1BI7B

Mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'EPSADWLATAAARGRVEEVRALLEAGANPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (kinase/anti-oncogene)
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bi7B00
3EU9A 4GMRA 2JABA 4HI8A 2P2CP 3TWWA 3TWXA 4ZHBA 3J5PA 1DC2A 3NBNB 4DX1A 1BLXB 4K5AB 4G8LA 4HLLA 1TR4A 3AJIA 2MYOA 4HB5A 3V2OA 5BXUA 2F37A 4OAVB 2DZNA 5AAOA 4BEPA 1K3ZD 1IHBA 1UOHA 2XZTG 3NOCD 4BESA 2L6BA 2F8XK 2DWZA 5CBNA 2V4HC 5EYLA 5AN8A 5CECB 4ATZD 1WDYA 5ENTD 2XEEA 2KBXA 2RFMA 3JXJA 4CZ2D 1MX4A 4U8YD 4HRNA 3J5QB 1BI8B 3TWTA 3JUEA 3W9GA 1AP7A 5AQAA 2PNNA 3ZUVB 4Z68A 5JA4D 4DX2A 2ZGGA 4BETA 3B7BA 4U8VD 3SO8A 4K5CA 1MX6A 3B95A 5ENRD 3DEPA 3LJNA 4GPMA 3TWVA 3C5RA 3EHQA 2DZOA 1DCQA 2ETBA 2AJAA 4DUIA 2J8SD 5ENQD 4LNUD 4QFVA 4DX5D 3W9FA 5FINA 5KNGA 2Y0BG 4K5BA 1BU9A 3DEOA 3KEAA 3T8KA 2KXPC 2HE0A 1QYMA 3D9HA 3HRAA 2A5EA 2BKKB 4DRXE 5BXOA 2XENA 3IXEA 1D9SA 5EYPF 3Q9NC 5FIOA 1AWCB 1K1BA 5CERB 2B0OE 4U95D 4N5QA 1YMPA 2VGEA 4HRMB 5ENOD 4LSZE 5ITZF 1IKND 3AAAC 4JB8P 4TUMA 4CYMD 2FO1E 4U96D 4C48B 2V5QC 1K1AA 1N11A 1OT8A 1WG0A 2XZDG 4O1PA 4O1OA 3T9KA 3ZU7B 4F6RD 5CBOA 1IXVA 3TWUA 3V2XA 5HRYA 1NFIE 4DX6D 1G3NB 5D66A 5EN5D 4DX7D 5CEAA 2NYJA 4YDWA 4A63B 4G8KA 4J8YA 3ZNGA 3EHRA 3JXIA 5KBAA 4UUCA 4YDYA 4J7WA 3F6QA 5HS0A 2QC9A 2RFAA 2ETCA 5EILA 4NIKA 5CEDB 1BD8A 1SW6A 4QQIA 4O60A 4F1PA 4BSZB 2BKGA 3Q9UC 4HBDA 1SVXA 1BI7B 4OAUC 3TWRA 5AARA 5EIBE 4LG6A 1OY3D 4RLYA 5ENSD 1YYHA 5ENPD 4HRLA 2Y1LE 2F8YA 4ZFHA 2ETAA 3ZKJA 1YCSB 5EIDA 3V30A 3NOGD 5AQBA 2DVWA 5HKPA 5AQ7A 4HNAD 5KWDA 3V79K 4BERA 1N0RA 5JMND 5KNHD 4HQDA 3UXGA 1S70B 3UI2A 1A5EA 2QYJA 3TWQA 3V31A 3HG0D 5AQ9A 1MJ0A 4B93B 1N0QA 3TWSA 4HI9A 3UTMA 2ZGDA 2XEHA 1MX2A 1MYOA
chains in the Genus database with same CATH superfamily
3TWXA 4L9PA 3T5XA 3VTXA 2CHWA 3HXEA 4BEPA 1UOHA 1V54E 2PQNA 4ATZD 1WDYA 5HQ8A 4BT8A 3W9GA 1OCRE 3HVEA 3RKVA 2IQCA 3PEVB 2WXKA 2ZGGA 5ANLA 2XS8A 2WMNA 1HS6A 3QAQA 4HOSA 5CRUA 2MRIA 4U7EB 2WXPA 1PAQA 2WQ6A 3QWVA 3QK0A 1UJKA 2XENA 3IXEA 4L23A 3Q9NC 3JQ0A 1O1RA 4I6GA 3MEKA 2Y4UA 3AG4E 3BQOA 1NZNA 2H6HA 2X6HA 4PH4B 3ESLA 1RW2A 1H2VC 3ZU7B 2I2OA 5CMYA 4AY5A 3TAXA 2BTDA 5KBAA 3JXIA 3T8MA 4MRUA 4XZ4A 2ETCA 5EILA 1NL4A 3CK8A 5ENPD 1QQEA 3RRUA 4K03A 3LCAA 3FUKA 2KZTB 3CVXA 3PNTB 2XEHA 1HG2A 4ZHBA 4Q94A 4K5AB 5C2YA 3AJIA 1D8EA 2CFUA 2KBXA 3DPYA 2P9NG 3ULQA 1JWGA 4BY6A 1ELRA 3UM1A 3LY9A 5B3SE 5BPPA 2L6JA 1TEZA 3E37A 3E30A 2LAIA 4LNUD 5C1DA 3CHQA 4IRUA 4GZCA 4DRXE 3C3QA 4MKTA 2IOLA 2AWIA 4UI9J 3KSQA 4DI3A 4MBGA 3AAAC 3AU5A 1B89A 5CBOA 3JQ1A 1TNYA 3CHRA 4AIFA 3ZEFA 3BEEA 5KJLA 1OUVA 5CEDB 4I17A 4GMJA 1KT1A 5FQ8A 4DK5A 4WWOA 5AJDA 5G2NA 2Y69E 2DYRE 3PVLA 1UN9A 3V79K 4XKBA 4BFRA 5ENNA 4KYOB 4L2YA 4UQXA 3MYVA 3KAEA 3OXLA 3B7UX 3QOUA 2LUHA 3AS5A 4JHKA 4JVSA 1YA0A 2CHXA 3FTYA 3ZN3A 5AAOA 3FU3A 3SD5A 4N3CA 3TJPA 3SGHA 3NB2A 1KT0A 3DXMG 4LNGA 3DSXA 4DLOA 3RSEG 3O48A 3ZUVB 4L1BA 3I4GA 2YHCA 1LD7A 3NQPA 2OCCE 3ESKA 3DWLG 3G2TA 1DCEA 4DX5D 2KXPC 1TNUA 3C98A 4UWGA 1L5JA 3Q79A 3RU0A 4EPZA 3APDA 5EYPF 3PE3A 2VGEA 3TGOA 4IYPA 4LSZE 5ITZF 4CYMD 3ABLE 3PRZA 4ABNA 5AYWD 3V2XA 2R59A 3LPZA 3URZA 4HOTA 3ZYMA 5LCWJ 5JJ7A 4NRHB 1BI7B 1S63A 1FVFA 4DPRA 1LF8A 3LVQE 4AXHA 5AQ7A 3PZ4A 2ZU6B 5JMND 2M63A 3N71A 2FEZA 4I1MA 4N5CA 3V31A 2QZAA 4JHJA 1S0PA 4LRZA 5H7PA 1Y6IA 3PUKA 5BV0A 1UN8A 2EILE 4FJZA 1E7VA 2OVFA 4A3TA 2WMOA 2DIWA 3ASFA 3S7FA 5CBNA 5EYLA 3LEWA 5AN8A 3B13A 4F53A 4EECA 3CVNA 3ZIMA 3PE4A 3PZ1A 2JEKA 3SHFA 3SFZA 4YVOA 1JCQA 5G55A 4G1TA 3VLDA 4AY6A 5KJKA 4R7LA 2J4DA 4K5BA 2XCCA 2GRNB 3CVLA 3I3NA 3R9AB 3PUJA 3FUDA 3L54A 4RG9A 2EIJE 4JB8P 4U96D 4JL0A 1OWPA 2WPVA 2R02A 1NFIE 5D66A 3ZXSA 4YDWA 3CSFA 1BPOA 4FA6A 2GRPB 3BU8A 1KZOA 3RAUA 3AG2E 1OCOE 3Q49B 4QQIA 3SF4A 3Q9UC 2C2LA 1SZ9A 3UKRG 2A5UA 3HVEB 4GTSA 3RIBA 1FCHA 1A5EA 2IOSA 4UWLA 2P9IG 5CMWA 3CVQA 4GMRA 1UW4B 1BLXB 1D8DA 2MYOA 3L16A 4JA7A 2IU1A 3RRMB 2OEVA 4YDOA 3ML9A 3IBEA 2ILRA 4WNFA 3LY8A 3CIAA 3UM3A 4CGVA 2Y3AA 2P9LG 1BU9A 3R7QA 3D9OA 4PS7A 3JYSA 4I9EA 5A6CA 3GZSA 1JCRA 2X6FA 3HXBA 5FZRA 4G25A 3DSVA 1JCSA 4W9RA 3PZDA 4LCTA 2Q7FA 2V5QC 1OT8A 2X6IA 4GTQA 4JA9A 5CEAA 3ZW3A 3C3RA 3FTUA 4G8KA 4J8YA 3ZNGA 4U8HA 2KATA 3ABKE 1PC2A 1N52A 2WQHA 2P9KG 1HX8A 2BKGA 3T5VA 1OWOA 3TWRA 5EIBE 2BUGA 1OY3D 5AJLA 1P5QA 2Y1LE 4ZFHA 2MHKA 4WNDA 2H6FA 3AU4A 3G2UA 2R2LA 3ZRHA 4XEIG 3NZUA 5AQ9A 4A1GA 2F8XK 3QKYA 1MYOA 2CFZA 3TWWA 2X3MA 2LSUA 4GYWA 4ANUA 3D9PA 4WNGA 3TXNA 4KVOA 4OAVB 2DWZA 1IQRA 3FH5A 3L82A 4GA0A 2CHZA 4HXIA 4N3BA 2LNIA 2GW1A 3JUEA 4UWHA 4NACA 4I6EA 1HZ4A 4DX2A 3CKBA 1HFAA 2C0LA 3UIPC 2WXHA 5ENRD 2R17C 3FEYA 1TNBA 2HYZA 1W3BA 2RD0A 3SY2A 1N95A 2Y0BG 4J8DA 5B1BE 2WXQA 1GW6A 3D9LA 3DPDA 3L9TA 2FO7A 4YDEA 4GAAA 5KWDA 2A4ZA 3KEZA 5FQ6A 4M3OA 3ZPJA 4N2SA 2C0MA 5D0OD 4IN3B 5D0QD 3CVUA 4GYOA 2RFAA 2J49A 4O60A 2NC9A 1SVXA 1N4SA 3D9KA 4CT4A 4DI4A 4CT0A 4HFGA 4UWKA 3V30A 2EINE 3DSWA 3DSSA 3UXGA 3UI2A 5E75A 3VLFA 1XGWA 4GTOA 1OCCE 3TWSA 2WXLA 1JUQA 5BUZA 5M72A 1IYGA 5KJMA 5FT9A 4BESA 1IHBA 3Q5MA 2KM4A 3B7SA 3AS4A 4A55A 4KXKB 4ILHB 2H6IA 3UT4A 3IEGA 4JEUA 3APFA 4Q96A 4AV7A 2VSYA 3ZVVA 3PZ2A 4K5CA 3FWVA 4G23A 4GZ6A 4GZ3A 1TN8A 4GTTA 2AJAA 1MQSA 4DUIA 3AS8A 3OTNA 2VGYA 2VJ8A 3L17A 3EHNA 2FI7A 5FJYA 4A3VA 3MGBA 4U95D 1KLXA 4PUCA 4HOQA 2FO1E 2XQ0A 3P2BA 4O1OA 5G05J 1EDUA 4ANVA 2WVIA 4GCOA 4XKCA 4J0UA 5BV1A 2GRMA 2UY1A 3CLJA 4GU5A 3UKUG 2I1KA 1TJCA 3LJ3A 3HXDA 3L6AA 2AVPA 1O1SA 4FULA 4HRLA 2P9PG 3MCXA 2R5SA 3I5PA 4GCNA 1A17A 4BX9A 4DLQA 1H6OA 4D10C 1EF1C 2KC7A 2L0IA 2WXFA 2YNQA 3NBNB 3P1UA 5EX3A 1DVPA 4HB5A 1KZPA 4PS8A 3S7BA 3NOCD 2V4HC 3EIJA 2XRZA 1ZU2A 1VDYA 3KD7A 3QDNA 3I4RB 5FQ4A 4HRNA 2IY0C 3PZ3A 4RG6A 4Z68A 3NAWA 4C0EA 4ANWA 3ZFWA 3TL5A 3FUFA 2HR2A 2XPYA 3MKRA 5ARFA 2DBAA 3KEAA 3ML8A 4J6IA 3D9JA 1OCZE 3VLEA 1D9SA 3ASDA 4GTRA 4NURA 4ATGA 2YQ8A 2VSNA 4KZCA 2WM9A 4DX7D 2DYSE 2ZISA 5FZSA 3X2QE 5BW8C 3FTWA 3IV0A 3FY4A 1E8YA 4JW1A 2FF4A 5CCMA 1EPUA 4BX8A 3BUAA 4AM9A 1OXJA 3CHOA 3FFLA 4U0UA 3CHSA 3ASHA 1H6KA 4FP7A 4AJWA 2I6HA 1MJ0A 3G2WA 4XIFA 5FZQA 3J5QB 3CV0A 2WXNA 4F7AA 1ELWA 4E6HA 3RJVA 2CG2A 2XPIA 3HDXA 5LOZA 5BXUA 1U3CA 2X38A 5DIZA 4WWPA 1H0AA 2XEEA 1OWMA 5J90A 3CQGB 3TG5A 3HXCA 2VTBA 4P29A 2BEDA 3QJZA 2OVBA 1E90A 2ETBA 2LXMA 3FULA 3MKQA 2BKKB 3OXGA 4LERA 5FQ7A 3RRNB 1AWCB 4N5QA 1YMPA 2ZIRA 4V3IA 2WXIA 3Q73A 3SQVA 2GGFA 4O1PA 1K1AA 1N11A 3AG3E 5G05C 3LY7A 4JZYA 5CCLA 4U63A 4B0ZA 4J7WA 2RG8A 2VSOE 3UT7A 2PM6A 4F1PA 2WXRA 4UI9C 4JD2G 2IO2C 1YYHA 2L9BA 2F8YA 4FLBA 5AQBA 3FP3A 2LSVA 5E76A 2E2EA 4HNAD 1INZA 5KNHD 3Q15A 3ZYQA 4FU3A 3CSTA 4PDXA 2P58C 1S64A 1HU3A 2FBNA 3Q7AA 1E8ZA 1O5MA 3FUNA 1TYQG 3U3WA 3GZ1A 3U64A 3UTMA 3SBSA 4CCAA 5EKQD 5EDSA 3PH0C 1LD8A 4G8LA 4GZ5A 2XZTG 3FUJA 2P9UG 2AXVA 5CECB 2PQRA 3ABME 3PREA 3MA5A 2RKKA 4M7CA 3B7RL 3QC1A 4A1SA 4FLHA 1IHGA 4NQ0A 1HG5A 2PM7A 1HXIA 3HIZA 1N9AA 3LJNA 1MHQA 4H7YA 3PEUB 3FDHA 1MZCA 3LVRE 2V0PA 1Y8MA 1N54A 1QYMA 4N39A 4I6JA 3KS2A 2XEVA 1PY1A 5FIOA 5ENOD 3ZGQA 1NA0A 1SA5A 4ME2A 1EYHA 5HRYA 2HM8A 3HYMB 2OOEA 4EZKA 2R05A 3EIQC 1SZAA 4FC8A 3CQCB 1E8WA 4F1SA 2V4LA 4KBQA 3Q4AB 2EIME 4IULA 1YCSB 4EHMA 1UJJA 3CVVA 3FH8A 2WXOA 3IHYA 5LCWC 3ZYLA 3CHPA 3UQ3A 5BNWA 4HI9A 5LP0A 4MLPA 4TXQA 4Q69A 3PDNA 4B8AA 4FJYA 4ILGA 2KCLA 4J8SA 4L2LA 3SZ7A 1U3DA 3DRAA 3ENEA 1RZ4A 2XGOA 3LS8A 1MX4A 2J07A 4U8YD 1LTXA 3RK6A 1BI8B 2V8SE 2VSXE 3B7BA 3CVYA 4U8VD 4GTMA 3WG7E 3MX3A 3DEPA 2UY1B 3GW4A 4XI9A 3EHQA 3K9IA 3QWPA 2J8SD 4FHKA 5KNGA 1V55E 3HRAA 2DCPA 1ZB1A 4HVBA 4Y6WA 2VGXA 2KCKA 3U4TA 3BG1B 4RQIA 4GTPA 4G2VA 3Q75A 3IKOB 4LUNU 3TWUA 2VQ2A 3APCA 1G3NB 3FHEA 4I1OB 4WAFA 2OEWA 4YNDA 3IHVA 4C9BB 3F6QA 5J08A 3R7RA 1BD8A 2WXMA 4HOUA 3D9IA 4HBDA 4EZJA 4OAUC 3ASOE 5HI7A 3ZKJA 3UIOC 5EIDA 2BF0X 3Q47B 3BG0B 5HKPA 3CVPA 3U9WA 4I1AA 1N4QA 2YINA 1N0QA 2ZGDA 5AARA 2JABA 3FU0A 4UQZA 3S2AA 1DC2A 5T8IA 3L13A 1TN6A 3UM0A 2ZXWE 3DBSA 1KPSB 1SA4A 4KT6B 5ENTD 3JXJA 2RFMA 4CZ2D 4GYYA 4HS2A 1AP7A 4N3AA 4X8QA 1Z6TA 2NSZA 3D3MA 1MX6A 5IY5E 4RSYA 5CHEE 2EQXA 3G2VA 4HORA 3AG1E 2J9QA 4UWFA 5ENQD 3E33A 4J8FA 3EHMA 3W9FA 1WY6A 5ANRA 3T8KA 2IEJA 3E4BA 5BXOA 3HHMA 3SFYA 3EJNA 2Y4TA 3ZYKA 2IF4A 4XX5A 2H6GA 1IXVA 5AENA 4DX6D 1TN7A 3DXKG 3UMVA 2XPZA 4KMOA 4YDYA 4E85A 4FHJA 2QC9A 3G2SA 1Z5SC 1HE8A 1NA3A 2HO1A 4J8EA 2V5FA 4BSZB 3CR3A 4B89A 1WAO1 4LG6A 2UWJG 2ETAA 2XS1A 4BWRA 4CEMA 1TJFA 5G04J 3DSUA 2YHEA 2VTBB 3ISMC 1N0RA 3R9MA 4GTVA 1NP7A 3TWQA 5EX0A 3RO2A 2MOWA 4OVUA 2XCBA 1MX2A 3LYAA 3QB2A 3MKQB 2GRQB 4DX1A 1E7UA 3V2OA 3WXXA 1SQMA 2F37A 2J09A 1WM5A 1QNFA 3SFXA 3TWTA 1HH8A 4XE0A 3C3OA 4PS3A 5B1AE 2J4BA 5T3RA 3ZHEA 4DJAA 3C5RA 2X6KA 2DZOA 1DCQA 4OVVA 5AIJA 2LO6A 3DEOA 2J08A 4BSXA 1X81A 3SI5A 4UQYA 5CERB 5FTPA 3UT8A 4EBAA 2WB2A 1UG3A 4GB9A 4JXTA 4F3VA 3Q78A 5EN5D 3D9MA 3UINC 5BT1A 2NYJA 3EHRA 2XGSA 1FT1A 1Q2ZA 4JC8A 4NIKA 4EBAG 1SW6A 3DSTA 1QZ2A 3S7JA 4AP2A 4APOA 2GRLA 3JUIA 5ENSD 1Z3YA 4APFA 3U66A 2L0TB 2X6JA 3TG4A 2IFUA 2QYJA 3UPVA 4L7TA 3QWWA 4JHRA 2EIKE 3ZXPA 3CEQA 1TR4A 3KSLA 5LX8A 4MS6A 4I9CA 3ULEG 3PS6A 2F0YA 1TNZA 5JJTA 1HO8A 3FU6A 2B6CA 4U0SA 3ULYA 5JA4D 3LKUA 2KZTA 3CGHA 3SO8A 3OAWA 3FUIA 4O6FA 4WUYA 2XGMA 4EQFA 3C72A 2GROB 4FADA 4RVBA 3FTZA 4I2ZA 3D9HA 3OXFA 3FU5A 4C0MA 5LFAA 3RO3A 5A23A 3LDZA 1K1BA 4I43A 4GZDA 5JHBA 1ELKA 3CVWA 1TNOA 1IKND 2WXGA 3MJWA 3UM2A 3VTYA 1K8KG 1WG0A 2XZDG 4KVMA 4F6RD 3NZSA 1NI1A 2AXZA 4BTAA 4URKA 5KCMA 2E0IA 3MV2B 4UUCA 4WNEA 3SNXA 5HS0A 2XRYA 4XI0A 2NXPA 2WQ7A 2IJGX 4I2WA 1DNPA 3NOGD 4U0ZA 5G04C 3O4ZA 2IO3C 3SBTB 4G26A 4CGWA 3CKCA 1S70B 3UX4A 4B8CB 4BT9A 1E96B 3FH7A 3EDTB 3ONLA 2XHEA 1Z3XA 3EU9A 4HI8A 2P2CP 2CG3A 4U07A 4HLLA 3UUXA 4YVQC 2VGXB 1IQUA 1N4RA 4OYSA 2LAHA 1K3ZD 3JCKC 2R03A 4U04A 2PZIA 5A7DB 4AEZC 5AQAA 3CK9A 5KJNA 4BETA 3B95A 1O1TA 3EU5A 4GPMA 2AXUA 4TUUA 1U2VG 2QFCA 2HE0A 3FEXA 1XNFA 2A5EA 3FTSA 4TXRA 3MV3B 2OV8A 4HRMB 4TUMA 2FULA 3QNKA 1H6PA 3ASGA 4B94A 3HXFA 5DBKA 4HLEA 1HF8A 1FT2A 1N94A 3ONKA 4LEUA 5D2MC 5JJ6A 4LNBA 3GZ2A 3CK7A 3B7TA 5JHAA 1JPLA 1OWLA 2I1JA 3LXUX 1ZBPA 2DVWA 3Q7FA 3EUVA 3TXMA 4GA2A 3E32A 4G11A 4K0RA 4Y6CA 2JLBA 2ONDA 4B93B 4GPKA 4TRQA 3L08A 4ACKA 3J5PA 1OWNA 4KZ0A 3GYZA 3FTVA 2DZNA 1H2UA 2L6BA 3FUMA 4ACLA 5CRVA 5ARGA 1N4PA 4H7XA 3D9NA 1FVHA 1X5BA 2P9SG 3FUEA 4CDNA 4GMLA 5T4YA 2PNNA 2QY7A 4CDRA 4G24A 4GA1A 4TV3A 2WXJA 1FPPA 2VYIA 3MZLB 3TWVA 2AW6A 4TXPA 3NF1A 4QFVA 1E8XA 5FINA 2IONA 2GRRB 3QARA 2B0OE 1H2TC 4AOFA 2KCVA 3ASNE 3CHMA 4ANXA 4C48B 3T9KA 1QBQA 2I9CA 3L22A 4A63B 4ILIA 4WWNA 3FTXA 3E34A 4CRWA 4CDMA 1H19A 4N2QA 4EZLA 2QYUA 4RLYA 3S7DA 2LXLA 3PNLB 5FWQA 4BERA 3FUHA 4JEHA 4HQDA 3ZHEB 2PL2A 4UI9K 4BTBA 3HG0D 1JWFA 4JPSA 4AVXA
chains in the Genus database with same CATH topology
3EU9A 4GMRA 2JABA 4HI8A 2P2CP 3TWWA 3TWXA 4ZHBA 3J5PA 1DC2A 3NBNB 4DX1A 1BLXB 4K5AB 4G8LA 4HLLA 1TR4A 3AJIA 2MYOA 4HB5A 3V2OA 5BXUA 2F37A 4OAVB 2DZNA 5AAOA 4BEPA 1K3ZD 1IHBA 1UOHA 2XZTG 3NOCD 4BESA 2L6BA 2F8XK 2DWZA 5CBNA 2V4HC 5EYLA 5AN8A 5CECB 4ATZD 1WDYA 5ENTD 2XEEA 2KBXA 2RFMA 3JXJA 4CZ2D 1MX4A 4U8YD 4HRNA 3J5QB 1BI8B 3TWTA 3JUEA 3W9GA 1AP7A 5AQAA 2PNNA 3ZUVB 4Z68A 5JA4D 4DX2A 2ZGGA 4BETA 3B7BA 4U8VD 3SO8A 4K5CA 1MX6A 3B95A 5ENRD 3DEPA 3LJNA 4GPMA 3TWVA 3C5RA 3EHQA 2DZOA 1DCQA 2ETBA 2AJAA 4DUIA 2J8SD 5ENQD 4LNUD 4QFVA 4DX5D 3W9FA 5FINA 5KNGA 2Y0BG 4K5BA 1BU9A 3DEOA 3KEAA 3T8KA 2KXPC 2HE0A 1QYMA 3D9HA 3HRAA 2A5EA 2BKKB 4DRXE 5BXOA 2XENA 3IXEA 1D9SA 5EYPF 3Q9NC 5FIOA 1AWCB 1K1BA 5CERB 2B0OE 4U95D 4N5QA 1YMPA 2VGEA 4HRMB 5ENOD 4LSZE 5ITZF 1IKND 3AAAC 4JB8P 4TUMA 4CYMD 2FO1E 4U96D 4C48B 2V5QC 1K1AA 1N11A 1OT8A 1WG0A 2XZDG 4O1PA 4O1OA 3T9KA 3ZU7B 4F6RD 5CBOA 1IXVA 3TWUA 3V2XA 5HRYA 1NFIE 4DX6D 1G3NB 5D66A 5EN5D 4DX7D 5CEAA 2NYJA 4YDWA 4A63B 4G8KA 4J8YA 3ZNGA 3EHRA 3JXIA 5KBAA 4UUCA 4YDYA 4J7WA 3F6QA 5HS0A 2QC9A 2RFAA 2ETCA 5EILA 4NIKA 5CEDB 1BD8A 1SW6A 4QQIA 4O60A 4F1PA 4BSZB 2BKGA 3Q9UC 4HBDA 1SVXA 1BI7B 4OAUC 3TWRA 5AARA 5EIBE 4LG6A 1OY3D 4RLYA 5ENSD 1YYHA 5ENPD 4HRLA 2Y1LE 2F8YA 4ZFHA 2ETAA 3ZKJA 1YCSB 5EIDA 3V30A 3NOGD 5AQBA 2DVWA 5HKPA 5AQ7A 4HNAD 5KWDA 3V79K 4BERA 1N0RA 5JMND 5KNHD 4HQDA 3UXGA 1S70B 3UI2A 1A5EA 2QYJA 3TWQA 3V31A 3HG0D 5AQ9A 1MJ0A 4B93B 1N0QA 3TWSA 4HI9A 3UTMA 2ZGDA 2XEHA 1MX2A 1MYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EU9 A;  4GMR A;  2JAB A;  4HI8 A;  2P2C P;  3TWW A;  3TWX A;  4ZHB A;  3J5P A;  1DC2 A;  3NBN B;  4DX1 A;  1BLX B;  4K5A B;  4G8L A;  4HLL A;  1TR4 A;  3AJI A;  2MYO A;  4HB5 A;  3V2O A;  5BXU A;  2F37 A;  4OAV B;  2DZN A;  5AAO A;  4BEP A;  1K3Z D;  1IHB A;  1UOH A;  2XZT G;  3NOC D;  4BES A;  2L6B A;  2F8X K;  2DWZ A;  5CBN A;  2V4H C;  5EYL A;  5AN8 A;  5CEC B;  4ATZ D;  1WDY A;  5ENT D;  2XEE A;  2KBX A;  2RFM A;  3JXJ A;  4CZ2 D;  1MX4 A;  4U8Y D;  4HRN A;  3J5Q B;  1BI8 B;  3TWT A;  3JUE A;  3W9G A;  1AP7 A;  5AQA A;  2PNN A;  3ZUV B;  4Z68 A;  5JA4 D;  4DX2 A;  2ZGG A;  4BET A;  3B7B A;  4U8V D;  3SO8 A;  4K5C A;  1MX6 A;  3B95 A;  5ENR D;  3DEP A;  3LJN A;  4GPM A;  3TWV A;  3C5R A;  3EHQ A;  2DZO A;  1DCQ A;  2ETB A;  2AJA A;  4DUI A;  2J8S D;  5ENQ D;  4LNU D;  4QFV A;  4DX5 D;  3W9F A;  5FIN A;  5KNG A;  2Y0B G;  4K5B A;  1BU9 A;  3DEO A;  3KEA A;  3T8K A;  2KXP C;  2HE0 A;  1QYM A;  3D9H A;  3HRA A;  2A5E A;  2BKK B;  4DRX E;  5BXO A;  2XEN A;  3IXE A;  1D9S A;  5EYP F;  3Q9N C;  5FIO A;  1AWC B;  1K1B A;  5CER B;  2B0O E;  4U95 D;  4N5Q A;  1YMP A;  2VGE A;  4HRM B;  5ENO D;  4LSZ E;  5ITZ F;  1IKN D;  3AAA C;  4JB8 P;  4TUM A;  4CYM D;  2FO1 E;  4U96 D;  4C48 B;  2V5Q C;  1K1A A;  1N11 A;  1OT8 A;  1WG0 A;  2XZD G;  4O1P A;  4O1O A;  3T9K A;  3ZU7 B;  4F6R D;  5CBO A;  1IXV A;  3TWU A;  3V2X A;  5HRY A;  1NFI E;  4DX6 D;  1G3N B;  5D66 A;  5EN5 D;  4DX7 D;  5CEA A;  2NYJ A;  4YDW A;  4A63 B;  4G8K A;  4J8Y A;  3ZNG A;  3EHR A;  3JXI A;  5KBA A;  4UUC A;  4YDY A;  4J7W A;  3F6Q A;  5HS0 A;  2QC9 A;  2RFA A;  2ETC A;  5EIL A;  4NIK A;  5CED B;  1BD8 A;  1SW6 A;  4QQI A;  4O60 A;  4F1P A;  4BSZ B;  2BKG A;  3Q9U C;  4HBD A;  1SVX A;  1BI7 B;  4OAU C;  3TWR A;  5AAR A;  5EIB E;  4LG6 A;  1OY3 D;  4RLY A;  5ENS D;  1YYH A;  5ENP D;  4HRL A;  2Y1L E;  2F8Y A;  4ZFH A;  2ETA A;  3ZKJ A;  1YCS B;  5EID A;  3V30 A;  3NOG D;  5AQB A;  2DVW A;  5HKP A;  5AQ7 A;  4HNA D;  5KWD A;  3V79 K;  4BER A;  1N0R A;  5JMN D;  5KNH D;  4HQD A;  3UXG A;  1S70 B;  3UI2 A;  1A5E A;  2QYJ A;  3TWQ A;  3V31 A;  3HG0 D;  5AQ9 A;  1MJ0 A;  4B93 B;  1N0Q A;  3TWS A;  4HI9 A;  3UTM A;  2ZGD A;  2XEH A;  1MX2 A;  1MYO A; 
#chains in the Genus database with same CATH topology
 3TWX A;  4L9P A;  3T5X A;  3VTX A;  2CHW A;  3HXE A;  4BEP A;  1UOH A;  1V54 E;  2PQN A;  4ATZ D;  1WDY A;  5HQ8 A;  4BT8 A;  3W9G A;  1OCR E;  3HVE A;  3RKV A;  2IQC A;  3PEV B;  2WXK A;  2ZGG A;  5ANL A;  2XS8 A;  2WMN A;  1HS6 A;  3QAQ A;  4HOS A;  5CRU A;  2MRI A;  4U7E B;  2WXP A;  1PAQ A;  2WQ6 A;  3QWV A;  3QK0 A;  1UJK A;  2XEN A;  3IXE A;  4L23 A;  3Q9N C;  3JQ0 A;  1O1R A;  4I6G A;  3MEK A;  2Y4U A;  3AG4 E;  3BQO A;  1NZN A;  2H6H A;  2X6H A;  4PH4 B;  3ESL A;  1RW2 A;  1H2V C;  3ZU7 B;  2I2O A;  5CMY A;  4AY5 A;  3TAX A;  2BTD A;  5KBA A;  3JXI A;  3T8M A;  4MRU A;  4XZ4 A;  2ETC A;  5EIL A;  1NL4 A;  3CK8 A;  5ENP D;  1QQE A;  3RRU A;  4K03 A;  3LCA A;  3FUK A;  2KZT B;  3CVX A;  3PNT B;  2XEH A;  1HG2 A;  4ZHB A;  4Q94 A;  4K5A B;  5C2Y A;  3AJI A;  1D8E A;  2CFU A;  2KBX A;  3DPY A;  2P9N G;  3ULQ A;  1JWG A;  4BY6 A;  1ELR A;  3UM1 A;  3LY9 A;  5B3S E;  5BPP A;  2L6J A;  1TEZ A;  3E37 A;  3E30 A;  2LAI A;  4LNU D;  5C1D A;  3CHQ A;  4IRU A;  4GZC A;  4DRX E;  3C3Q A;  4MKT A;  2IOL A;  2AWI A;  4UI9 J;  3KSQ A;  4DI3 A;  4MBG A;  3AAA C;  3AU5 A;  1B89 A;  5CBO A;  3JQ1 A;  1TNY A;  3CHR A;  4AIF A;  3ZEF A;  3BEE A;  5KJL A;  1OUV A;  5CED B;  4I17 A;  4GMJ A;  1KT1 A;  5FQ8 A;  4DK5 A;  4WWO A;  5AJD A;  5G2N A;  2Y69 E;  2DYR E;  3PVL A;  1UN9 A;  3V79 K;  4XKB A;  4BFR A;  5ENN A;  4KYO B;  4L2Y A;  4UQX A;  3MYV A;  3KAE A;  3OXL A;  3B7U X;  3QOU A;  2LUH A;  3AS5 A;  4JHK A;  4JVS A;  1YA0 A;  2CHX A;  3FTY A;  3ZN3 A;  5AAO A;  3FU3 A;  3SD5 A;  4N3C A;  3TJP A;  3SGH A;  3NB2 A;  1KT0 A;  3DXM G;  4LNG A;  3DSX A;  4DLO A;  3RSE G;  3O48 A;  3ZUV B;  4L1B A;  3I4G A;  2YHC A;  1LD7 A;  3NQP A;  2OCC E;  3ESK A;  3DWL G;  3G2T A;  1DCE A;  4DX5 D;  2KXP C;  1TNU A;  3C98 A;  4UWG A;  1L5J A;  3Q79 A;  3RU0 A;  4EPZ A;  3APD A;  5EYP F;  3PE3 A;  2VGE A;  3TGO A;  4IYP A;  4LSZ E;  5ITZ F;  4CYM D;  3ABL E;  3PRZ A;  4ABN A;  5AYW D;  3V2X A;  2R59 A;  3LPZ A;  3URZ A;  4HOT A;  3ZYM A;  5LCW J;  5JJ7 A;  4NRH B;  1BI7 B;  1S63 A;  1FVF A;  4DPR A;  1LF8 A;  3LVQ E;  4AXH A;  5AQ7 A;  3PZ4 A;  2ZU6 B;  5JMN D;  2M63 A;  3N71 A;  2FEZ A;  4I1M A;  4N5C A;  3V31 A;  2QZA A;  4JHJ A;  1S0P A;  4LRZ A;  5H7P A;  1Y6I A;  3PUK A;  5BV0 A;  1UN8 A;  2EIL E;  4FJZ A;  1E7V A;  2OVF A;  4A3T A;  2WMO A;  2DIW A;  3ASF A;  3S7F A;  5CBN A;  5EYL A;  3LEW A;  5AN8 A;  3B13 A;  4F53 A;  4EEC A;  3CVN A;  3ZIM A;  3PE4 A;  3PZ1 A;  2JEK A;  3SHF A;  3SFZ A;  4YVO A;  1JCQ A;  5G55 A;  4G1T A;  3VLD A;  4AY6 A;  5KJK A;  4R7L A;  2J4D A;  4K5B A;  2XCC A;  2GRN B;  3CVL A;  3I3N A;  3R9A B;  3PUJ A;  3FUD A;  3L54 A;  4RG9 A;  2EIJ E;  4JB8 P;  4U96 D;  4JL0 A;  1OWP A;  2WPV A;  2R02 A;  1NFI E;  5D66 A;  3ZXS A;  4YDW A;  3CSF A;  1BPO A;  4FA6 A;  2GRP B;  3BU8 A;  1KZO A;  3RAU A;  3AG2 E;  1OCO E;  3Q49 B;  4QQI A;  3SF4 A;  3Q9U C;  2C2L A;  1SZ9 A;  3UKR G;  2A5U A;  3HVE B;  4GTS A;  3RIB A;  1FCH A;  1A5E A;  2IOS A;  4UWL A;  2P9I G;  5CMW A;  3CVQ A;  4GMR A;  1UW4 B;  1BLX B;  1D8D A;  2MYO A;  3L16 A;  4JA7 A;  2IU1 A;  3RRM B;  2OEV A;  4YDO A;  3ML9 A;  3IBE A;  2ILR A;  4WNF A;  3LY8 A;  3CIA A;  3UM3 A;  4CGV A;  2Y3A A;  2P9L G;  1BU9 A;  3R7Q A;  3D9O A;  4PS7 A;  3JYS A;  4I9E A;  5A6C A;  3GZS A;  1JCR A;  2X6F A;  3HXB A;  5FZR A;  4G25 A;  3DSV A;  1JCS A;  4W9R A;  3PZD A;  4LCT A;  2Q7F A;  2V5Q C;  1OT8 A;  2X6I A;  4GTQ A;  4JA9 A;  5CEA A;  3ZW3 A;  3C3R A;  3FTU A;  4G8K A;  4J8Y A;  3ZNG A;  4U8H A;  2KAT A;  3ABK E;  1PC2 A;  1N52 A;  2WQH A;  2P9K G;  1HX8 A;  2BKG A;  3T5V A;  1OWO A;  3TWR A;  5EIB E;  2BUG A;  1OY3 D;  5AJL A;  1P5Q A;  2Y1L E;  4ZFH A;  2MHK A;  4WND A;  2H6F A;  3AU4 A;  3G2U A;  2R2L A;  3ZRH A;  4XEI G;  3NZU A;  5AQ9 A;  4A1G A;  2F8X K;  3QKY A;  1MYO A;  2CFZ A;  3TWW A;  2X3M A;  2LSU A;  4GYW A;  4ANU A;  3D9P A;  4WNG A;  3TXN A;  4KVO A;  4OAV B;  2DWZ A;  1IQR A;  3FH5 A;  3L82 A;  4GA0 A;  2CHZ A;  4HXI A;  4N3B A;  2LNI A;  2GW1 A;  3JUE A;  4UWH A;  4NAC A;  4I6E A;  1HZ4 A;  4DX2 A;  3CKB A;  1HFA A;  2C0L A;  3UIP C;  2WXH A;  5ENR D;  2R17 C;  3FEY A;  1TNB A;  2HYZ A;  1W3B A;  2RD0 A;  3SY2 A;  1N95 A;  2Y0B G;  4J8D A;  5B1B E;  2WXQ A;  1GW6 A;  3D9L A;  3DPD A;  3L9T A;  2FO7 A;  4YDE A;  4GAA A;  5KWD A;  2A4Z A;  3KEZ A;  5FQ6 A;  4M3O A;  3ZPJ A;  4N2S A;  2C0M A;  5D0O D;  4IN3 B;  5D0Q D;  3CVU A;  4GYO A;  2RFA A;  2J49 A;  4O60 A;  2NC9 A;  1SVX A;  1N4S A;  3D9K A;  4CT4 A;  4DI4 A;  4CT0 A;  4HFG A;  4UWK A;  3V30 A;  2EIN E;  3DSW A;  3DSS A;  3UXG A;  3UI2 A;  5E75 A;  3VLF A;  1XGW A;  4GTO A;  1OCC E;  3TWS A;  2WXL A;  1JUQ A;  5BUZ A;  5M72 A;  1IYG A;  5KJM A;  5FT9 A;  4BES A;  1IHB A;  3Q5M A;  2KM4 A;  3B7S A;  3AS4 A;  4A55 A;  4KXK B;  4ILH B;  2H6I A;  3UT4 A;  3IEG A;  4JEU A;  3APF A;  4Q96 A;  4AV7 A;  2VSY A;  3ZVV A;  3PZ2 A;  4K5C A;  3FWV A;  4G23 A;  4GZ6 A;  4GZ3 A;  1TN8 A;  4GTT A;  2AJA A;  1MQS A;  4DUI A;  3AS8 A;  3OTN A;  2VGY A;  2VJ8 A;  3L17 A;  3EHN A;  2FI7 A;  5FJY A;  4A3V A;  3MGB A;  4U95 D;  1KLX A;  4PUC A;  4HOQ A;  2FO1 E;  2XQ0 A;  3P2B A;  4O1O A;  5G05 J;  1EDU A;  4ANV A;  2WVI A;  4GCO A;  4XKC A;  4J0U A;  5BV1 A;  2GRM A;  2UY1 A;  3CLJ A;  4GU5 A;  3UKU G;  2I1K A;  1TJC A;  3LJ3 A;  3HXD A;  3L6A A;  2AVP A;  1O1S A;  4FUL A;  4HRL A;  2P9P G;  3MCX A;  2R5S A;  3I5P A;  4GCN A;  1A17 A;  4BX9 A;  4DLQ A;  1H6O A;  4D10 C;  1EF1 C;  2KC7 A;  2L0I A;  2WXF A;  2YNQ A;  3NBN B;  3P1U A;  5EX3 A;  1DVP A;  4HB5 A;  1KZP A;  4PS8 A;  3S7B A;  3NOC D;  2V4H C;  3EIJ A;  2XRZ A;  1ZU2 A;  1VDY A;  3KD7 A;  3QDN A;  3I4R B;  5FQ4 A;  4HRN A;  2IY0 C;  3PZ3 A;  4RG6 A;  4Z68 A;  3NAW A;  4C0E A;  4ANW A;  3ZFW A;  3TL5 A;  3FUF A;  2HR2 A;  2XPY A;  3MKR A;  5ARF A;  2DBA A;  3KEA A;  3ML8 A;  4J6I A;  3D9J A;  1OCZ E;  3VLE A;  1D9S A;  3ASD A;  4GTR A;  4NUR A;  4ATG A;  2YQ8 A;  2VSN A;  4KZC A;  2WM9 A;  4DX7 D;  2DYS E;  2ZIS A;  5FZS A;  3X2Q E;  5BW8 C;  3FTW A;  3IV0 A;  3FY4 A;  1E8Y A;  4JW1 A;  2FF4 A;  5CCM A;  1EPU A;  4BX8 A;  3BUA A;  4AM9 A;  1OXJ A;  3CHO A;  3FFL A;  4U0U A;  3CHS A;  3ASH A;  1H6K A;  4FP7 A;  4AJW A;  2I6H A;  1MJ0 A;  3G2W A;  4XIF A;  5FZQ A;  3J5Q B;  3CV0 A;  2WXN A;  4F7A A;  1ELW A;  4E6H A;  3RJV A;  2CG2 A;  2XPI A;  3HDX A;  5LOZ A;  5BXU A;  1U3C A;  2X38 A;  5DIZ A;  4WWP A;  1H0A A;  2XEE A;  1OWM A;  5J90 A;  3CQG B;  3TG5 A;  3HXC A;  2VTB A;  4P29 A;  2BED A;  3QJZ A;  2OVB A;  1E90 A;  2ETB A;  2LXM A;  3FUL A;  3MKQ A;  2BKK B;  3OXG A;  4LER A;  5FQ7 A;  3RRN B;  1AWC B;  4N5Q A;  1YMP A;  2ZIR A;  4V3I A;  2WXI A;  3Q73 A;  3SQV A;  2GGF A;  4O1P A;  1K1A A;  1N11 A;  3AG3 E;  5G05 C;  3LY7 A;  4JZY A;  5CCL A;  4U63 A;  4B0Z A;  4J7W A;  2RG8 A;  2VSO E;  3UT7 A;  2PM6 A;  4F1P A;  2WXR A;  4UI9 C;  4JD2 G;  2IO2 C;  1YYH A;  2L9B A;  2F8Y A;  4FLB A;  5AQB A;  3FP3 A;  2LSV A;  5E76 A;  2E2E A;  4HNA D;  1INZ A;  5KNH D;  3Q15 A;  3ZYQ A;  4FU3 A;  3CST A;  4PDX A;  2P58 C;  1S64 A;  1HU3 A;  2FBN A;  3Q7A A;  1E8Z A;  1O5M A;  3FUN A;  1TYQ G;  3U3W A;  3GZ1 A;  3U64 A;  3UTM A;  3SBS A;  4CCA A;  5EKQ D;  5EDS A;  3PH0 C;  1LD8 A;  4G8L A;  4GZ5 A;  2XZT G;  3FUJ A;  2P9U G;  2AXV A;  5CEC B;  2PQR A;  3ABM E;  3PRE A;  3MA5 A;  2RKK A;  4M7C A;  3B7R L;  3QC1 A;  4A1S A;  4FLH A;  1IHG A;  4NQ0 A;  1HG5 A;  2PM7 A;  1HXI A;  3HIZ A;  1N9A A;  3LJN A;  1MHQ A;  4H7Y A;  3PEU B;  3FDH A;  1MZC A;  3LVR E;  2V0P A;  1Y8M A;  1N54 A;  1QYM A;  4N39 A;  4I6J A;  3KS2 A;  2XEV A;  1PY1 A;  5FIO A;  5ENO D;  3ZGQ A;  1NA0 A;  1SA5 A;  4ME2 A;  1EYH A;  5HRY A;  2HM8 A;  3HYM B;  2OOE A;  4EZK A;  2R05 A;  3EIQ C;  1SZA A;  4FC8 A;  3CQC B;  1E8W A;  4F1S A;  2V4L A;  4KBQ A;  3Q4A B;  2EIM E;  4IUL A;  1YCS B;  4EHM A;  1UJJ A;  3CVV A;  3FH8 A;  2WXO A;  3IHY A;  5LCW C;  3ZYL A;  3CHP A;  3UQ3 A;  5BNW A;  4HI9 A;  5LP0 A;  4MLP A;  4TXQ A;  4Q69 A;  3PDN A;  4B8A A;  4FJY A;  4ILG A;  2KCL A;  4J8S A;  4L2L A;  3SZ7 A;  1U3D A;  3DRA A;  3ENE A;  1RZ4 A;  2XGO A;  3LS8 A;  1MX4 A;  2J07 A;  4U8Y D;  1LTX A;  3RK6 A;  1BI8 B;  2V8S E;  2VSX E;  3B7B A;  3CVY A;  4U8V D;  4GTM A;  3WG7 E;  3MX3 A;  3DEP A;  2UY1 B;  3GW4 A;  4XI9 A;  3EHQ A;  3K9I A;  3QWP A;  2J8S D;  4FHK A;  5KNG A;  1V55 E;  3HRA A;  2DCP A;  1ZB1 A;  4HVB A;  4Y6W A;  2VGX A;  2KCK A;  3U4T A;  3BG1 B;  4RQI A;  4GTP A;  4G2V A;  3Q75 A;  3IKO B;  4LUN U;  3TWU A;  2VQ2 A;  3APC A;  1G3N B;  3FHE A;  4I1O B;  4WAF A;  2OEW A;  4YND A;  3IHV A;  4C9B B;  3F6Q A;  5J08 A;  3R7R A;  1BD8 A;  2WXM A;  4HOU A;  3D9I A;  4HBD A;  4EZJ A;  4OAU C;  3ASO E;  5HI7 A;  3ZKJ A;  3UIO C;  5EID A;  2BF0 X;  3Q47 B;  3BG0 B;  5HKP A;  3CVP A;  3U9W A;  4I1A A;  1N4Q A;  2YIN A;  1N0Q A;  2ZGD A;  5AAR A;  2JAB A;  3FU0 A;  4UQZ A;  3S2A A;  1DC2 A;  5T8I A;  3L13 A;  1TN6 A;  3UM0 A;  2ZXW E;  3DBS A;  1KPS B;  1SA4 A;  4KT6 B;  5ENT D;  3JXJ A;  2RFM A;  4CZ2 D;  4GYY A;  4HS2 A;  1AP7 A;  4N3A A;  4X8Q A;  1Z6T A;  2NSZ A;  3D3M A;  1MX6 A;  5IY5 E;  4RSY A;  5CHE E;  2EQX A;  3G2V A;  4HOR A;  3AG1 E;  2J9Q A;  4UWF A;  5ENQ D;  3E33 A;  4J8F A;  3EHM A;  3W9F A;  1WY6 A;  5ANR A;  3T8K A;  2IEJ A;  3E4B A;  5BXO A;  3HHM A;  3SFY A;  3EJN A;  2Y4T A;  3ZYK A;  2IF4 A;  4XX5 A;  2H6G A;  1IXV A;  5AEN A;  4DX6 D;  1TN7 A;  3DXK G;  3UMV A;  2XPZ A;  4KMO A;  4YDY A;  4E85 A;  4FHJ A;  2QC9 A;  3G2S A;  1Z5S C;  1HE8 A;  1NA3 A;  2HO1 A;  4J8E A;  2V5F A;  4BSZ B;  3CR3 A;  4B89 A;  1WAO 1;  4LG6 A;  2UWJ G;  2ETA A;  2XS1 A;  4BWR A;  4CEM A;  1TJF A;  5G04 J;  3DSU A;  2YHE A;  2VTB B;  3ISM C;  1N0R A;  3R9M A;  4GTV A;  1NP7 A;  3TWQ A;  5EX0 A;  3RO2 A;  2MOW A;  4OVU A;  2XCB A;  1MX2 A;  3LYA A;  3QB2 A;  3MKQ B;  2GRQ B;  4DX1 A;  1E7U A;  3V2O A;  3WXX A;  1SQM A;  2F37 A;  2J09 A;  1WM5 A;  1QNF A;  3SFX A;  3TWT A;  1HH8 A;  4XE0 A;  3C3O A;  4PS3 A;  5B1A E;  2J4B A;  5T3R A;  3ZHE A;  4DJA A;  3C5R A;  2X6K A;  2DZO A;  1DCQ A;  4OVV A;  5AIJ A;  2LO6 A;  3DEO A;  2J08 A;  4BSX A;  1X81 A;  3SI5 A;  4UQY A;  5CER B;  5FTP A;  3UT8 A;  4EBA A;  2WB2 A;  1UG3 A;  4GB9 A;  4JXT A;  4F3V A;  3Q78 A;  5EN5 D;  3D9M A;  3UIN C;  5BT1 A;  2NYJ A;  3EHR A;  2XGS A;  1FT1 A;  1Q2Z A;  4JC8 A;  4NIK A;  4EBA G;  1SW6 A;  3DST A;  1QZ2 A;  3S7J A;  4AP2 A;  4APO A;  2GRL A;  3JUI A;  5ENS D;  1Z3Y A;  4APF A;  3U66 A;  2L0T B;  2X6J A;  3TG4 A;  2IFU A;  2QYJ A;  3UPV A;  4L7T A;  3QWW A;  4JHR A;  2EIK E;  3ZXP A;  3CEQ A;  1TR4 A;  3KSL A;  5LX8 A;  4MS6 A;  4I9C A;  3ULE G;  3PS6 A;  2F0Y A;  1TNZ A;  5JJT A;  1HO8 A;  3FU6 A;  2B6C A;  4U0S A;  3ULY A;  5JA4 D;  3LKU A;  2KZT A;  3CGH A;  3SO8 A;  3OAW A;  3FUI A;  4O6F A;  4WUY A;  2XGM A;  4EQF A;  3C72 A;  2GRO B;  4FAD A;  4RVB A;  3FTZ A;  4I2Z A;  3D9H A;  3OXF A;  3FU5 A;  4C0M A;  5LFA A;  3RO3 A;  5A23 A;  3LDZ A;  1K1B A;  4I43 A;  4GZD A;  5JHB A;  1ELK A;  3CVW A;  1TNO A;  1IKN D;  2WXG A;  3MJW A;  3UM2 A;  3VTY A;  1K8K G;  1WG0 A;  2XZD G;  4KVM A;  4F6R D;  3NZS A;  1NI1 A;  2AXZ A;  4BTA A;  4URK A;  5KCM A;  2E0I A;  3MV2 B;  4UUC A;  4WNE A;  3SNX A;  5HS0 A;  2XRY A;  4XI0 A;  2NXP A;  2WQ7 A;  2IJG X;  4I2W A;  1DNP A;  3NOG D;  4U0Z A;  5G04 C;  3O4Z A;  2IO3 C;  3SBT B;  4G26 A;  4CGW A;  3CKC A;  1S70 B;  3UX4 A;  4B8C B;  4BT9 A;  1E96 B;  3FH7 A;  3EDT B;  3ONL A;  2XHE A;  1Z3X A;  3EU9 A;  4HI8 A;  2P2C P;  2CG3 A;  4U07 A;  4HLL A;  3UUX A;  4YVQ C;  2VGX B;  1IQU A;  1N4R A;  4OYS A;  2LAH A;  1K3Z D;  3JCK C;  2R03 A;  4U04 A;  2PZI A;  5A7D B;  4AEZ C;  5AQA A;  3CK9 A;  5KJN A;  4BET A;  3B95 A;  1O1T A;  3EU5 A;  4GPM A;  2AXU A;  4TUU A;  1U2V G;  2QFC A;  2HE0 A;  3FEX A;  1XNF A;  2A5E A;  3FTS A;  4TXR A;  3MV3 B;  2OV8 A;  4HRM B;  4TUM A;  2FUL A;  3QNK A;  1H6P A;  3ASG A;  4B94 A;  3HXF A;  5DBK A;  4HLE A;  1HF8 A;  1FT2 A;  1N94 A;  3ONK A;  4LEU A;  5D2M C;  5JJ6 A;  4LNB A;  3GZ2 A;  3CK7 A;  3B7T A;  5JHA A;  1JPL A;  1OWL A;  2I1J A;  3LXU X;  1ZBP A;  2DVW A;  3Q7F A;  3EUV A;  3TXM A;  4GA2 A;  3E32 A;  4G11 A;  4K0R A;  4Y6C A;  2JLB A;  2OND A;  4B93 B;  4GPK A;  4TRQ A;  3L08 A;  4ACK A;  3J5P A;  1OWN A;  4KZ0 A;  3GYZ A;  3FTV A;  2DZN A;  1H2U A;  2L6B A;  3FUM A;  4ACL A;  5CRV A;  5ARG A;  1N4P A;  4H7X A;  3D9N A;  1FVH A;  1X5B A;  2P9S G;  3FUE A;  4CDN A;  4GML A;  5T4Y A;  2PNN A;  2QY7 A;  4CDR A;  4G24 A;  4GA1 A;  4TV3 A;  2WXJ A;  1FPP A;  2VYI A;  3MZL B;  3TWV A;  2AW6 A;  4TXP A;  3NF1 A;  4QFV A;  1E8X A;  5FIN A;  2ION A;  2GRR B;  3QAR A;  2B0O E;  1H2T C;  4AOF A;  2KCV A;  3ASN E;  3CHM A;  4ANX A;  4C48 B;  3T9K A;  1QBQ A;  2I9C A;  3L22 A;  4A63 B;  4ILI A;  4WWN A;  3FTX A;  3E34 A;  4CRW A;  4CDM A;  1H19 A;  4N2Q A;  4EZL A;  2QYU A;  4RLY A;  3S7D A;  2LXL A;  3PNL B;  5FWQ A;  4BER A;  3FUH A;  4JEH A;  4HQD A;  3ZHE B;  2PL2 A;  4UI9 K;  4BTB A;  3HG0 D;  1JWF A;  4JPS A;  4AVX A; 
#chains in the Genus database with same CATH homology
 3EU9 A;  4GMR A;  2JAB A;  4HI8 A;  2P2C P;  3TWW A;  3TWX A;  4ZHB A;  3J5P A;  1DC2 A;  3NBN B;  4DX1 A;  1BLX B;  4K5A B;  4G8L A;  4HLL A;  1TR4 A;  3AJI A;  2MYO A;  4HB5 A;  3V2O A;  5BXU A;  2F37 A;  4OAV B;  2DZN A;  5AAO A;  4BEP A;  1K3Z D;  1IHB A;  1UOH A;  2XZT G;  3NOC D;  4BES A;  2L6B A;  2F8X K;  2DWZ A;  5CBN A;  2V4H C;  5EYL A;  5AN8 A;  5CEC B;  4ATZ D;  1WDY A;  5ENT D;  2XEE A;  2KBX A;  2RFM A;  3JXJ A;  4CZ2 D;  1MX4 A;  4U8Y D;  4HRN A;  3J5Q B;  1BI8 B;  3TWT A;  3JUE A;  3W9G A;  1AP7 A;  5AQA A;  2PNN A;  3ZUV B;  4Z68 A;  5JA4 D;  4DX2 A;  2ZGG A;  4BET A;  3B7B A;  4U8V D;  3SO8 A;  4K5C A;  1MX6 A;  3B95 A;  5ENR D;  3DEP A;  3LJN A;  4GPM A;  3TWV A;  3C5R A;  3EHQ A;  2DZO A;  1DCQ A;  2ETB A;  2AJA A;  4DUI A;  2J8S D;  5ENQ D;  4LNU D;  4QFV A;  4DX5 D;  3W9F A;  5FIN A;  5KNG A;  2Y0B G;  4K5B A;  1BU9 A;  3DEO A;  3KEA A;  3T8K A;  2KXP C;  2HE0 A;  1QYM A;  3D9H A;  3HRA A;  2A5E A;  2BKK B;  4DRX E;  5BXO A;  2XEN A;  3IXE A;  1D9S A;  5EYP F;  3Q9N C;  5FIO A;  1AWC B;  1K1B A;  5CER B;  2B0O E;  4U95 D;  4N5Q A;  1YMP A;  2VGE A;  4HRM B;  5ENO D;  4LSZ E;  5ITZ F;  1IKN D;  3AAA C;  4JB8 P;  4TUM A;  4CYM D;  2FO1 E;  4U96 D;  4C48 B;  2V5Q C;  1K1A A;  1N11 A;  1OT8 A;  1WG0 A;  2XZD G;  4O1P A;  4O1O A;  3T9K A;  3ZU7 B;  4F6R D;  5CBO A;  1IXV A;  3TWU A;  3V2X A;  5HRY A;  1NFI E;  4DX6 D;  1G3N B;  5D66 A;  5EN5 D;  4DX7 D;  5CEA A;  2NYJ A;  4YDW A;  4A63 B;  4G8K A;  4J8Y A;  3ZNG A;  3EHR A;  3JXI A;  5KBA A;  4UUC A;  4YDY A;  4J7W A;  3F6Q A;  5HS0 A;  2QC9 A;  2RFA A;  2ETC A;  5EIL A;  4NIK A;  5CED B;  1BD8 A;  1SW6 A;  4QQI A;  4O60 A;  4F1P A;  4BSZ B;  2BKG A;  3Q9U C;  4HBD A;  1SVX A;  1BI7 B;  4OAU C;  3TWR A;  5AAR A;  5EIB E;  4LG6 A;  1OY3 D;  4RLY A;  5ENS D;  1YYH A;  5ENP D;  4HRL A;  2Y1L E;  2F8Y A;  4ZFH A;  2ETA A;  3ZKJ A;  1YCS B;  5EID A;  3V30 A;  3NOG D;  5AQB A;  2DVW A;  5HKP A;  5AQ7 A;  4HNA D;  5KWD A;  3V79 K;  4BER A;  1N0R A;  5JMN D;  5KNH D;  4HQD A;  3UXG A;  1S70 B;  3UI2 A;  1A5E A;  2QYJ A;  3TWQ A;  3V31 A;  3HG0 D;  5AQ9 A;  1MJ0 A;  4B93 B;  1N0Q A;  3TWS A;  4HI9 A;  3UTM A;  2ZGD A;  2XEH A;  1MX2 A;  1MYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...