1BI7B

Mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
EPSADWLATAAARGRVEEVRALLEAGANPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (kinase/anti-oncogene)
molecule keywords CYCLIN-DEPENDENT KINASE 6
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bi7B00
1BD8A 1K1BA 2QYJA 2DVWA 5HKPA 4LSZE 1MX2A 2RFAA 4DX5D 2L6BA 5CEAA 4BSZB 1BU9A 2BKKB 1UOHA 3UTMA 2ETBA 4OAVB 4BERA 1QYMA 3EHQA 1SW6A 4YDWA 3V31A 2P2CP 4U8VD 1K3ZD 1G3NB 2ETCA 3TWTA 3HG0D 2XENA 4K5CA 2DWZA 5JA4D 5EN5D 4HRLA 4J8YA 4G8LA 3ZUVB 5EIDA 3TWVA 5EIBE 3Q9UC 4HRMB 5KWDA 4HNAD 1BI8B 3UXGA 3V30A 1DC2A 4LG6A 5KNHD 3JXJA 4DRXE 2Y0BG 4BESA 4GMRA 2MYOA 2KBXA 1OT8A 4GPMA 1N0QA 4O1PA 2VGEA 3TWUA 4O1OA 1BLXB 2F8XK 1BI7B 2NYJA 2BKGA 3TWSA 3C5RA 3JUEA 4QQIA 3TWXA 2XZTG 1IXVA 5CBOA 2RFMA 2F8YA 4K5BA 4U95D 1MX4A 5BXOA 4UUCA 2ZGGA 5CBNA 3V2OA 5CERB 2QC9A 1YMPA 5EYPF 4A63B 4DX7D 5BXUA 3KEAA 5AN8A 5ENPD 3W9FA 2DZNA 5CECB 4ATZD 5ITZF 3V2XA 4OAUC 1YYHA 3NOGD 3ZU7B 1WDYA 5EILA 5ENOD 5AQ9A 4DX1A 3AJIA 3B7BA 5AAOA 2FO1E 3J5PA 4RLYA 1D9SA 5KNGA 4HQDA 1MX6A 2V5QC 1AP7A 3F6QA 5FINA 2ZGDA 2A5EA 3TWQA 3W9GA 1NFIE 3ZNGA 2HE0A 5ENSD 5AQ7A 4ZHBA 4HI9A 2Y1LE 3J5QB 4QFVA 2PNNA 4U96D 5AARA 2B0OE 4N5QA 4DUIA 3T8KA 1MYOA 3B95A 5AQAA 3DEOA 5ENRD 3NOCD 2XZDG 4CZ2D 4HI8A 4YDYA 5CEDB 1AWCB 4JB8P 2ETAA 2DZOA 3JXIA 3IXEA 1YCSB 4C48B 5EYLA 4ZFHA 1WG0A 4K5AB 2JABA 4BETA 5ENTD 4HRNA 2XEHA 5HRYA 4DX2A 3LJNA 3T9KA 4DX6D 1A5EA 4HLLA 4Z68A 3TWRA 4O60A 3UI2A 2F37A 4NIKA 5JMND 1N0RA 4HB5A 3Q9NC 1IKND 1DCQA 3SO8A 4HBDA 3TWWA 4F1PA 3ZKJA 1K1AA 3EU9A 5AQBA 4LNUD 5KBAA 3DEPA 1N11A 1TR4A 3D9HA 4U8YD 4CYMD 2XEEA 4BEPA 4G8KA 1MJ0A 3V79K 3AAAC 2KXPC 2J8SD 3HRAA 4J7WA 1SVXA 2V4HC 1IHBA 4TUMA 5FIOA 5ENQD 5HS0A 4F6RD 1S70B 3NBNB 3EHRA 4B93B 1OY3D 2AJAA 5D66A
chains in the Genus database with same CATH superfamily
4R7LA 3SBSA 3D9OA 4KBQA 2J9QA 3CK7A 2Y3AA 4ANWA 5HI7A 4HLEA 3HXEA 4K5CA 3U9WA 2BF0X 3MA5A 1MQSA 3QOUA 4HRLA 4GU5A 3FH8A 4HRMB 5KWDA 4DI3A 3O4ZA 2ZU6B 3CVQA 3D9NA 2BTDA 3LY8A 4UWLA 3RO2A 3T5VA 1IXVA 1N4RA 3LKUA 2WPVA 3APDA 3QDNA 3V2XA 3UPVA 4HXIA 3CVPA 1E90A 4X8QA 1MX6A 2XS1A 1QZ2A 4L23A 3QNKA 1HXIA 4MS6A 1OWNA 2WQHA 3CQGB 1OCRE 3T8MA 3QC1A 2P9SG 4AEZC 3EU5A 1VDYA 4UI9K 3WXXA 4U0UA 5EYLA 2WXMA 1E8YA 3OTNA 2VSOE 2Y4TA 2X6KA 1N0RA 1PAQA 4DLQA 2OVFA 4AIFA 2WXRA 3GZ2A 3UT4A 1O1RA 4CYMD 1BPOA 2KXPC 3PZ1A 1Z5SC 1FCHA 1HX8A 1O1TA 4XKBA 4FLHA 2WB2A 3AS4A 3IHVA 1BU9A 4GTPA 3P1UA 4BTAA 4PS7A 4BSXA 5LCWJ 1K3ZD 2P9KG 4MBGA 2J49A 4Q96A 1TJFA 2WQ7A 1NA0A 3I4GA 3RRMB 3AG4E 3PVLA 1N94A 1EF1C 2QFCA 2RD0A 3MKQA 4DX1A 2VSNA 2FO1E 5G55A 3DRAA 2X6FA 5LCWC 4OVVA 4RG6A 1HO8A 4HI9A 3FP3A 2HYZA 3FUFA 2KZTB 3G2SA 5A7DB 4TUUA 3NOCD 5JJ6A 2NC9A 1U3CA 2DYSE 1E7UA 2C0LA 2AWIA 1HFAA 5HQ8A 3L16A 4J8EA 2OVBA 1YA0A 3LY9A 5AIJA 3ABKE 4O60A 3K9IA 4HB5A 4HORA 3SO8A 1NL4A 4UWFA 2XPYA 4U0ZA 2XS8A 2X3MA 4F6RD 1Y8MA 5HKPA 3SBTB 4EQFA 2XCCA 3ENEA 4U63A 3S7JA 3QK0A 3UQ3A 2LO6A 3CHRA 3C3RA 3CEQA 4KMOA 2VGEA 4MLPA 2NYJA 4FC8A 3MGBA 3MCXA 2XZTG 3FU6A 4ILHB 4B8AA 1SA5A 4UUCA 2QC9A 5AN8A 4EHMA 2EILE 5EILA 2IONA 4P29A 3B7UX 1SA4A 4CGVA 4JXTA 2I9CA 2GRLA 1Q2ZA 4F53A 3R9MA 4URKA 4BY6A 4EECA 2GRQB 4FJZA 3ESKA 1MYOA 5ENRD 3CSTA 1N95A 3HXCA 4HI8A 4EBAA 4WWOA 2ZISA 3ULQA 2L9BA 5DIZA 5AJLA 3HVEA 2KM4A 2AXVA 5AYWD 3FUIA 4NIKA 1DVPA 4L2YA 5FZRA 3EIQC 5FT9A 4YDEA 3VTXA 3GZ1A 2C2LA 2VYIA 4I1MA 4MKTA 2QY7A 2KATA 2IOSA 2DCPA 3B7TA 3EIJA 4JHJA 3NBNB 4B93B 3ULEG 1ZU2A 4BSZB 4FU3A 2LAHA 5CMYA 3IBEA 3LVQE 4WNEA 4N3CA 2OEWA 3JYSA 1E7VA 3CK9A 5BV0A 4JW1A 3DPDA 3FHEA 3FUEA 4GTSA 5EIBE 1BI8B 2IY0C 2XCBA 4K03A 3CKCA 5G05C 2MYOA 1N0QA 4G25A 3C98A 4Y6CA 2XGMA 4W9RA 3DWLG 3MZLB 3ISMC 4YVOA 5FWQA 2F8YA 4AVXA 3CVNA 4DX7D 2P9PG 3L17A 4XKCA 5A23A 4PS3A 4AY5A 4TRQA 1UN9A 3FTVA 4E6HA 3Q5MA 2V5QC 4A1GA 2J4DA 2IF4A 5LP0A 4GA2A 5ENSD 5EKQD 3FTUA 3QARA 2R05A 3T8KA 4HOUA 4CZ2D 1SZAA 3L6AA 3MEKA 3TJPA 3IXEA 2MRIA 4GAAA 4EBAG 2VSXE 2IQCA 4HRNA 3LPZA 2AW6A 3KSQA 3G2UA 1OCCE 1WY6A 4N3BA 3ZYQA 1HH8A 5B1BE 3PEUB 3ASHA 5G04C 5AQBA 1FT1A 4I9EA 2EIJE 3D9HA 3L9TA 4BEPA 3G2VA 3ASDA 3ABLE 2A5UA 4GYOA 2FULA 5ENQD 3ZYKA 2Y69E 5JJTA 3RKVA 2XHEA 3SF4A 4DX5D 5JJ7A 4BT9A 3V31A 3SI5A 4APOA 3ZUVB 3TWVA 2WXIA 4A1SA 2Y0BG 4FHKA 3ZHEA 2RKKA 3OXFA 3LY7A 1HG2A 3CHQA 2H6IA 2RFMA 1QBQA 5CERB 4A63B 3L08A 3VTYA 2X6IA 5AQ9A 4UI9J 3SZ7A 4B89A 3F6QA 3ONKA 3ZIMA 1H6OA 3CVYA 3CLJA 2EIKE 4FHJA 4NACA 3G2WA 2P58C 4DUIA 3FTWA 3MYVA 2I6HA 4YDYA 2BEDA 3ZXSA 1U2VG 4N2QA 2ETAA 2DZOA 5JHBA 4V3IA 2XEHA 3NQPA 3LJNA 2L6JA 3JUIA 4GTQA 4LRZA 4CRWA 3UT8A 4XZ4A 3SY2A 1K1AA 4RQIA 4RG9A 5H7PA 2RG8A 3E37A 2YHCA 4DPRA 4BX9A 1XNFA 5FIOA 5FJYA 2LUHA 2PM7A 4G23A 2H6FA 5D66A 5T4YA 4XIFA 3PNLB 1PY1A 3CVXA 2GRNB 2ETBA 4YDWA 2GRPB 3URZA 4F7AA 3ZFWA 3V30A 2OOEA 2P9NG 4F1SA 4DRXE 5BW8C 3LCAA 2WMNA 3TWSA 3ZGQA 4Q69A 2XQ0A 2I2OA 3L13A 1FVFA 1X5BA 3AU5A 2ZGGA 3D9KA 3D9MA 4HVBA 3GW4A 4XE0A 3E34A 4L1BA 4KVOA 3ZW3A 1NFIE 4EPZA 3AU4A 1TNUA 3UINC 2PM6A 3Q4AB 4GZ6A 5BPPA 2PNNA 3RJVA 3ONLA 2E2EA 4GYYA 2FBNA 3FUMA 1OWPA 3I5PA 4ZFHA 3JCKC 4Z68A 3UM1A 3Q73A 4I17A 3E30A 4I43A 1LF8A 4HBDA 2AVPA 2F0YA 4OYSA 3DSSA 5KBAA 5G05J 1TR4A 1JWGA 4GA0A 1OWLA 3AAAC 2LXLA 2V4HC 2VGXB 2LAIA 1OY3D 1DNPA 4YVQC 2YQ8A 1HE8A 3CVLA 1H6PA 3L82A 1JCQA 4HFGA 2J09A 4N2SA 4JA9A 2IFUA 1N52A 3EHQA 4H7YA 2WXFA 1KLXA 2DWZA 5JA4D 3ASFA 4J8FA 3L54A 4KYOB 3Q47B 5KNHD 3LXUX 3I3NA 2IU1A 2J08A 4RSYA 3S7BA 3MKRA 2NSZA 4UWHA 3TGOA 2XEVA 4HOTA 3FY4A 4EZLA 3ZU7B 1WDYA 5FQ8A 4L2LA 1D9SA 2EQXA 3RRUA 3Q7AA 2YNQA 3T5XA 2X6JA 1KZOA 1OCZE 2VGXA 2IOLA 4I1OB 3KD7A 5T3RA 3B95A 3DEOA 3E32A 4CCAA 3FTSA 4PH4B 3KS2A 2HO1A 2J07A 2CHXA 3UT7A 3HHMA 3Q78A 4APFA 3UI2A 1TNYA 4XI9A 2UY1A 3Q9NC 1Z3XA 4GYWA 1QQEA 4GTRA 2UY1B 1KZPA 3FUHA 3PE3A 2VGYA 4G8KA 1NZNA 3D3MA 4U8HA 4AV7A 2CHZA 3UM2A 1HG5A 3ESLA 1K1BA 2LNIA 2QYJA 2DVWA 2JEKA 3LEWA 2X6HA 5CRVA 1UOHA 3FULA 4U8VD 3UM3A 3HDXA 3RIBA 2FO7A 2WVIA 4BESA 3NF1A 4O1PA 2KCKA 1BLXB 3AG3E 1S64A 1X81A 2ILRA 3CQCB 4IULA 3OXLA 3UKUG 5EX3A 2GW1A 1UN8A 1FT2A 4JEUA 2J4BA 4ATZD 4J0UA 3CR3A 3C72A 2A5EA 3FU0A 4KVMA 4TV3A 3W9GA 2Y4UA 4ZHBA 2OV8A 4UQZA 3I4RB 1N9AA 2DIWA 4ILGA 4GMJA 3SGHA 2R5SA 4JB8P 1HF8A 4JPSA 3HXDA 2AXUA 4GTTA 1D8DA 3BG0B 4HLLA 2XRYA 5AENA 3S7DA 4KXKB 1ZB1A 2XPIA 5KCMA 3DSXA 3IEGA 5CRUA 4ATGA 3PRZA 3SQVA 4G24A 5LX8A 2YHEA 5FQ4A 3UMVA 3TXMA 4H7XA 3FWVA 1ELRA 4K0RA 5ARGA 4ME2A 3AG2E 2BKKB 1HS6A 3PNTB 4BFRA 2XENA 3ZRHA 5EIDA 3UXGA 5FQ7A 4LG6A 4GMRA 2WXHA 4O1OA 5B1AE 3FUDA 3JUEA 4QQIA 3AS8A 3PZDA 1MX4A 5T8IA 1IYGA 3LYAA 5EYPF 3AS5A 3IV0A 3C3OA 3S2AA 2GRMA 4WWNA 5FINA 1S63A 1N54A 3FU3A 3UIOC 2WXKA 4N5QA 1KT1A 2CFUA 3L22A 2AXZA 3OAWA 3R7RA 4CEMA 2MHKA 3FEYA 1IQUA 4RVBA 3TWRA 3TG4A 5LOZA 4JL0A 1IKND 1ZBPA 3TWWA 4JZYA 2QYUA 3BU8A 3D9IA 4GCNA 3V79K 2R03A 4GTVA 3CGHA 3BUAA 3SNXA 4TUMA 5DBKA 1JCSA 4U07A 3EHRA 1TJCA 4HOQA 3NAWA 2R59A 3ML8A 2M63A 3HG0D 5G2NA 1LD8A 1Y6IA 4I6JA 3JXJA 1XGWA 3IHYA 2KBXA 3FH5A 1L5JA 4UWGA 3FH7A 3RO3A 1S0PA 3NZSA 5FQ6A 2H6GA 4U95D 4WNDA 3MV3B 4WNFA 5BXUA 2GRRB 2VSYA 2V8SE 5CCLA 4LEUA 4BT8A 3SHFA 4ABNA 4HQDA 5CMWA 4M7CA 2FF4A 3FTXA 3KSLA 3GYZA 4A3VA 1V54E 4UI9C 4QFVA 2VTBB 1GW6A 2B0OE 4DJAA 4UQXA 4PDXA 5KJKA 1FVHA 5CEDB 3FUKA 2WXPA 2P9IG 1KT0A 3ASOE 3VLDA 3T9KA 4J6IA 4FADA 1SZ9A 1NA3A 3U4TA 3CIAA 4F1PA 4LNUD 3PS6A 2ONDA 3PZ3A 5BNWA 1P5QA 4AOFA 2WXOA 2IO3C 3IKOB 3ZEFA 2RFAA 3SFXA 2IO2C 1O5MA 2V0PA 2KCVA 3PUJA 4E85A 3HYMB 4U0SA 4AP2A 4I6GA 4HNAD 1DC2A 3Q75A 2WXQA 1RZ4A 4I9CA 1OUVA 3V2OA 3VLEA 3CHSA 4JA7A 3AJIA 3RAUA 3AG1E 5KNGA 2VQ2A 3TWQA 4JD2G 2FI7A 5B3SE 3C3QA 2Y1LE 3BG1B 5AARA 2VJ8A 3BEEA 1E96B 2XRZA 1QNFA 4WWPA 3FU5A 1K8KG 5BT1A 2CFZA 1YCSB 3R7QA 1WG0A 3PH0C 4GA1A 4DX6D 4N3AA 2F37A 3HXFA 1H2TC 3X2QE 3DSTA 3MJWA 3PDNA 1UW4B 3GZSA 5E76A 5A6CA 1OWMA 3DPYA 3EHNA 3HRAA 3LS8A 1Z3YA 3Q79A 1MZCA 3G2TA 1ELWA 1TNBA 1EYHA 3RK6A 1BD8A 1TYQG 3HVEB 4WUYA 4HOSA 1HZ4A 2KC7A 4WNGA 4LERA 2ETCA 4N5CA 2XGOA 5D0QD 1LD7A 4LNGA 4I6EA 2C0MA 4J8YA 3DBSA 2WQ6A 2XPZA 4GTOA 4GPMA 1OT8A 3FTZA 4GCOA 4M3OA 3D9LA 3EJNA 4K5BA 5BXOA 3ZHEB 1A17A 3DSWA 4O6FA 5D0OD 2IEJA 3NOGD 4FP7A 5ENOD 3B7BA 3HIZA 3OXGA 5AAOA 1UG3A 2V5FA 2L0IA 3CVWA 2GROB 3ZNGA 3KEZA 1N4PA 5AQ7A 2B6CA 4JEHA 1B89A 4U96D 5J90A 4TXPA 1JWFA 4GZDA 1KPSB 3QWPA 1JCRA 4FLBA 3QAQA 4BETA 5ENTD 4C9BB 2LXMA 5FTPA 3TG5A 3FUNA 3SFZA 3PE4A 2WXGA 2CG2A 4XI0A 4NURA 1N11A 4OVUA 3CHMA 1E8ZA 3ZVVA 1SVXA 3JQ0A 3PZ4A 4B8CB 3O48A 4A55A 3RRNB 3CHOA 3UKRG 1UJJA 1ELKA 2VTBA 1MX2A 3MV2B 4G26A 4YDOA 5CEAA 4A3TA 4OAVB 3UIPC 4C0MA 4CDMA 4GB9A 1H19A 2R02A 5CCMA 2WXLA 3MKQB 4HS2A 3QB2A 1FPPA 3TWUA 4G2VA 3ZPJA 3DSVA 3NZUA 2MOWA 1TN7A 4TXQA 5JHAA 5CBOA 3PEVB 2V4LA 5IY5E 3B7RL 3W9FA 4L7TA 1D8EA 2CG3A 4OAUC 1YYHA 4L9PA 3CVVA 1WM5A 4CT4A 4RLYA 5D2MC 4LCTA 2P9UG 5J08A 2ZGDA 2H6HA 1SQMA 4EZJA 2HE0A 3J5QB 2PQNA 2LSUA 1LTXA 4ANUA 3PUKA 4LNBA 1H0AA 5AQAA 4YNDA 1Z6TA 3LVRE 4DLOA 1TNZA 1V55E 4D10C 3JXIA 4ANVA 4PUCA 3VLFA 3EUVA 4ANXA 3S7FA 1NP7A 4KZ0A 5BUZA 3CSFA 5EDSA 2PZIA 4J8SA 5C1DA 1TN8A 1JUQA 4CGWA 4LUNU 1MJ0A 4ACKA 1IHBA 3UX4A 1S70B 4N39A 4DK5A 2AJAA 2R2LA 3R9AB 1WAO1 1H2UA 3FFLA 2UWJG 4AM9A 4LSZE 2DBAA 2L6BA 2XGSA 4IN3B 1H2VC 2GGFA 3TWTA 4IYPA 4G11A 3CV0A 5LFAA 2DYRE 4G8LA 3NB2A 3Q9UC 2I1KA 4ACLA 4NQ0A 1EPUA 3SD5A 4C0EA 1OCOE 1BI7B 3TXNA 3ZXPA 3C5RA 4U04A 1HU3A 2YINA 3QWVA 3U66A 3KAEA 5CECB 3B13A 4B94A 2EIME 3D9PA 2WMOA 2IJGX 4TXRA 3RU0A 4JVSA 3FUJA 3WG7E 1AWCB 1MHQA 3U64A 4K5AB 4GTMA 1A5EA 5JMND 2Q7FA 3LDZA 3PREA 4MRUA 3P2BA 1O1SA 3FEXA 2XEEA 4WAFA 2J8SD 3D9JA 3DSUA 4I1AA 4KZCA 4CDRA 2ZIRA 2R17C 5ANLA 3FTYA 3JQ1A 4NRHB 4J8DA 4BERA 4GZCA 1SW6A 3EDTB 2P2CP 1G3NB 4FA6A 4XX5A 3ULYA 3ZN3A 1RW2A 1NI1A 5KJLA 5FZQA 4AY6A 4I2ZA 5AJDA 2EINE 3HXBA 2F8XK 2BKGA 3TWXA 1UJKA 5CBNA 1U3DA 4Y6WA 1YMPA 3KEAA 2DZNA 3ASNE 3CK8A 3J5PA 4GMLA 4GPKA 3Q49B 4ILIA 2LSVA 3ML9A 3EHMA 4JHKA 2XZDG 2ZXWE 1TN6A 1DCEA 4XEIG 2I1JA 2WM9A 4Q94A 4GZ5A 3ZYLA 3FDHA 4AXHA 2JABA 5ENNA 3QJZA 4UQYA 2E0IA 3N71A 3CVUA 4KT6B 5KJMA 3CHPA 1EDUA 3UM0A 3ZKJA 3EU9A 3Q7FA 1TNOA 4B0ZA 3APFA 3APCA 3DEPA 4U8YD 1E8XA 2OEVA 5E75A 4J7WA 3ASGA 4UWKA 2FEZA 5BV1A 1INZA 3UUXA 3QKYA 3UTMA 1H6KA 3PZ2A 1QYMA 4F3VA 3TL5A 2OCCE 1N4QA 2WXNA 3E33A 1TEZA 5EN5D 4BWRA 5KJNA 2CHWA 5CHEE 3B7SA 3TAXA 4EZKA 2PL2A 3ABME 1JPLA 4I2WA 4PS8A 2HR2A 3DXMG 2X38A 2KCLA 1OXJA 5ARFA 3RSEG 4GZ3A 3QWWA 5C2YA 2BUGA 3CKBA 5ENPD 2P9LG 4U7EB 5ITZF 4JHRA 3Q15A 4BX8A 3ZYMA 5ANRA 1AP7A 2WXJA 2JLBA 4G1TA 4FULA 2A4ZA 2L0TB 1W3BA 2PQRA 1OWOA 1IQRA 4AJWA 1IHGA 3MX3A 3U3WA 4C48B 5FZSA 5HRYA 4DX2A 3SFYA 2HM8A 2QZAA 4FJYA 5M72A 1DCQA 3BQOA 4IRUA 1PC2A 4JC8A 4CDNA 1N4SA 2NXPA 3DXKG 1E8WA 4BTBA 4CT0A 4DI4A 3LJ3A 5G04J 5EX0A 5HS0A 2KZTA 3E4BA
chains in the Genus database with same CATH topology
1BD8A 1K1BA 2QYJA 2DVWA 5HKPA 4LSZE 1MX2A 2RFAA 4DX5D 2L6BA 5CEAA 4BSZB 1BU9A 2BKKB 1UOHA 3UTMA 2ETBA 4OAVB 4BERA 1QYMA 3EHQA 1SW6A 4YDWA 3V31A 2P2CP 4U8VD 1K3ZD 1G3NB 2ETCA 3TWTA 3HG0D 2XENA 4K5CA 2DWZA 5JA4D 5EN5D 4HRLA 4J8YA 4G8LA 3ZUVB 5EIDA 3TWVA 5EIBE 3Q9UC 4HRMB 5KWDA 4HNAD 1BI8B 3UXGA 3V30A 1DC2A 4LG6A 5KNHD 3JXJA 4DRXE 2Y0BG 4BESA 4GMRA 2MYOA 2KBXA 1OT8A 4GPMA 1N0QA 4O1PA 2VGEA 3TWUA 4O1OA 1BLXB 2F8XK 1BI7B 2NYJA 2BKGA 3TWSA 3C5RA 3JUEA 4QQIA 3TWXA 2XZTG 1IXVA 5CBOA 2RFMA 2F8YA 4K5BA 4U95D 1MX4A 5BXOA 4UUCA 2ZGGA 5CBNA 3V2OA 5CERB 2QC9A 1YMPA 5EYPF 4A63B 4DX7D 5BXUA 3KEAA 5AN8A 5ENPD 3W9FA 2DZNA 5CECB 4ATZD 5ITZF 3V2XA 4OAUC 1YYHA 3NOGD 3ZU7B 1WDYA 5EILA 5ENOD 5AQ9A 4DX1A 3AJIA 3B7BA 5AAOA 2FO1E 3J5PA 4RLYA 1D9SA 5KNGA 4HQDA 1MX6A 2V5QC 1AP7A 3F6QA 5FINA 2ZGDA 2A5EA 3TWQA 3W9GA 1NFIE 3ZNGA 2HE0A 5ENSD 5AQ7A 4ZHBA 4HI9A 2Y1LE 3J5QB 4QFVA 2PNNA 4U96D 5AARA 2B0OE 4N5QA 4DUIA 3T8KA 1MYOA 3B95A 5AQAA 3DEOA 5ENRD 3NOCD 2XZDG 4CZ2D 4HI8A 4YDYA 5CEDB 1AWCB 4JB8P 2ETAA 2DZOA 3JXIA 3IXEA 1YCSB 4C48B 5EYLA 4ZFHA 1WG0A 4K5AB 2JABA 4BETA 5ENTD 4HRNA 2XEHA 5HRYA 4DX2A 3LJNA 3T9KA 4DX6D 1A5EA 4HLLA 4Z68A 3TWRA 4O60A 3UI2A 2F37A 4NIKA 5JMND 1N0RA 4HB5A 3Q9NC 1IKND 1DCQA 3SO8A 4HBDA 3TWWA 4F1PA 3ZKJA 1K1AA 3EU9A 5AQBA 4LNUD 5KBAA 3DEPA 1N11A 1TR4A 3D9HA 4U8YD 4CYMD 2XEEA 4BEPA 4G8KA 1MJ0A 3V79K 3AAAC 2KXPC 2J8SD 3HRAA 4J7WA 1SVXA 2V4HC 1IHBA 4TUMA 5FIOA 5ENQD 5HS0A 4F6RD 1S70B 3NBNB 3EHRA 4B93B 1OY3D 2AJAA 5D66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BD8 A;  1K1B A;  2QYJ A;  2DVW A;  5HKP A;  4LSZ E;  1MX2 A;  2RFA A;  4DX5 D;  2L6B A;  5CEA A;  4BSZ B;  1BU9 A;  2BKK B;  1UOH A;  3UTM A;  2ETB A;  4OAV B;  4BER A;  1QYM A;  3EHQ A;  1SW6 A;  4YDW A;  3V31 A;  2P2C P;  4U8V D;  1K3Z D;  1G3N B;  2ETC A;  3TWT A;  3HG0 D;  2XEN A;  4K5C A;  2DWZ A;  5JA4 D;  5EN5 D;  4HRL A;  4J8Y A;  4G8L A;  3ZUV B;  5EID A;  3TWV A;  5EIB E;  3Q9U C;  4HRM B;  5KWD A;  4HNA D;  1BI8 B;  3UXG A;  3V30 A;  1DC2 A;  4LG6 A;  5KNH D;  3JXJ A;  4DRX E;  2Y0B G;  4BES A;  4GMR A;  2MYO A;  2KBX A;  1OT8 A;  4GPM A;  1N0Q A;  4O1P A;  2VGE A;  3TWU A;  4O1O A;  1BLX B;  2F8X K;  1BI7 B;  2NYJ A;  2BKG A;  3TWS A;  3C5R A;  3JUE A;  4QQI A;  3TWX A;  2XZT G;  1IXV A;  5CBO A;  2RFM A;  2F8Y A;  4K5B A;  4U95 D;  1MX4 A;  5BXO A;  4UUC A;  2ZGG A;  5CBN A;  3V2O A;  5CER B;  2QC9 A;  1YMP A;  5EYP F;  4A63 B;  4DX7 D;  5BXU A;  3KEA A;  5AN8 A;  5ENP D;  3W9F A;  2DZN A;  5CEC B;  4ATZ D;  5ITZ F;  3V2X A;  4OAU C;  1YYH A;  3NOG D;  3ZU7 B;  1WDY A;  5EIL A;  5ENO D;  5AQ9 A;  4DX1 A;  3AJI A;  3B7B A;  5AAO A;  2FO1 E;  3J5P A;  4RLY A;  1D9S A;  5KNG A;  4HQD A;  1MX6 A;  2V5Q C;  1AP7 A;  3F6Q A;  5FIN A;  2ZGD A;  2A5E A;  3TWQ A;  3W9G A;  1NFI E;  3ZNG A;  2HE0 A;  5ENS D;  5AQ7 A;  4ZHB A;  4HI9 A;  2Y1L E;  3J5Q B;  4QFV A;  2PNN A;  4U96 D;  5AAR A;  2B0O E;  4N5Q A;  4DUI A;  3T8K A;  1MYO A;  3B95 A;  5AQA A;  3DEO A;  5ENR D;  3NOC D;  2XZD G;  4CZ2 D;  4HI8 A;  4YDY A;  5CED B;  1AWC B;  4JB8 P;  2ETA A;  2DZO A;  3JXI A;  3IXE A;  1YCS B;  4C48 B;  5EYL A;  4ZFH A;  1WG0 A;  4K5A B;  2JAB A;  4BET A;  5ENT D;  4HRN A;  2XEH A;  5HRY A;  4DX2 A;  3LJN A;  3T9K A;  4DX6 D;  1A5E A;  4HLL A;  4Z68 A;  3TWR A;  4O60 A;  3UI2 A;  2F37 A;  4NIK A;  5JMN D;  1N0R A;  4HB5 A;  3Q9N C;  1IKN D;  1DCQ A;  3SO8 A;  4HBD A;  3TWW A;  4F1P A;  3ZKJ A;  1K1A A;  3EU9 A;  5AQB A;  4LNU D;  5KBA A;  3DEP A;  1N11 A;  1TR4 A;  3D9H A;  4U8Y D;  4CYM D;  2XEE A;  4BEP A;  4G8K A;  1MJ0 A;  3V79 K;  3AAA C;  2KXP C;  2J8S D;  3HRA A;  4J7W A;  1SVX A;  2V4H C;  1IHB A;  4TUM A;  5FIO A;  5ENQ D;  5HS0 A;  4F6R D;  1S70 B;  3NBN B;  3EHR A;  4B93 B;  1OY3 D;  2AJA A;  5D66 A; 
#chains in the Genus database with same CATH topology
 4R7L A;  3SBS A;  3D9O A;  4KBQ A;  2J9Q A;  3CK7 A;  2Y3A A;  4ANW A;  5HI7 A;  4HLE A;  3HXE A;  4K5C A;  3U9W A;  2BF0 X;  3MA5 A;  1MQS A;  3QOU A;  4HRL A;  4GU5 A;  3FH8 A;  4HRM B;  5KWD A;  4DI3 A;  3O4Z A;  2ZU6 B;  3CVQ A;  3D9N A;  2BTD A;  3LY8 A;  4UWL A;  3RO2 A;  3T5V A;  1IXV A;  1N4R A;  3LKU A;  2WPV A;  3APD A;  3QDN A;  3V2X A;  3UPV A;  4HXI A;  3CVP A;  1E90 A;  4X8Q A;  1MX6 A;  2XS1 A;  1QZ2 A;  4L23 A;  3QNK A;  1HXI A;  4MS6 A;  1OWN A;  2WQH A;  3CQG B;  1OCR E;  3T8M A;  3QC1 A;  2P9S G;  4AEZ C;  3EU5 A;  1VDY A;  4UI9 K;  3WXX A;  4U0U A;  5EYL A;  2WXM A;  1E8Y A;  3OTN A;  2VSO E;  2Y4T A;  2X6K A;  1N0R A;  1PAQ A;  4DLQ A;  2OVF A;  4AIF A;  2WXR A;  3GZ2 A;  3UT4 A;  1O1R A;  4CYM D;  1BPO A;  2KXP C;  3PZ1 A;  1Z5S C;  1FCH A;  1HX8 A;  1O1T A;  4XKB A;  4FLH A;  2WB2 A;  3AS4 A;  3IHV A;  1BU9 A;  4GTP A;  3P1U A;  4BTA A;  4PS7 A;  4BSX A;  5LCW J;  1K3Z D;  2P9K G;  4MBG A;  2J49 A;  4Q96 A;  1TJF A;  2WQ7 A;  1NA0 A;  3I4G A;  3RRM B;  3AG4 E;  3PVL A;  1N94 A;  1EF1 C;  2QFC A;  2RD0 A;  3MKQ A;  4DX1 A;  2VSN A;  2FO1 E;  5G55 A;  3DRA A;  2X6F A;  5LCW C;  4OVV A;  4RG6 A;  1HO8 A;  4HI9 A;  3FP3 A;  2HYZ A;  3FUF A;  2KZT B;  3G2S A;  5A7D B;  4TUU A;  3NOC D;  5JJ6 A;  2NC9 A;  1U3C A;  2DYS E;  1E7U A;  2C0L A;  2AWI A;  1HFA A;  5HQ8 A;  3L16 A;  4J8E A;  2OVB A;  1YA0 A;  3LY9 A;  5AIJ A;  3ABK E;  4O60 A;  3K9I A;  4HB5 A;  4HOR A;  3SO8 A;  1NL4 A;  4UWF A;  2XPY A;  4U0Z A;  2XS8 A;  2X3M A;  4F6R D;  1Y8M A;  5HKP A;  3SBT B;  4EQF A;  2XCC A;  3ENE A;  4U63 A;  3S7J A;  3QK0 A;  3UQ3 A;  2LO6 A;  3CHR A;  3C3R A;  3CEQ A;  4KMO A;  2VGE A;  4MLP A;  2NYJ A;  4FC8 A;  3MGB A;  3MCX A;  2XZT G;  3FU6 A;  4ILH B;  4B8A A;  1SA5 A;  4UUC A;  2QC9 A;  5AN8 A;  4EHM A;  2EIL E;  5EIL A;  2ION A;  4P29 A;  3B7U X;  1SA4 A;  4CGV A;  4JXT A;  2I9C A;  2GRL A;  1Q2Z A;  4F53 A;  3R9M A;  4URK A;  4BY6 A;  4EEC A;  2GRQ B;  4FJZ A;  3ESK A;  1MYO A;  5ENR D;  3CST A;  1N95 A;  3HXC A;  4HI8 A;  4EBA A;  4WWO A;  2ZIS A;  3ULQ A;  2L9B A;  5DIZ A;  5AJL A;  3HVE A;  2KM4 A;  2AXV A;  5AYW D;  3FUI A;  4NIK A;  1DVP A;  4L2Y A;  5FZR A;  3EIQ C;  5FT9 A;  4YDE A;  3VTX A;  3GZ1 A;  2C2L A;  2VYI A;  4I1M A;  4MKT A;  2QY7 A;  2KAT A;  2IOS A;  2DCP A;  3B7T A;  3EIJ A;  4JHJ A;  3NBN B;  4B93 B;  3ULE G;  1ZU2 A;  4BSZ B;  4FU3 A;  2LAH A;  5CMY A;  3IBE A;  3LVQ E;  4WNE A;  4N3C A;  2OEW A;  3JYS A;  1E7V A;  3CK9 A;  5BV0 A;  4JW1 A;  3DPD A;  3FHE A;  3FUE A;  4GTS A;  5EIB E;  1BI8 B;  2IY0 C;  2XCB A;  4K03 A;  3CKC A;  5G05 C;  2MYO A;  1N0Q A;  4G25 A;  3C98 A;  4Y6C A;  2XGM A;  4W9R A;  3DWL G;  3MZL B;  3ISM C;  4YVO A;  5FWQ A;  2F8Y A;  4AVX A;  3CVN A;  4DX7 D;  2P9P G;  3L17 A;  4XKC A;  5A23 A;  4PS3 A;  4AY5 A;  4TRQ A;  1UN9 A;  3FTV A;  4E6H A;  3Q5M A;  2V5Q C;  4A1G A;  2J4D A;  2IF4 A;  5LP0 A;  4GA2 A;  5ENS D;  5EKQ D;  3FTU A;  3QAR A;  2R05 A;  3T8K A;  4HOU A;  4CZ2 D;  1SZA A;  3L6A A;  3MEK A;  3TJP A;  3IXE A;  2MRI A;  4GAA A;  4EBA G;  2VSX E;  2IQC A;  4HRN A;  3LPZ A;  2AW6 A;  3KSQ A;  3G2U A;  1OCC E;  1WY6 A;  4N3B A;  3ZYQ A;  1HH8 A;  5B1B E;  3PEU B;  3ASH A;  5G04 C;  5AQB A;  1FT1 A;  4I9E A;  2EIJ E;  3D9H A;  3L9T A;  4BEP A;  3G2V A;  3ASD A;  3ABL E;  2A5U A;  4GYO A;  2FUL A;  5ENQ D;  3ZYK A;  2Y69 E;  5JJT A;  3RKV A;  2XHE A;  3SF4 A;  4DX5 D;  5JJ7 A;  4BT9 A;  3V31 A;  3SI5 A;  4APO A;  3ZUV B;  3TWV A;  2WXI A;  4A1S A;  2Y0B G;  4FHK A;  3ZHE A;  2RKK A;  3OXF A;  3LY7 A;  1HG2 A;  3CHQ A;  2H6I A;  2RFM A;  1QBQ A;  5CER B;  4A63 B;  3L08 A;  3VTY A;  2X6I A;  5AQ9 A;  4UI9 J;  3SZ7 A;  4B89 A;  3F6Q A;  3ONK A;  3ZIM A;  1H6O A;  3CVY A;  3CLJ A;  2EIK E;  4FHJ A;  4NAC A;  3G2W A;  2P58 C;  4DUI A;  3FTW A;  3MYV A;  2I6H A;  4YDY A;  2BED A;  3ZXS A;  1U2V G;  4N2Q A;  2ETA A;  2DZO A;  5JHB A;  4V3I A;  2XEH A;  3NQP A;  3LJN A;  2L6J A;  3JUI A;  4GTQ A;  4LRZ A;  4CRW A;  3UT8 A;  4XZ4 A;  3SY2 A;  1K1A A;  4RQI A;  4RG9 A;  5H7P A;  2RG8 A;  3E37 A;  2YHC A;  4DPR A;  4BX9 A;  1XNF A;  5FIO A;  5FJY A;  2LUH A;  2PM7 A;  4G23 A;  2H6F A;  5D66 A;  5T4Y A;  4XIF A;  3PNL B;  1PY1 A;  3CVX A;  2GRN B;  2ETB A;  4YDW A;  2GRP B;  3URZ A;  4F7A A;  3ZFW A;  3V30 A;  2OOE A;  2P9N G;  4F1S A;  4DRX E;  5BW8 C;  3LCA A;  2WMN A;  3TWS A;  3ZGQ A;  4Q69 A;  2XQ0 A;  2I2O A;  3L13 A;  1FVF A;  1X5B A;  3AU5 A;  2ZGG A;  3D9K A;  3D9M A;  4HVB A;  3GW4 A;  4XE0 A;  3E34 A;  4L1B A;  4KVO A;  3ZW3 A;  1NFI E;  4EPZ A;  3AU4 A;  1TNU A;  3UIN C;  2PM6 A;  3Q4A B;  4GZ6 A;  5BPP A;  2PNN A;  3RJV A;  3ONL A;  2E2E A;  4GYY A;  2FBN A;  3FUM A;  1OWP A;  3I5P A;  4ZFH A;  3JCK C;  4Z68 A;  3UM1 A;  3Q73 A;  4I17 A;  3E30 A;  4I43 A;  1LF8 A;  4HBD A;  2AVP A;  2F0Y A;  4OYS A;  3DSS A;  5KBA A;  5G05 J;  1TR4 A;  1JWG A;  4GA0 A;  1OWL A;  3AAA C;  2LXL A;  2V4H C;  2VGX B;  2LAI A;  1OY3 D;  1DNP A;  4YVQ C;  2YQ8 A;  1HE8 A;  3CVL A;  1H6P A;  3L82 A;  1JCQ A;  4HFG A;  2J09 A;  4N2S A;  4JA9 A;  2IFU A;  1N52 A;  3EHQ A;  4H7Y A;  2WXF A;  1KLX A;  2DWZ A;  5JA4 D;  3ASF A;  4J8F A;  3L54 A;  4KYO B;  3Q47 B;  5KNH D;  3LXU X;  3I3N A;  2IU1 A;  2J08 A;  4RSY A;  3S7B A;  3MKR A;  2NSZ A;  4UWH A;  3TGO A;  2XEV A;  4HOT A;  3FY4 A;  4EZL A;  3ZU7 B;  1WDY A;  5FQ8 A;  4L2L A;  1D9S A;  2EQX A;  3RRU A;  3Q7A A;  2YNQ A;  3T5X A;  2X6J A;  1KZO A;  1OCZ E;  2VGX A;  2IOL A;  4I1O B;  3KD7 A;  5T3R A;  3B95 A;  3DEO A;  3E32 A;  4CCA A;  3FTS A;  4PH4 B;  3KS2 A;  2HO1 A;  2J07 A;  2CHX A;  3UT7 A;  3HHM A;  3Q78 A;  4APF A;  3UI2 A;  1TNY A;  4XI9 A;  2UY1 A;  3Q9N C;  1Z3X A;  4GYW A;  1QQE A;  4GTR A;  2UY1 B;  1KZP A;  3FUH A;  3PE3 A;  2VGY A;  4G8K A;  1NZN A;  3D3M A;  4U8H A;  4AV7 A;  2CHZ A;  3UM2 A;  1HG5 A;  3ESL A;  1K1B A;  2LNI A;  2QYJ A;  2DVW A;  2JEK A;  3LEW A;  2X6H A;  5CRV A;  1UOH A;  3FUL A;  4U8V D;  3UM3 A;  3HDX A;  3RIB A;  2FO7 A;  2WVI A;  4BES A;  3NF1 A;  4O1P A;  2KCK A;  1BLX B;  3AG3 E;  1S64 A;  1X81 A;  2ILR A;  3CQC B;  4IUL A;  3OXL A;  3UKU G;  5EX3 A;  2GW1 A;  1UN8 A;  1FT2 A;  4JEU A;  2J4B A;  4ATZ D;  4J0U A;  3CR3 A;  3C72 A;  2A5E A;  3FU0 A;  4KVM A;  4TV3 A;  3W9G A;  2Y4U A;  4ZHB A;  2OV8 A;  4UQZ A;  3I4R B;  1N9A A;  2DIW A;  4ILG A;  4GMJ A;  3SGH A;  2R5S A;  4JB8 P;  1HF8 A;  4JPS A;  3HXD A;  2AXU A;  4GTT A;  1D8D A;  3BG0 B;  4HLL A;  2XRY A;  5AEN A;  3S7D A;  4KXK B;  1ZB1 A;  2XPI A;  5KCM A;  3DSX A;  3IEG A;  5CRU A;  4ATG A;  3PRZ A;  3SQV A;  4G24 A;  5LX8 A;  2YHE A;  5FQ4 A;  3UMV A;  3TXM A;  4H7X A;  3FWV A;  1ELR A;  4K0R A;  5ARG A;  4ME2 A;  3AG2 E;  2BKK B;  1HS6 A;  3PNT B;  4BFR A;  2XEN A;  3ZRH A;  5EID A;  3UXG A;  5FQ7 A;  4LG6 A;  4GMR A;  2WXH A;  4O1O A;  5B1A E;  3FUD A;  3JUE A;  4QQI A;  3AS8 A;  3PZD A;  1MX4 A;  5T8I A;  1IYG A;  3LYA A;  5EYP F;  3AS5 A;  3IV0 A;  3C3O A;  3S2A A;  2GRM A;  4WWN A;  5FIN A;  1S63 A;  1N54 A;  3FU3 A;  3UIO C;  2WXK A;  4N5Q A;  1KT1 A;  2CFU A;  3L22 A;  2AXZ A;  3OAW A;  3R7R A;  4CEM A;  2MHK A;  3FEY A;  1IQU A;  4RVB A;  3TWR A;  3TG4 A;  5LOZ A;  4JL0 A;  1IKN D;  1ZBP A;  3TWW A;  4JZY A;  2QYU A;  3BU8 A;  3D9I A;  4GCN A;  3V79 K;  2R03 A;  4GTV A;  3CGH A;  3BUA A;  3SNX A;  4TUM A;  5DBK A;  1JCS A;  4U07 A;  3EHR A;  1TJC A;  4HOQ A;  3NAW A;  2R59 A;  3ML8 A;  2M63 A;  3HG0 D;  5G2N A;  1LD8 A;  1Y6I A;  4I6J A;  3JXJ A;  1XGW A;  3IHY A;  2KBX A;  3FH5 A;  1L5J A;  4UWG A;  3FH7 A;  3RO3 A;  1S0P A;  3NZS A;  5FQ6 A;  2H6G A;  4U95 D;  4WND A;  3MV3 B;  4WNF A;  5BXU A;  2GRR B;  2VSY A;  2V8S E;  5CCL A;  4LEU A;  4BT8 A;  3SHF A;  4ABN A;  4HQD A;  5CMW A;  4M7C A;  2FF4 A;  3FTX A;  3KSL A;  3GYZ A;  4A3V A;  1V54 E;  4UI9 C;  4QFV A;  2VTB B;  1GW6 A;  2B0O E;  4DJA A;  4UQX A;  4PDX A;  5KJK A;  1FVH A;  5CED B;  3FUK A;  2WXP A;  2P9I G;  1KT0 A;  3ASO E;  3VLD A;  3T9K A;  4J6I A;  4FAD A;  1SZ9 A;  1NA3 A;  3U4T A;  3CIA A;  4F1P A;  4LNU D;  3PS6 A;  2OND A;  3PZ3 A;  5BNW A;  1P5Q A;  4AOF A;  2WXO A;  2IO3 C;  3IKO B;  3ZEF A;  2RFA A;  3SFX A;  2IO2 C;  1O5M A;  2V0P A;  2KCV A;  3PUJ A;  4E85 A;  3HYM B;  4U0S A;  4AP2 A;  4I6G A;  4HNA D;  1DC2 A;  3Q75 A;  2WXQ A;  1RZ4 A;  4I9C A;  1OUV A;  3V2O A;  3VLE A;  3CHS A;  4JA7 A;  3AJI A;  3RAU A;  3AG1 E;  5KNG A;  2VQ2 A;  3TWQ A;  4JD2 G;  2FI7 A;  5B3S E;  3C3Q A;  2Y1L E;  3BG1 B;  5AAR A;  2VJ8 A;  3BEE A;  1E96 B;  2XRZ A;  1QNF A;  4WWP A;  3FU5 A;  1K8K G;  5BT1 A;  2CFZ A;  1YCS B;  3R7Q A;  1WG0 A;  3PH0 C;  4GA1 A;  4DX6 D;  4N3A A;  2F37 A;  3HXF A;  1H2T C;  3X2Q E;  3DST A;  3MJW A;  3PDN A;  1UW4 B;  3GZS A;  5E76 A;  5A6C A;  1OWM A;  3DPY A;  3EHN A;  3HRA A;  3LS8 A;  1Z3Y A;  3Q79 A;  1MZC A;  3G2T A;  1ELW A;  1TNB A;  1EYH A;  3RK6 A;  1BD8 A;  1TYQ G;  3HVE B;  4WUY A;  4HOS A;  1HZ4 A;  2KC7 A;  4WNG A;  4LER A;  2ETC A;  4N5C A;  2XGO A;  5D0Q D;  1LD7 A;  4LNG A;  4I6E A;  2C0M A;  4J8Y A;  3DBS A;  2WQ6 A;  2XPZ A;  4GTO A;  4GPM A;  1OT8 A;  3FTZ A;  4GCO A;  4M3O A;  3D9L A;  3EJN A;  4K5B A;  5BXO A;  3ZHE B;  1A17 A;  3DSW A;  4O6F A;  5D0O D;  2IEJ A;  3NOG D;  4FP7 A;  5ENO D;  3B7B A;  3HIZ A;  3OXG A;  5AAO A;  1UG3 A;  2V5F A;  2L0I A;  3CVW A;  2GRO B;  3ZNG A;  3KEZ A;  1N4P A;  5AQ7 A;  2B6C A;  4JEH A;  1B89 A;  4U96 D;  5J90 A;  4TXP A;  1JWF A;  4GZD A;  1KPS B;  3QWP A;  1JCR A;  4FLB A;  3QAQ A;  4BET A;  5ENT D;  4C9B B;  2LXM A;  5FTP A;  3TG5 A;  3FUN A;  3SFZ A;  3PE4 A;  2WXG A;  2CG2 A;  4XI0 A;  4NUR A;  1N11 A;  4OVU A;  3CHM A;  1E8Z A;  3ZVV A;  1SVX A;  3JQ0 A;  3PZ4 A;  4B8C B;  3O48 A;  4A55 A;  3RRN B;  3CHO A;  3UKR G;  1UJJ A;  1ELK A;  2VTB A;  1MX2 A;  3MV2 B;  4G26 A;  4YDO A;  5CEA A;  4A3T A;  4OAV B;  3UIP C;  4C0M A;  4CDM A;  4GB9 A;  1H19 A;  2R02 A;  5CCM A;  2WXL A;  3MKQ B;  4HS2 A;  3QB2 A;  1FPP A;  3TWU A;  4G2V A;  3ZPJ A;  3DSV A;  3NZU A;  2MOW A;  1TN7 A;  4TXQ A;  5JHA A;  5CBO A;  3PEV B;  2V4L A;  5IY5 E;  3B7R L;  3W9F A;  4L7T A;  1D8E A;  2CG3 A;  4OAU C;  1YYH A;  4L9P A;  3CVV A;  1WM5 A;  4CT4 A;  4RLY A;  5D2M C;  4LCT A;  2P9U G;  5J08 A;  2ZGD A;  2H6H A;  1SQM A;  4EZJ A;  2HE0 A;  3J5Q B;  2PQN A;  2LSU A;  1LTX A;  4ANU A;  3PUK A;  4LNB A;  1H0A A;  5AQA A;  4YND A;  1Z6T A;  3LVR E;  4DLO A;  1TNZ A;  1V55 E;  4D10 C;  3JXI A;  4ANV A;  4PUC A;  3VLF A;  3EUV A;  4ANX A;  3S7F A;  1NP7 A;  4KZ0 A;  5BUZ A;  3CSF A;  5EDS A;  2PZI A;  4J8S A;  5C1D A;  1TN8 A;  1JUQ A;  4CGW A;  4LUN U;  1MJ0 A;  4ACK A;  1IHB A;  3UX4 A;  1S70 B;  4N39 A;  4DK5 A;  2AJA A;  2R2L A;  3R9A B;  1WAO 1;  1H2U A;  3FFL A;  2UWJ G;  4AM9 A;  4LSZ E;  2DBA A;  2L6B A;  2XGS A;  4IN3 B;  1H2V C;  2GGF A;  3TWT A;  4IYP A;  4G11 A;  3CV0 A;  5LFA A;  2DYR E;  4G8L A;  3NB2 A;  3Q9U C;  2I1K A;  4ACL A;  4NQ0 A;  1EPU A;  3SD5 A;  4C0E A;  1OCO E;  1BI7 B;  3TXN A;  3ZXP A;  3C5R A;  4U04 A;  1HU3 A;  2YIN A;  3QWV A;  3U66 A;  3KAE A;  5CEC B;  3B13 A;  4B94 A;  2EIM E;  3D9P A;  2WMO A;  2IJG X;  4TXR A;  3RU0 A;  4JVS A;  3FUJ A;  3WG7 E;  1AWC B;  1MHQ A;  3U64 A;  4K5A B;  4GTM A;  1A5E A;  5JMN D;  2Q7F A;  3LDZ A;  3PRE A;  4MRU A;  3P2B A;  1O1S A;  3FEX A;  2XEE A;  4WAF A;  2J8S D;  3D9J A;  3DSU A;  4I1A A;  4KZC A;  4CDR A;  2ZIR A;  2R17 C;  5ANL A;  3FTY A;  3JQ1 A;  4NRH B;  4J8D A;  4BER A;  4GZC A;  1SW6 A;  3EDT B;  2P2C P;  1G3N B;  4FA6 A;  4XX5 A;  3ULY A;  3ZN3 A;  1RW2 A;  1NI1 A;  5KJL A;  5FZQ A;  4AY6 A;  4I2Z A;  5AJD A;  2EIN E;  3HXB A;  2F8X K;  2BKG A;  3TWX A;  1UJK A;  5CBN A;  1U3D A;  4Y6W A;  1YMP A;  3KEA A;  2DZN A;  3ASN E;  3CK8 A;  3J5P A;  4GML A;  4GPK A;  3Q49 B;  4ILI A;  2LSV A;  3ML9 A;  3EHM A;  4JHK A;  2XZD G;  2ZXW E;  1TN6 A;  1DCE A;  4XEI G;  2I1J A;  2WM9 A;  4Q94 A;  4GZ5 A;  3ZYL A;  3FDH A;  4AXH A;  2JAB A;  5ENN A;  3QJZ A;  4UQY A;  2E0I A;  3N71 A;  3CVU A;  4KT6 B;  5KJM A;  3CHP A;  1EDU A;  3UM0 A;  3ZKJ A;  3EU9 A;  3Q7F A;  1TNO A;  4B0Z A;  3APF A;  3APC A;  3DEP A;  4U8Y D;  1E8X A;  2OEV A;  5E75 A;  4J7W A;  3ASG A;  4UWK A;  2FEZ A;  5BV1 A;  1INZ A;  3UUX A;  3QKY A;  3UTM A;  1H6K A;  3PZ2 A;  1QYM A;  4F3V A;  3TL5 A;  2OCC E;  1N4Q A;  2WXN A;  3E33 A;  1TEZ A;  5EN5 D;  4BWR A;  5KJN A;  2CHW A;  5CHE E;  3B7S A;  3TAX A;  4EZK A;  2PL2 A;  3ABM E;  1JPL A;  4I2W A;  4PS8 A;  2HR2 A;  3DXM G;  2X38 A;  2KCL A;  1OXJ A;  5ARF A;  3RSE G;  4GZ3 A;  3QWW A;  5C2Y A;  2BUG A;  3CKB A;  5ENP D;  2P9L G;  4U7E B;  5ITZ F;  4JHR A;  3Q15 A;  4BX8 A;  3ZYM A;  5ANR A;  1AP7 A;  2WXJ A;  2JLB A;  4G1T A;  4FUL A;  2A4Z A;  2L0T B;  1W3B A;  2PQR A;  1OWO A;  1IQR A;  4AJW A;  1IHG A;  3MX3 A;  3U3W A;  4C48 B;  5FZS A;  5HRY A;  4DX2 A;  3SFY A;  2HM8 A;  2QZA A;  4FJY A;  5M72 A;  1DCQ A;  3BQO A;  4IRU A;  1PC2 A;  4JC8 A;  4CDN A;  1N4S A;  2NXP A;  3DXK G;  1E8W A;  4BTB A;  4CT0 A;  4DI4 A;  3LJ3 A;  5G04 J;  5EX0 A;  5HS0 A;  2KZT A;  3E4B A; 
#chains in the Genus database with same CATH homology
 1BD8 A;  1K1B A;  2QYJ A;  2DVW A;  5HKP A;  4LSZ E;  1MX2 A;  2RFA A;  4DX5 D;  2L6B A;  5CEA A;  4BSZ B;  1BU9 A;  2BKK B;  1UOH A;  3UTM A;  2ETB A;  4OAV B;  4BER A;  1QYM A;  3EHQ A;  1SW6 A;  4YDW A;  3V31 A;  2P2C P;  4U8V D;  1K3Z D;  1G3N B;  2ETC A;  3TWT A;  3HG0 D;  2XEN A;  4K5C A;  2DWZ A;  5JA4 D;  5EN5 D;  4HRL A;  4J8Y A;  4G8L A;  3ZUV B;  5EID A;  3TWV A;  5EIB E;  3Q9U C;  4HRM B;  5KWD A;  4HNA D;  1BI8 B;  3UXG A;  3V30 A;  1DC2 A;  4LG6 A;  5KNH D;  3JXJ A;  4DRX E;  2Y0B G;  4BES A;  4GMR A;  2MYO A;  2KBX A;  1OT8 A;  4GPM A;  1N0Q A;  4O1P A;  2VGE A;  3TWU A;  4O1O A;  1BLX B;  2F8X K;  1BI7 B;  2NYJ A;  2BKG A;  3TWS A;  3C5R A;  3JUE A;  4QQI A;  3TWX A;  2XZT G;  1IXV A;  5CBO A;  2RFM A;  2F8Y A;  4K5B A;  4U95 D;  1MX4 A;  5BXO A;  4UUC A;  2ZGG A;  5CBN A;  3V2O A;  5CER B;  2QC9 A;  1YMP A;  5EYP F;  4A63 B;  4DX7 D;  5BXU A;  3KEA A;  5AN8 A;  5ENP D;  3W9F A;  2DZN A;  5CEC B;  4ATZ D;  5ITZ F;  3V2X A;  4OAU C;  1YYH A;  3NOG D;  3ZU7 B;  1WDY A;  5EIL A;  5ENO D;  5AQ9 A;  4DX1 A;  3AJI A;  3B7B A;  5AAO A;  2FO1 E;  3J5P A;  4RLY A;  1D9S A;  5KNG A;  4HQD A;  1MX6 A;  2V5Q C;  1AP7 A;  3F6Q A;  5FIN A;  2ZGD A;  2A5E A;  3TWQ A;  3W9G A;  1NFI E;  3ZNG A;  2HE0 A;  5ENS D;  5AQ7 A;  4ZHB A;  4HI9 A;  2Y1L E;  3J5Q B;  4QFV A;  2PNN A;  4U96 D;  5AAR A;  2B0O E;  4N5Q A;  4DUI A;  3T8K A;  1MYO A;  3B95 A;  5AQA A;  3DEO A;  5ENR D;  3NOC D;  2XZD G;  4CZ2 D;  4HI8 A;  4YDY A;  5CED B;  1AWC B;  4JB8 P;  2ETA A;  2DZO A;  3JXI A;  3IXE A;  1YCS B;  4C48 B;  5EYL A;  4ZFH A;  1WG0 A;  4K5A B;  2JAB A;  4BET A;  5ENT D;  4HRN A;  2XEH A;  5HRY A;  4DX2 A;  3LJN A;  3T9K A;  4DX6 D;  1A5E A;  4HLL A;  4Z68 A;  3TWR A;  4O60 A;  3UI2 A;  2F37 A;  4NIK A;  5JMN D;  1N0R A;  4HB5 A;  3Q9N C;  1IKN D;  1DCQ A;  3SO8 A;  4HBD A;  3TWW A;  4F1P A;  3ZKJ A;  1K1A A;  3EU9 A;  5AQB A;  4LNU D;  5KBA A;  3DEP A;  1N11 A;  1TR4 A;  3D9H A;  4U8Y D;  4CYM D;  2XEE A;  4BEP A;  4G8K A;  1MJ0 A;  3V79 K;  3AAA C;  2KXP C;  2J8S D;  3HRA A;  4J7W A;  1SVX A;  2V4H C;  1IHB A;  4TUM A;  5FIO A;  5ENQ D;  5HS0 A;  4F6R D;  1S70 B;  3NBN B;  3EHR A;  4B93 B;  1OY3 D;  2AJA A;  5D66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...