 1N1LA 3LOXA 2RDEA 4SGAE 1SQTA 2JKHA 1ZYOA 5HXFA 2J94A 1ARBA 2NU1E 2B7DH 2BZ6H 1O2HA 1OX1A 1GBEA 1GDNA 2FLRH 1D3QB 4BTIB 4OGXA 4JK6A 2P59A 3WWFA 2A5AA 5ABWA 4IMZA 2WUBA 1P3CA 3ZZBA 1NROH 2PTCE 3S69A 3TNTA 2ZHEH 1O2TA 3F9FA 3SNCA 1KXFA 1O3MA 1PQAA 1S6FA 5EQQA 4MTBA 1ZJDA 1O3LA 1BMMH 2CV3A 1SKYE 5DP3A 4AG1A 3BF6H 3LT3A 2ZCLP 3GDUA 1AU8A 5G4BA 3U1IB 3MO9A 1TB6H 4HG6A 2AYWA 1MKXH 2WYGA 3I29A 1ZR0A 5JBTA 2A2QH 3SU4A 5LPFA 1PPFE 4YT7H 2OCVB 4D9QA 1D9IA 4AOQA 3PWBA 3SHAH 3E0PB 4NIXA 1O3OA 4ZKSU 2YMSC 4O3TA 4JK5A 1LVYA 1K1IA 1BJVA 2H6MA 4ACAA 1O3PB 1UTPA 2A7CA 3RDZA 3M5LA 3QN7A 2QAAA 4I31A 5C1XA 5EJLA 4E7RG 1G3DA 4CRAA 1Y3WA 1WQSA 1AWHB 3SU2A 1GHBG 4XDEA 1AFQC 2OTVA 3ZV9A 2THFB 1U6QA 3FZZA 1MAXA 4YOGA 5A0CA 2FPZA 3RXAA 2ZU1A 4J2YB 1MZAA 1AVWA 4BAOB 3PV5A 4NCYA 4D76A 1E38B 2ZDAH 2IN2A 1GJDB 1O32A 2AMDA 1BT7A 2AEIH 2ZGBH 2ILNA 3MYWA 4INLA 1C5ZB 1HAHH 4O3UA 5F53A 4HZHA 3ITIA 1G36A 1GBAA 1QBOA 2CMYA 1O3NA 1QCPA 1EZQA 3F1SB 1GHAF 1BIOA 3UY9A 1BMAA 1GGDC 2VWNA 4JZFH 1W13U 2J9NA 3SNEA 8KME2 2ZHDA 3F68H 2UWPA 2BOKA 4NA8A 5A0AE 5K0HA 2FOFA 2G55A 4MQAA 1S85A 3U28C 2Z3EA 5DGJA 4F49A 1GHWH 1AUTC 1VITH 1VCWA 3T5FH 1G3BA 1P2IA 2FOCA 1C5OH 1SLWB 1GJBB 1Q31A 2YMSB 4UD9H 1KDQA 3ATWA 3BEIB 5I46H 1O2KA 1CHOG 4B6EA 1VJ9U 1WTHD 2FX4A 4U2WA 1S81A 4BAQB 1DUAA 1EOLA 1G30B 4I86A 5BRRE 3MNXA 1F0RA 1L2EA 2UUFB 5EPNA 1P2JA 1LPZB 4A92A 3DA9B 4UFGH 3K2UA 1AFQB 2ZF0H 1AKSB 3KN2A 1TPSA 2FX6A 1FQ3A 2PGQB 1FPHH 1DXPA 2BQ6B 1QY6A 2J38A 1NC6A 3KL6A 3EE7A 2CJIA 3SHCH 1O38A 2ANWA 1SQRA 1NM6A 2PV9B 3EA7A 1A0LA 4WXIA 1O5CB 2JH6D 1MD8A 1AHTH 2GT7A 1AE5A 4LZ4B 3DCLA 4CHAC 3MWIU 4FUCA 2GT8A 1RTKA 4J1YA 1C2FA 3A7VA 2ZFRH 3PRBA 4UFDH 1HJAC 2YMSD 5EG4A 2PUQH 3FP7E 1HNEE 4WMFA 3UNQA 3SV6A 2ZFSA 1BOQA 2F9OA 3OTPA 1GDQA 2P3TB 1O2OA 3R0FA 2TBSA 1ZZZA 1A3BH 4D8NA 3ZYEA 3QDZB 1MAYA 3GYMA 5E0JA 3EE0B 2WPMS 4B71A 9LPRA 3UIRA 1C9PA 2O8LA 1G37A 1D4PB 1PYTC 2PKAA 3RXOA 1SGYE 1KY9A 3MHWU 1IAUA 5EU8A 3LH1A 1E1QD 3SI4H 3P8OA 1C1MA 3FZDA 4OS4A 1FX0B 2OC0A 1EAIA 1SGDE 4XFQA 3ZVAA 1GPZA 3LGIA 3LC3A 1SMFE 5JDUB 3SUEA 2QF0A 4I8GA 1IHSH 2J98B 1GI0A 3KQDA 2BD7A 1TGTA 4NIYA 1GWAA 1TX8A 2A45B 2FTMA 5CHAC 1AVXA 4FUFA 1YM0A 2BD2A 3RMMH 2W5EA 3D62A 2VIQA 3QO6A 4ABGA 3OY5U 3SNDA 2V3MA 1JBUH 3PRDA 5A09A 5SGAE 2PUXB 5EW2H 1N8OC 1YKTA 4XOJA 4CHAB 5CDFE 5DP6A 1P11E 1KLTA 2J4IA 3SI3H 3FFGA 3RXIA 3P8FA 2AH4X 4Q7ZA 1XMNB 1IQMA 4GPGA 3RC6A 1HJAB 1CA0B 3GY3A 2A1DB 1GVZA 2G4TA 1T8OA 1XUKA 2A31A 1H4WA 1LCYA 3K6YA 1F5KU 4Y0YE 3F6UH 1UVUH 2SGDE 1B0FA 1FAKH 3QLPH 4X6MA 4ZXXH 2GV7A 1S6LA 3K6ZA 1HAYB 2HOBA 4NIVA 1KTSB 2L6OA 1LHGH 1GL0E 4NWLA 3ATKA 3SORA 3BTME 3NKKA 2XNDD 3PLKA 3TVJB 3I77A 3TGIE 3H7TA 5EOKA 3NCLA 4X1RU 4KELA 1BITA 1MD7A 1GDUA 5A8XA 2ZQ1A 2AIPA 1TNGA 1SHHB 3F3BA 3CNRA 1TMUH 3STIA 4YXWD 1ZPCA 3SBKA 2A4GA 2H9EH 4WMDA 1H8HD 3CS0A 2ZFFH 1QNJA 3T25A 4GCHF 1BHXB 2HNTF 2OK5A 3VXFH 2HNTE 2FYRA 2ZDKA 3FKSD 5C2ZA 1K9OE 5E0GA 3LIWA 4NFEA 1HGTH 1OPHB 2BQ7B 4AC9A 1W0ZU 2VWLA 4TPIZ 4KP0A 5CHAB 4CREA 3RXUA 3DUXH 2XCNA 1MCVA 5HM9A 1Y8TA 4MNWA 2ODQA 5FPSA 3RXLA 3ZVDA 1TA2A 3AW0A 2PSYA 1BMNH 2F9VA 3RXDA 7KMEH 4JYTA 1N8OB 4D7GA 1MQ5A 5C94A 1A0HB 5DSFA 2PHBA 1K1OA 2KZ4A 1YLCA 2EA3A 1GCDA 3PMJA 3PTBA 1O3HA 2FODA 1UTJA 1E35B 1UTOA 1NY22 2ZFPH 3T2NA 4OS7A 3W95A 1ELCA 1SC8U 4AB8A 4Q80A 4TSFD 1PYTD 1TRNA 1RD3B 2ZA5A 3PO1C 3MU1A 1V2TT 1O3GA 3TJUA 3UNSA 3VGCB 1AI8H 1BTWA 2GCHF 1SLUB 1C5RA 1Y3VA 1HAIH 1C2LA 1TFXA 3TGJE 3SU6A 1MABB 1WBGB 3OY6U 2BY8X 1AN1E 5HMAA 4TWWA 1Y5BT 1CSOE 3S0NA 1FY8E 2WPHS 3WW7A 3M35A 1HB0B 1UJ1A 4ZHLU 5PTPA 1SPJA 3MH7A 1CA8B 3BTKE 4IS5A 2OC7A 3SU3A 1TBZH 1VITG 1KXEA 1UVPA 2ZDLA 3QGNB 5DPAA 4I8JA 4Y7AA 1F7ZA 1GBLA 3V0XA 1XKAC 2VIPA 4FU7A 4UFEH 2HLCA 2BD9A 2VNTA 5FCRA 3TH3H 1KLIH 4KTSA 4DT7B 5A8YA 2Y5FA 2R9PA 2O8TA 1YPHC 3DHKH 3ZIAD 3EYDA 2BOHB 4OS6A 2D26C 1ARCA 3F2HA 1CGIE 2GVFA 2W3KA 4AFQA 2Z6BD 3RXHA 4I32A 2ZPRA 1OSSA 3CP7A 3RXCA 1DDJA 4CRCA 4YTAA 1NRNH 4QT8C 2J95A 1IHTH 1ZRBA 3K65B 4U30A 2CGAA 5F03A 2OC8A 2CK3D 1J9CH 3DD2H 1Y5AT 2WPLS 1CT2E 4GLYA 3F2GA 5B6OA 5C17A 1O39A 4LZ1H 1FIZA 5HGGA 4DVAU 2HVYB 1KTTB 1SGPE 3NK8A 3UFAA 3PO1B 3BTHE 2OQ5A 2Y6TA 4H42U 1KSNA 4I7YH 2QXGA 4Y8XA 1AWFH 4AYVB 4XBBA 1V2JT 2J98A 4Y79A 1W2KH 1YPHE 3SZEA 2ZU2A 1EATA 1ETRH 1D3PB 3LU9B 1GMCF 1NTPA 2B5TB 1HRTH 1Q3XA 1O3AA 2ZGCA 3KQCA 1O3JA 1QURH 1UK4A 1C1RA 1XXDA 1SGFG 2KCAA 4Y11E 4YOJA 1W11U 4PROA 4WH6A 1P3EA 1VJAU 1C2HA 1H8IH 1JOUB 1WCZA 4Y7BA 4TT3D 1C5SA 1L1NA 4X6NA 1L4DA 1C5WB 1KXDA 1IOEA 1J8AA 1BRBE 1UVSH 2BZAA 4K69A 3TU7H 1O2ZA 3FP6E 3GCOA 5C0UA 3B23B 1F0SA 2IPHA 4YZUA 1BRUP 1GI2A 1PJPA 2SGFE 1Z1IA 1SSXA 1DITH 1ZHMA 1Z8GA 1JXPA 4FU8A 4K1SA 1TE0A 3TITA 1E0FD 2NU2E 1TGNA 5DP5A 5IK2D 4UEHH 3P70B 4ABBA 4RN6A 1HCGA 3KF2A 1RRKA 1KDQB 2BQWB 4RT1A 2Y7XA 1EPTB 1SGRE 2QE7D 1TWXB 4FVDA 4YLUA 2HWLB 1TLDA 4CRGA 4B74A 2Q6FA 1V2OT 2FTLE 4ZUHA 3FOAA 5EJ1A 5A0BA 2P93A 3O8BA 1BMLA 1GMHG 3QGJA 1TMTH 1QZ8A 1V2UT 4BOHA 4LK4A 3P17H 3SGQE 2ZU3A 3TGKE 4MPXA 4ACBA 1GBTA 1OWDA 2EC9H 3SJ9A 3ZZCA 2GTBA 4AX9H 4I8LA 2AFQB 4NSVA 1TALA 5F6MA 1W12U 6GCHF 3RXRA 1O2NA 3HATH 4FUEA 2KAIB 1TOCB 4XD7D 3LGUA 1UTLM 1LVBA 2FS9A 2F9UA 3ATLA 3F0OA 1NFWA 4Z1MD 1AZZA 2XBXA 1GL1A 1CQQA 2EY4C 2WPJS 1DM4B 4IMQA 3Q76A 4NZLA 1FUJA 2IJOB 3DFJA 3QZRA 5ESBA 3N7OA 4FXGH 2BD4A 3BSQA 1ELEE 1ELAA 2H5CA 3A7YA 5KECA 2J5UA 1ANDA 4ESTE 1DICA 2JH5D 1F0UA 3A8AA 4TPYA 1VCQA 5EQRA 1UVTH 2BB4A 1BRAA 1NFXA 2GP9B 4I8HA 2GDDA 1GBBA 4Q7YA 1V2KT 2WPKS 3OAAD 3A8BA 4IGDA 1SHYA 1T8MA 1KLJH 2ZP0H 1QRWA 4B1TA 1K21H 1LHDH 1ABIH 1DOJA 1Z8IB 3EAJA 1ZTLA 1HXFH 4K1EA 4Y71A 4IN1A 1K1LA 2PKAB 1WUNH 1EOJA 4ABAA 2P8OC 3KGPA 2FOMB 2G5NA 3SOSA 4X8SH 1OP8A 2K1QA 5DP8A 2G81E 2KR7A 3RC5A 1H9LB 3Q77A 1O2VA 2J2UA 1GBDA 1UCYE 2TGDA 2BVXH 2LELA 1YC0A 4IC5A 1OYTH 1CBWC 4MNVA 3P8GA 4FUJA 3Q00A 3RLYH 2G4UA 3U9AH 2CXVA 2FLBH 1AMHA 2STAE 5DP9A 1EX3A 2A2XH 1LKBA 3M7UA 1C5TA 3ZVEA 1QIXB 2ZDVH 5EW1H 2GDEH 2ZIQH 3KQBA 3RXMA 4CRFA 2K0QA 1EFRD 1QFKH 1MBMA 1FN8A 1O37A 3RUOA 2C4FH 2PTNA 3MMGA 1O2JA 5FX6A 2ZO3H 5I25A 1V2ST 2V3OH 1WU1A 4X8TH 1SLXB 2BLWA 2Y82A 1EASA 4AFSA 1NRQH 2OINA 2IPQX 3OFND 4HI3A 2Q6DA 4FUGA 3P8NA 1ZMJA 1QQ4A 2BDBA 1TIOA 5GDSH 1CT0E 2EI6A 1C2IA 1T8NA 2ZGJA 3RMLH 5AF9H 3ZZ4A 1C5VA 1DANH 4K2YA 1PQ8A 5DP4A 4ZCNA 2BY9X 5TCAA 3GCHC 4UDWH 2BYAX 1IQGA 3S7HB 2VH6A 1GBIA 3ZVFA 1KMHB 2OBQA 1GBKA 4THNH 1SQAA 2H2ZA 1FJSA 4X2VA 2P8OB 4MDSA 3TJNA 3FANA 3AVZA 1MZDA 1F0TA 2WHXA 2W3IA 1P2NA 1C1TA 1WQVH 1CGHA 3SJIA 4P00A 3RXJA 3F9EA 2F3CE 3DFLA 1SBWA 1PQ7A 3A81A 4M9FA 1CBWB 1QA0A 4YM9A 1NRSH 1O5GH 1QRXA 3VFEA 3ZZ6A 2R3YA 3GCTG 2W6JD 2A4OA 1ABJH 3N7DA 2B8OH 1W14U 4F4OC 4E06H 3S9BA 1UMAH 1LVMA 1C5MD 4XBDA 2ZDNA 2BXUH 3UQOA 4INKA 3Q3KA 2OUAA 1BA8B 1GMDF 1QTFA 1S5SA 1C1UH 2VIWA 3M3VA 3RM0H 3UR9A 4BNRA 2IJD1 1FXYA 1EPTA 4WVPE 4SGBE 3OX7U 1NU9A 1ZSLA 3BTTE 3H5CB 1LKAA 3RU4T 4YESB 5C20A 1YCPK 3KCGH 3GY7A 4O9VA 5EQSA 4DW2U 5GIBA 4BAKB 7GCHF 1FLEE 1BTYA 2BX3A 5HIYA 2AHME 1GBFA 3DSOA 4F55A 3H09A 3MOCA 1YPEH 3TLOA 1NESE 1FONA 1DWEH 2QV1A 4MNYA 1T7CA 2BY6X 2Y7ZA 3NUMA 1NRRH 3I78A 3GCHB 1SVPA 3SYJA 1MBQA 2KAIA 1PPEE 1UTQA 2VJ1A 3JZ2B 2ZTYA 1GI5A 1MTWA 1THRH 2ZQ2A 3V12A 2ZU4A 1RXPA 3ESTA 5JB9S 3MU4A 8GCHF 1GJ8B 1MU6B 2BHGA 2STBE 2WINI 5ESTE 1GJ6A 5DO4H 5GXPA 3PLBA 1ZGVA 3R3GB 1SOTA 4Q7XA 5TCCA 2ZWLH 4DOQA 5C5NA 5JYIA 3O8CA 9ESTA 1CA0C 2GX4A 4E7NA 1EKBB 1HYLA 3WWBA 1P05A 1ZMNA 4AB9A 1H1BA 3MH5A 2HPQH 4BANB 1B0EA 1LHCH 4OGYA 3ZZDA 3A86A 2BLOA 1XUJA 2D1JA 1OWJA 1QR3E 3SUDA 4X2YA 1GMCG 1A4WH 1AUJA 4DCDA 1GI7B 3S9AA 1W0KD 1TQ0B 1YPGH 4YT6H 3E0NB 3QUMP 2F9NA 1GI3A 4Y10E 5CE1A 1Z1JA 1GHYH 2VVVA 1C5QA 2R2WU 3KHVA 4H6TA 1HAXB 1BBRE 1LQEA 4ISNA 3SZNA 1TX7A 1DE7H 3M3SA 3HGPA 4OS5A 4TY7A 5K7RA 2R0LA 2ULLA 3LJJA 2Z9LA 2YNBA 2G8TA 4WY3A 3ZVBA 1WTGH 3LGVA 4ISLA 1WOFA 4D7FA 1GI1A 2BMGB 3UR6A 1A3EH 2Y5GA 5GCHF 4O97A 1A46H 2P3UB 4JYVH 3M5MA 1ZPBA 2VIDA 3A82A 2BD3A 5A8ZA 5HKKD 2FOGA 2AMQA 4DT4A 3P92A 1UK2A 3SJ8A 1E1RD 1P9SA 2PGBB 2ANYA 3U8RH 1H9IE 3A7WA 2C8WB 2JJ1D 5J4SA 2FXRA 2ZPSA 2RG3A 1HAPH 3TK9A 4A7IB 2BM2A 1KIGH 5A2MH 1TABE 3LC5A 3G01A 3ZZ7A 2ZFTA 1AGJA 2EI7A 3A85A 1AZ8A 2D2DA 3VB7A 1BHXF 3PM3A 3SU1A 4VGCC 4NWKA 2FO9A 1DLKB 4I33A 3VGCC 1C4U2 2M5TA 3FP8E 4ASHA 1C4V2 1P04A 1BMFD 2B9LA 1E37B 3RC4A 3MU5A 1EP5A 3L33A 1FPCH 1F5LA 3UUZA 1OWIA 3MH4A 2G52A 3SJOA 1GI9B 4JZ1A 1O2QA 2QIQA 2DE8A 3MU8A 1EP6A 2FM2A 4B73A 5GNDA 1G32B 4I8KA 2FI5E 1TPPA 3AW1A 4DURA 4AN7A 4INHA 1AIXH 3RM2H 2ANMH 5F8TA 3ZZ9A 1V6DA 1MUEB 2OP9A 1RTLA 3M61U 1SQOA 5DKMA 1W7GH 2BD5A 4KKDA 3TPIZ 3ZZ5A 3GS9A 1MTSA 2AGEX 2Z94A 1O2LA 3NWUA 5E2PA 2WV9A 1FN6A 1IQLA 1TNHA 1ZHPA 1SI5H 1N6YA 1TX6A 1SB1H 1AFEH 1SFQB 3BEFB 4XSKU 2BDCA 1BJUA 1GHBF 4RSPA 1O5DH 1SGNE 3O8DA 1OWHA 2XBYA 1GVLA 1P10A 4TYDA 4A1VA 3F9GA 1YY3A 1PPHE 1QB6A 2ZPQA 1JRTA 3HKJB 1ZSJA 4DIIH 2P95A 5JBAS 4XBCA 1MKWK 2PSXA 2G5VA 1COWD 3LGWA 5T6DA 1GG6B 2OD3B 2XC4A 2Z7FE 2ODPA 2AGGX 2GD4B 1UTNA 1CT4E 4CBNA 2WSSD 1LVOA 1O30A 3B9FH 2P3FH 1HJ9A 5CMXH 4VGCB 5HM2A 2C3SA 5B6LA 1O33A 3HK6B 3UOPA 7LPRA 2VH0A 5FAHA 1QL8A 4X2XA 1ESTA 3SQEE 1ETSH 1GCTB 1HDTH 1NRPH 2QXIA 1BQYA 2OQUA 1DWCH 4FUIA 1S0RA 1MTUA 4JZIA 1NBME 1G3EA 1NZQH 3E1XB 1W3CA 2QC2A 4BXWA 3OU0A 3E6PH 1GVKB 3A7XA 1JWTA 2XC0A 1LPGB 1TOMH 2GZ8A 2NU0E 1LPKB 1HLTH 2JJ2D 2AMPA 1Y3UA 1ETTH 1E79D 1EJAA 5HIZA 2GGVB 4MPWA 1P02A 1F92A 1G2LA 3MO6A 1P12E 5AFYH 1CHOF 1SOZA 3GDSA 3FN8A 1SGFA 2TGTA 1ORFA 1ZGIA 2HPPH 1FY5A 3HPTB 1BTHH 2H5DA 5F8XA 1NPMA 5EXNA 1P2OA 1ELDE 2A32A 5C0TA 1P09A 3MU0A 3EQ0H 3M36A 2QXJA 1TNKA 2CF9H 1EPTC 3STJA 1GJ9B 1KXAA 1B7XB 4IW4E 4GVUA 1DVAH 1LHEH 4AFUA 2QY0B 3A84A 4A1TA 1SGQE 5EXLA 4WH8A 4GUXA 3VG8A 3RXTA 1SR5C 3E91A 1A5IA 2NWNA 1XUHA 2JETC 1QBNA 1GHAG 1TGSZ 1UCYK 1TBRH 2HGTH 1XM1A 1C1NA 1DWBH 1NT1A 5LPRA 1AB9B 3IITA 1O3KA 3KNXA 1O2PA 1UHBB 2QF5A 2QXHA 2VVCA 3UTUH 3GY4A 4XRNA 3LGTA 2SGEE 4CR5A 2HALA 1MU8B 3L3TA 1QB9A 4K3JA 1RGQA 3U8OH 2BY5X 2FDAA 3O8RA 1Y5UT 2TRMA 1XUGA 1HV7A 1NBMD 5EODA 1IQEA 1J14A 4IBLH 4ZROA 1BTXA 2ASUB 4Y8YA 1DT2A 4M7GA 1BCUH 4JCNA 2IOTA 1J17T 1CGJE 1LTOA 3EA9A 2CHAC 3A88A 2V35A 4JMYA 1G3CA 2LNCA 3GY8A 3C1KA 5C5OA 1VZQH 1AE8H 5FPYA 1OWEA 3AK5A 3MTYA 1T31A 1W0JD 5FBIA 1ZJKA 2CF8H 3S7KB 1XX9A 2FP7B 1SLVB 3UWIA 1JIMA 2TIOA 1V2LT 3VB4A 2ANKH 3ATIA 4X1NU 3A83A 2P16A 1T8LA 1MTNC 1MMJN 1YGCH 3HK3B 4U01A 3RMNH 3UQVA 1K1PA 5DN6D 3FVFB 3TIUA 3H7OA 1YYY1 3GDVA 3RXKA 1FY4A 2F83A 2PWXA 1O35A 2JETB 2PW8H 4X8VH 1INCA 4HFPB 3A80A 1OHHD 1MQ6A 3DSPA 1GBMA 1TBQH 3ZZ3A 1W10U 1AO5A 1EQ9A 2J97A 1TGBA 1V2WT 3GY2A 1ESBA 3QK1A 5TJXA 1K1NA 4FUHA 4MG3A 3BV9B 5IYTA 1GJ5H 1UTKA 1PPCE 3RXPA 5EJZA 1HIAB 2FMJA 3ATMA 2BDHA 2BDYA 1V3XA 4Y8ZA 3UAIC 2EQNA 1MKWH 1J16A 1OWKA 2GZ9A 6LPRA 3GY5A 2CHAB 1NS3A 1YPJH 3SNAA 2W7UA 2AGIX 1KXBA 2NU3E 5JPMH 1VGCB 2GCTB 1ZOMA 4HTCH 3GCNA 1XVMA 4FUDA 1AD8H 2WYJA 3GY6A 1ZTKA 2UUYA 2FZZA 4KTUA 2XTTB 1TGCA 3OE7D 2W6ID 1FY1A 1PPGE 4CBOA 1LQDB 3F0PA 3OTJE 1UW7A 4Z6AH 3EDXB 3RU4D 1O34A 1QQUA 4B2CA 1DPOA 1MTNB 1XXFA 2OBOA 3URCA 5L6NH 1H8DH 3PMAB 3TK5A 1V2VT 5AVDA 3FO8D 4MNXA 2A7JA 3RXVA 3M7QA 1O2SA 2BX4A 4A1XA 1RJXB 2Z3DA 1A7SA 2Z9GA 3PMBB 1ELGA 1QJ1B 1QJ6B 4X1QU 2ZG0H 3UOUA 2XCFA 4ABHA 3CS7A 1C2GA 1FNIA 3JZ1B 4DGJA 3PWCA 5L2ZH 2F4LA 1EB1H 3BG4C 3PV4A 2GMTC 2ZTZA 2BY7X 2FOHA 3E3TA 1RFNA 2QYIA 1OP0A 2VB0A 2WUCA 1Z6EA 2C93B 1GJCB 2ZHWH 2C8XB 2YNAA 3TH4H 4OM9A 1V2NT 5EPYA 1L0ZA 3PMHB 4ABDA 1FDPA 3MI4A 4X0WU 2FYQA 1JMOH 4GCHG 3SV9A 2A7HA 3KEEA 4U32A 1IQNA 2Y80A 4MVNA 1MTVA 1BBRK 1EAXA 4FETA 5KEDA 2ZEBA 2C8ZB 3OSYA 1DSUA 2ALPA 3AAVA 3LJOA 4E05H 1VITF 3CENA 1C2KA 1QJ7B 4A5TS 1UHBA 1ZRKA 1UCYH 1ZTJA 3ZYDA 1TAWA 1HAOH 1HUTH 1HJ8A 2ZKSA 3A8CA 3N7EA 1A61H 4YLQH 1O2XA 4B6FA 4ZH8A 5L2YH 4CH2B 2PKSB 1M9UA 3FAOA 4K8YA 1A1RA 4F48B 2C8YB 4ZMAH 2ZDMA 1EZUC 1OKXA 2AS9A 2ZGHA 1GHXH 2Z9KA 2O8WA 1EJMA 2FOEA 8ESTE 1D6RA 1WYKA 2VVUA 2AERH 4NZQA 3KQ5A 1DY8A 2F91A 3GYLB 3GICB 3BTDE 4ZKRU 1P2QA 4Q63A 1GI8B 1SL3A 2GCHG 1G9IE 2ALVA 2G51A 2GJGA 2TGPZ 2ZFQH 1YWUA 3Q3XA 3MNSA 1EZSC 1MCTA 1T32A 3BG4B 3PYHA 5F8ZA 3F2FA 1Z8RA 1ZPZA 2GMTB 1TRMA 1NN6A 3VXEH 1ELBA 2XNIA 1YCPM 3SN8A 2QGRA 2R2MB 3RXSA 1K0HA 1LDTT 1O2YA 4Q4LA 2KCOA 2ZNKH 1DLEA 1C1WH 4B75A 1Y3YA 3NPSA 3V13A 2TGAA 3PROA 1BB0B 1K1JA 1O5FH 2RDLA 2W7SA 4WWYA 2ZTXA 1DY9A 1QL9A 1KXCA 3F9HA 1S0QA 1BZXE 2M2AA 2SFAA 2A5KA 2GKVE 1O36A 2BLVA 2F9BH 4ISIH 5JB8S 2BTCE 3SV8A 1AY6H 2JDID 2OC1A 1THPB 3TK6A 4GAWA 3T62A 1ID5H 1IQIA 1N6XA 3BTEE 1LHFH 4IN2A 5GJ4B 1T4VH 3ZV8A 1L1GA 4OS2A 4X8UH 5LH8A 1C5LH 3W1EA 3DT0H 3T26A 4NG9H 1GHZA 1ACBE 3BTGE 3VEQB 3E16B 1HIAA 3VB6A 3UB0A 3SV7A 4R0IA 4A6LA 5GWZA 1C2JA 1J15A 3MO3A 1NFUA 1H9HE 4BXSA 1AQ7A 4JYUH 2JIZD 1EZXC 2I6QA 1WV7H 4X2WA 3IG6B 2RA0A 3M5OA 3NZIA 4WJG2 1SGEE 5IDKA 1WAYB 3BEUA 1FIWA 2B0FA 4H4FA 3M37A 3PTNA 3PV2A 4AFZA 4RT0A 2BDAA 3QZQA 4B2AA 6ESTA 1EXFA 3MFJA 4RKJB 2W26A 1TNJA 1GMHF 4D9RA 1YPMH 1GGDB 1QB1A 1O3IA 2WPIS 4NSYA 1O31A 1ANEA 4NIWA 4AYYB 1P2MA 2L74A 1TQ7B 1GJAB 5E0HA 5J4QA 2K8IA 4LOYH 1NU7B 4ZXYH 2VINA 5C3NA 1SGCA 1C5NH 1K28D 1E34B 2ZGXH 2F43B 3OYPA 3SGBE 2XBVA 5LPEA 3M3TA 5FX5A 3A7ZA 6CHAC 2A4RA 3VPKA 1DXWA 1P2KA 1H8ED 2XYAA 1P01A 5ETXA 4AZ2B 1CU1A 2ZCKP 2LPRA 2A5IA 3UWJH 4DY7B 5DP7A 3LGYA 1TPOA 2VIOA 2RA3A 2XOKD 1W8BH 4CRDA 3U1JB 2ZHFH 4MLFB 2CN0H 3QTVH 1D3TB 2HRVA 1CE5A 1CHGA 4Y76A 1HBTH 3OEED 4DG4A 1GJ7B 5JBBS 1A5GH 2YOLA 3A7TA 1SG8B 1GG6C 1C1VH 4AG2A 1W0YH 2ZZUH 3T29A 3D65E 3ZVCA 1O3DA 3GOVB 1QHRB 2JH0D 1BTZA 3U98H 1S82A 4BAHB 1FMGA 3SU0A 1IQKA 2UUKB 3HGNA 2BVRH 2UUJB 3RXFA 2G00A 3ODFA 1O5EH 5E8EH 2ZC9H 3N99A 6GCHG 1T4UH 3SNBA 5FXLA 1JRSA 1NFYA 1GCTC 4K1TA 4O03A 4GHQA 5EXMA 1BBRH 1YLNA 1DX5M 5FHTA 2O8UA 2UWLA 2HNTC 1UVOA 1XKBC 4K5ZA 2KCYA 3ZZ8A 2GZ7A 3URDA 5GPIB 1C2EA 3SV2H 1ANBA 5DJ7A 1V2RT 1K1MA 1QGFA 1UO6A 2FWWA 4FUBA 2FIRH 4JZEH 5T6GA 3RLWH 3E8LA 3E90B 4NA7A 3SO3A 1DFPA 2PR3A 2SGQE 1THSH 1O5BB 1YP9A 4ZAEA 1O2GH 4IC6A 6CHAB 1QA7A 1C1OA 3QX5H 4ZKNU 1FI8A 1EJNA 2ZECA 4MPUA 2R3UA 3DSGA 3BTQE 2BD8A 2D8WA 1Q2WA 4H6SB 1S6HA 1GBHA 1O3BA 2FOBA 1FZZA 2BVSH 2H9HA 1C5UA 4ISOA 3LDXH 5T3HA 2VIVA 2VBCA 1P57B 1O2RA 1BDAA 1SGTA 4BAMB 1AVGH 2XW9A 3ELAH 2SNVA 1HAVB 4AGKA 2ZCHP 1TRYA 5AFZH 1VR1H 1ZLRA 4DJZB 3BTFE 1O3CA 3PLPA 3MNBA 4UE7H 3D49H 4K8BA 1C9TA 2WV5A 1OS8A 3BG8A 3QWCH 2HVXA 1HAZB 1RIWC 3LPRA 2ODYB 3WY8A 4FU9A 3P6ZB 1YCPH 3TNSA 3UREA 4ZKOU 3SJKA 2UWOA 3U8TH 1LMWB 2RFKC 1AB9C 1TYNA 3UNRA 1IQJA 1UK3A 3HKIB 1ELTA 2V6NA 5H4IB 1TONA 2GV6A 1BTPA 5EIYA 1X7AC 2PP6A 3GCTF 2VU8E 2XC5A 4TWYA 3V3MA 1DSTA 1A0JA 2Y5HA 4NA9H 3SUGA 2VGCC 3S9CA 4DIHH 1C1QA 1KYNA 2H9TH 3OEHD 4WMEA 1AKSA 4ABFA 5CHBA 1TNLA 2SGAA 4NGAH 1C1SA 1EAWA 1GI6A 4KGAA 1YLDA 3NRLA 3SGAE 3QTOH 1JIRA 2O9QA 4JZDH 2J92A 1BTUA 1HPGA 1OYQA 1B5GH 1S83A 3NXPA 4YOIA 2QF4A 2Z3CA 3UPEA 1HXEH 3SW2B 4ABEA 2V0BA 1BUIA 3M5NA 1EAUA 1Z8JB 2H1UA 1YPKH 5C1YA 1MH0A 2ESTE 4OS1A 1Z71A 2BDGA 1UTMA 3RXEA 1E36B 1OXGA 1C4Y2 1Z6JH 1SFIA 2PFEA 4P02A 4UONA 4ISHH 3D23A 4WF8A 3U69H 1P03A 1K2I1 1GI4A 2ZI2H 2XBWA 4HGCA 1MKXK 5L30H 3ODDA 1C5XB 2Z9IA 3IWMA 1RS0A 5BPEA 1CVWH 2KX4A 1FAXA 1GHVH 3A87A 1ZMLA 4NFFA 2VWOA 1O0DH 1O5AB 2HLDD 1HAGE 1ELVA 1XUIA 5FPTA 1ANCA 2DE9A
chains in the Genus database with same CATH topology
1RIWB 2VWMA 4X1SU 2AIQA 1TA6A 3ZVGA 4BTUB 2Q6GA 4Y6DA 2XWAA 5FCKA 1QRZA 7ESTE 2ZHQH 3EGKH 2A4QA 2I6SA 3A8DA 4R8TB 5C1UA 1FV9A 3TJVA 1P06A 2EI8A 1PFXC 2V3HH 4WXVA 1GMDG 1GJ4H 2VGCB 3L6PA 1IQFA 3M7TA 1C5YB 1F2SE 2BDIA 3AASA 5T6FA 3SQHE 3P95A 1F5RA 1K22H 3ZZAA 3SUFA 3W94A 1PPZA 1PPBH 2OXSA 7GCHG 1ZHRA 4Z0KA 3BTWE 1O2MA 3LKWA 2DUCA 1Y3XA 1V2PT 1C1PA 2J34A 2R0KA 1QL7A 1LO6A 3ENSB 1L4ZA 1W7XH 1V2QT 2F9PA 1VGCC 2GCTC 2ZU5A 4X1PU 1EUFA 3RP2A 3RU4E 3A89A 2OLGA 4XE4A 2QA9E 3KQEA 4CRBA 2Q1JA 3RXBA 4Y0ZE 1RTFB 2SNWA 1NO9H 4YO9A 3B8JA 3C27B 1C2DA 2PLXA 8GCHG 2QF3A 4X6OA 2P94A 2EEKA 2BXTH 1DUEA 1XUFA 1SGIB 3RXGA 1O3FA 3PB1E 4LXBH 1S84A 1TPAE 1YBWA 1O2WA 1TNIA 3TJOA 1A5HA 1OP2A 3BIVH 3LH3A 4Q2KA 2TPIZ 4KTCA 4FVBA 2FEQH 2Y81A 5DG6A 1G2MA 2WV4A 2C90B 1O2UA 2XRCA 4X6PA 1GBCA 5AHGH 2A0QB 4GSOA 5HYOA 1HFDA 4K60A 4AGJA 4TY6A 2Z9JA 3SU5A 1Z7KA 4BTTB 1BRCE 1XVOA 3GISB 3RXQA 3RMOH 2FOAA 3BN9A 2XXLA 3KIDU 1GBJA 3LONA 4MPVA 1CO7E 1IQHA 1QBVH 3AAUA 1HAVA 3EA8A 4CR9A 1EB2A 8LPRA 2BLQA 2RCEA 1O2IA 2QCYA 5FBEA 4ABJA 1YF4A 3Q3YA 3MNCA 3MH6A 3TH2H 4CH8B 3T28A 2O8MA 5JBCS 1C2MA 3K9XB 2SGPE 4ABIA 2FESH 1TMBH 2FS8A 3T27A 1YPLH 1L1JA 5E2OA 1OOKB 1VCPA 5C67A 4ZHMU 4B76A 1V2MT 2QN5T 4UFFH 1O3EA 1P9UA 2XWBI 4AORA 2NU4E 2FI3E 1P0SH 3VB5A 3VB3A 5GCHG 1ESAA 1A2CH 1DS2E 5EGMA 4ZHAA 1ELFA 4RKOB 1PQ5A 2PKSC 4B2BA 1WSSH 5LGOA 1C5PA 1DWDH 1Y59T 4GHTA 3BIUH 2FI4E 1FY3A 5DK1A 3V7TA 1P8VC 1D6WA 1ZSKA 1D3DB 1N1LA 3LOXA 4SGAE 1SQTA 2JKHA 1ZYOA 5HXFA 2J94A 1ARBA 2NU1E 2B7DH 2BZ6H 1O2HA 1OX1A 1GBEA 1GDNA 2FLRH 1D3QB 4BTIB 4OGXA 4JK6A 2P59A 2A5AA 5ABWA 4IMZA 2WUBA 1P3CA 3ZZBA 1NROH 2PTCE 3S69A 3TNTA 2ZHEH 1O2TA 3F9FA 3SNCA 1KXFA 1O3MA 1PQAA 1S6FA 5EQQA 4MTBA 1ZJDA 1O3LA 1BMMH 2CV3A 5DP3A 4AG1A 3BF6H 3LT3A 2ZCLP 3GDUA 1AU8A 5G4BA 3U1IB 3MO9A 1TB6H 2AYWA 1MKXH 2WYGA 3I29A 1ZR0A 5JBTA 2A2QH 3SU4A 5LPFA 1PPFE 4YT7H 2OCVB 4D9QA 1D9IA 4AOQA 3PWBA 3SHAH 3E0PB 4NIXA 1O3OA 4ZKSU 4O3TA 4JK5A 1LVYA 1K1IA 1BJVA 2H6MA 1O3PB 1UTPA 2A7CA 3RDZA 3M5LA 3QN7A 2QAAA 4I31A 5C1XA 4E7RG 1G3DA 4CRAA 1Y3WA 1WQSA 1AWHB 3SU2A 1GHBG 4XDEA 1AFQC 2OTVA 3ZV9A 2THFB 1U6QA 3FZZA 1MAXA 4YOGA 5A0CA 2FPZA 3RXAA 2ZU1A 4J2YB 1MZAA 1AVWA 4BAOB 4NCYA 4D76A 1E38B 2ZDAH 2IN2A 1GJDB 1O32A 2AMDA 1BT7A 2AEIH 2ZGBH 2ILNA 3MYWA 4INLA 1C5ZB 1HAHH 4O3UA 4HZHA 3ITIA 1G36A 1GBAA 1QBOA 2CMYA 1O3NA 1QCPA 1EZQA 3F1SB 1GHAF 1BIOA 3UY9A 1BMAA 1GGDC 2VWNA 4JZFH 1W13U 2J9NA 3SNEA 8KME2 2ZHDA 3F68H 2UWPA 2BOKA 4NA8A 5A0AE 5K0HA 2FOFA 2G55A 4MQAA 1S85A 2Z3EA 5DGJA 4F49A 1GHWH 1AUTC 1VITH 1VCWA 3T5FH 1G3BA 1P2IA 2FOCA 1C5OH 1SLWB 1GJBB 1Q31A 4UD9H 1KDQA 3ATWA 3BEIB 5I46H 1O2KA 1CHOG 1VJ9U 1WTHD 2FX4A 4U2WA 1S81A 4BAQB 1DUAA 1EOLA 1G30B 5BRRE 3MNXA 1F0RA 1L2EA 2UUFB 5EPNA 1P2JA 1LPZB 4A92A 3DA9B 4UFGH 3K2UA 1AFQB 2ZF0H 1AKSB 3KN2A 1TPSA 2PGQB 1FQ3A 2FX6A 1FPHH 1DXPA 2BQ6B 1QY6A 2J38A 1NC6A 3KL6A 2CJIA 3SHCH 1O38A 2ANWA 2PV9B 1NM6A 3EA7A 1A0LA 4WXIA 1O5CB 2JH6D 1MD8A 1AHTH 2GT7A 1AE5A 4LZ4B 4CHAC 3MWIU 4FUCA 2GT8A 1RTKA 4J1YA 1C2FA 3A7VA 2ZFRH 4UFDH 1HJAC 5EG4A 2PUQH 3FP7E 1HNEE 4WMFA 3UNQA 3SV6A 2ZFSA 1BOQA 2F9OA 1GDQA 2P3TB 1O2OA 3R0FA 2TBSA 1ZZZA 1A3BH 4D8NA 3ZYEA 3QDZB 1MAYA 3GYMA 5E0JA 3EE0B 2WPMS 4B71A 9LPRA 3UIRA 1C9PA 2O8LA 1G37A 1D4PB 1PYTC 2PKAA 3RXOA 1SGYE 1KY9A 3MHWU 1IAUA 5EU8A 3LH1A 3SI4H 3P8OA 1C1MA 3FZDA 4OS4A 2OC0A 1EAIA 1SGDE 4XFQA 3ZVAA 1GPZA 3LGIA 3LC3A 1SMFE 5JDUB 3SUEA 2QF0A 4I8GA 1IHSH 1GI0A 3KQDA 2BD7A 1TGTA 4NIYA 1GWAA 1TX8A 2A45B 2FTMA 5CHAC 1AVXA 4FUFA 1YM0A 2BD2A 3RMMH 2W5EA 3D62A 2VIQA 3QO6A 4ABGA 3OY5U 3SNDA 1JBUH 5A09A 5SGAE 2PUXB 5EW2H 1N8OC 1YKTA 4XOJA 4CHAB 5DP6A 1P11E 1KLTA 2J4IA 3SI3H 3FFGA 3RXIA 3P8FA 2AH4X 4Q7ZA 1XMNB 1IQMA 4GPGA 3RC6A 1HJAB 1CA0B 3GY3A 2A1DB 1GVZA 2G4TA 1T8OA 1XUKA 2A31A 1H4WA 1LCYA 3K6YA 1F5KU 4Y0YE 3F6UH 1UVUH 2SGDE 1B0FA 1FAKH 3QLPH 4X6MA 4ZXXH 2GV7A 3K6ZA 1HAYB 2HOBA 4NIVA 1KTSB 1LHGH 1GL0E 4NWLA 3ATKA 3SORA 3BTME 3NKKA 3PLKA 3TVJB 3I77A 3TGIE 3H7TA 5EOKA 3NCLA 4X1RU 4KELA 1BITA 1MD7A 1GDUA 5A8XA 2ZQ1A 2AIPA 1TNGA 1SHHB 1TMUH 3STIA 1ZPCA 3SBKA 2A4GA 2H9EH 4WMDA 3CS0A 2ZFFH 1QNJA 3T25A 4GCHF 1BHXB 2HNTF 3VXFH 2HNTE 2FYRA 2ZDKA 5C2ZA 1K9OE 5E0GA 3LIWA 4NFEA 1HGTH 1OPHB 2BQ7B 1W0ZU 2VWLA 4TPIZ 4KP0A 5CHAB 4CREA 3RXUA 3DUXH 2XCNA 1MCVA 5HM9A 1Y8TA 4MNWA 2ODQA 5FPSA 3RXLA 3ZVDA 1TA2A 3AW0A 2PSYA 1BMNH 2F9VA 3RXDA 7KMEH 4JYTA 1N8OB 4D7GA 1MQ5A 1A0HB 2PHBA 1K1OA 1YLCA 2EA3A 1GCDA 3PMJA 3PTBA 1O3HA 2FODA 1UTJA 1E35B 1UTOA 1NY22 2ZFPH 3T2NA 4OS7A 3W95A 1ELCA 1SC8U 4AB8A 4Q80A 1PYTD 1TRNA 1RD3B 2ZA5A 3PO1C 3MU1A 1V2TT 1O3GA 3TJUA 3UNSA 3VGCB 1AI8H 1BTWA 2GCHF 1SLUB 1C5RA 1Y3VA 1HAIH 1C2LA 1TFXA 3TGJE 3SU6A 1WBGB 3OY6U 2BY8X 1AN1E 5HMAA 4TWWA 1Y5BT 1CSOE 3S0NA 1FY8E 2WPHS 3M35A 1HB0B 1UJ1A 4ZHLU 5PTPA 1SPJA 3MH7A 1CA8B 3BTKE 4IS5A 2OC7A 3SU3A 1TBZH 1VITG 1KXEA 1UVPA 2ZDLA 3QGNB 5DPAA 4I8JA 4Y7AA 1F7ZA 1GBLA 3V0XA 1XKAC 2VIPA 4FU7A 4UFEH 2HLCA 2BD9A 2VNTA 5FCRA 3TH3H 1KLIH 4KTSA 4DT7B 5A8YA 2Y5FA 2R9PA 2O8TA 1YPHC 3DHKH 3EYDA 2BOHB 4OS6A 2D26C 1ARCA 1CGIE 2GVFA 2W3KA 4AFQA 2Z6BD 3RXHA 4I32A 2ZPRA 1OSSA 3CP7A 3RXCA 1DDJA 4CRCA 4YTAA 1NRNH 4QT8C 2J95A 1IHTH 1ZRBA 3K65B 4U30A 2CGAA 5F03A 2OC8A 1J9CH 3DD2H 1Y5AT 2WPLS 1CT2E 4GLYA 5B6OA 1O39A 4LZ1H 1FIZA 5HGGA 4DVAU 1KTTB 1SGPE 3NK8A 3UFAA 3PO1B 3BTHE 2OQ5A 2Y6TA 4H42U 1KSNA 4I7YH 2QXGA 4Y8XA 1AWFH 4AYVB 4XBBA 1V2JT 4Y79A 1W2KH 1YPHE 2ZU2A 1EATA 1ETRH 1D3PB 3LU9B 1GMCF 1NTPA 2B5TB 1HRTH 1Q3XA 1O3AA 2ZGCA 3KQCA 1O3JA 1QURH 1UK4A 1C1RA 1XXDA 1SGFG 4Y11E 4YOJA 1W11U 4PROA 4WH6A 1P3EA 1VJAU 1C2HA 1H8IH 1JOUB 1WCZA 4Y7BA 1C5SA 1L1NA 4X6NA 1L4DA 1C5WB 1KXDA 1IOEA 1J8AA 1BRBE 1UVSH 2BZAA 4K69A 3TU7H 1O2ZA 3FP6E 3GCOA 3B23B 1F0SA 2IPHA 4YZUA 1BRUP 1GI2A 1PJPA 2SGFE 1Z1IA 1SSXA 1DITH 1ZHMA 1Z8GA 1JXPA 4FU8A 4K1SA 1TE0A 3TITA 1E0FD 2NU2E 1TGNA 5DP5A 4UEHH 3P70B 4ABBA 4RN6A 1HCGA 3KF2A 1RRKA 1KDQB 2BQWB 2Y7XA 1EPTB 1SGRE 1TWXB 4FVDA 4YLUA 2HWLB 1TLDA 4CRGA 4B74A 2Q6FA 1V2OT 2FTLE 4ZUHA 5A0BA 2P93A 3O8BA 1BMLA 1GMHG 3QGJA 1TMTH 1V2UT 4BOHA 4LK4A 3P17H 3SGQE 2ZU3A 3TGKE 4MPXA 1GBTA 1OWDA 2EC9H 3SJ9A 3ZZCA 2GTBA 4AX9H 4I8LA 2AFQB 4NSVA 1TALA 5F6MA 1W12U 6GCHF 3RXRA 1O2NA 3HATH 4FUEA 2KAIB 1TOCB 3LGUA 1UTLM 1LVBA 2FS9A 2F9UA 3ATLA 1NFWA 1AZZA 2XBXA 1GL1A 1CQQA 2WPJS 1DM4B 4IMQA 3Q76A 4NZLA 1FUJA 2IJOB 3DFJA 3QZRA 5ESBA 3N7OA 4FXGH 2BD4A 3BSQA 1ELEE 1ELAA 2H5CA 3A7YA 1ANDA 4ESTE 1DICA 2JH5D 1F0UA 3A8AA 4TPYA 1VCQA 5EQRA 1UVTH 2BB4A 1BRAA 1NFXA 2GP9B 4I8HA 2GDDA 1GBBA 4Q7YA 1V2KT 2WPKS 3A8BA 4IGDA 1SHYA 1T8MA 1KLJH 2ZP0H 1QRWA 4B1TA 1K21H 1LHDH 1ABIH 1DOJA 1Z8IB 3EAJA 1ZTLA 1HXFH 4K1EA 4Y71A 4IN1A 1K1LA 2PKAB 1WUNH 1EOJA 4ABAA 2P8OC 3KGPA 2FOMB 2G5NA 3SOSA 4X8SH 1OP8A 2K1QA 5DP8A 2G81E 3RC5A 1H9LB 3Q77A 1O2VA 2J2UA 1GBDA 1UCYE 2TGDA 2BVXH 1YC0A 4IC5A 1OYTH 1CBWC 4MNVA 3P8GA 4FUJA 3Q00A 3RLYH 2G4UA 3U9AH 2CXVA 2FLBH 1AMHA 2STAE 5DP9A 1EX3A 2A2XH 1LKBA 3M7UA 1C5TA 3ZVEA 1QIXB 2ZDVH 5EW1H 2GDEH 2ZIQH 3KQBA 3RXMA 4CRFA 1QFKH 1MBMA 1FN8A 1O37A 3RUOA 2C4FH 2PTNA 3MMGA 1O2JA 5FX6A 2ZO3H 5I25A 1V2ST 2V3OH 1WU1A 4X8TH 1SLXB 2BLWA 2Y82A 1EASA 4AFSA 1NRQH 2OINA 4HI3A 2Q6DA 4FUGA 3P8NA 1ZMJA 1QQ4A 2BDBA 1TIOA 5GDSH 1CT0E 2EI6A 1C2IA 1T8NA 2ZGJA 3RMLH 5AF9H 3ZZ4A 1C5VA 1DANH 4K2YA 1PQ8A 5DP4A 2BY9X 5TCAA 3GCHC 4UDWH 2BYAX 1IQGA 3S7HB 2VH6A 1GBIA 3ZVFA 2OBQA 1GBKA 4THNH 1SQAA 2H2ZA 1FJSA 4X2VA 2P8OB 4MDSA 3TJNA 3FANA 3AVZA 1MZDA 1F0TA 2W3IA 1P2NA 1C1TA 1WQVH 1CGHA 3SJIA 3RXJA 3F9EA 2F3CE 3DFLA 1SBWA 1PQ7A 3A81A 1CBWB 1QA0A 4YM9A 1NRSH 1O5GH 1QRXA 3VFEA 3ZZ6A 2R3YA 3GCTG 2A4OA 1ABJH 2B8OH 1W14U 4F4OC 4E06H 3S9BA 1UMAH 1LVMA 1C5MD 4XBDA 2ZDNA 2BXUH 3UQOA 4INKA 3Q3KA 2OUAA 1BA8B 1GMDF 1QTFA 1S5SA 1C1UH 2VIWA 3M3VA 3RM0H 3UR9A 4BNRA 1FXYA 1EPTA 4WVPE 4SGBE 3OX7U 1NU9A 1ZSLA 3BTTE 3H5CB 1LKAA 3RU4T 4YESB 5C20A 1YCPK 3KCGH 3GY7A 4O9VA 5EQSA 4DW2U 5GIBA 4BAKB 7GCHF 1FLEE 1BTYA 2BX3A 1GBFA 3MOCA 1YPEH 3TLOA 1NESE 1FONA 1DWEH 2QV1A 4MNYA 1T7CA 2BY6X 2Y7ZA 3NUMA 1NRRH 3I78A 3GCHB <