1BI8B

Mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
VRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (kinase/inhibitor)
molecule keywords CYCLIN-DEPENDENT KINASE 6
total genus 51
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
B PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bi8B00
5FINA 1BI7B 3DEOA 3EU9A 1DC2A 5EIDA 1DCQA 2Y0BG 3W9GA 2KBXA 2DVWA 4HI8A 3ZKJA 1YCSB 3TWVA 5KBAA 5AQ7A 5AQAA 1IXVA 3D9HA 3EHRA 5EYPF 2L6BA 3UI2A 3J5QB 4LG6A 5CEAA 4B93B 4HBDA 3HG0D 4CZ2D 2NYJA 5FIOA 3HRAA 4HQDA 1MX4A 2XZTG 4U8VD 3C5RA 1WG0A 4GPMA 1QYMA 5ENTD 5ENRD 3NOCD 5KNHD 2DWZA 4TUMA 3W9FA 4K5CA 1WDYA 2ETCA 4G8KA 5ENPD 5CBNA 4BSZB 3JUEA 3TWUA 5D66A 1TR4A 1K1AA 4DX5D 4GMRA 5JA4D 3J5PA 2XEEA 3JXIA 5EYLA 1BU9A 1UOHA 4N5QA 3ZUVB 3V31A 2HE0A 1N0QA 4ZHBA 5EILA 4HRNA 3KEAA 1YMPA 4A63B 4DUIA 5EN5D 4U96D 2FO1E 4ZFHA 4G8LA 5EIBE 4HNAD 3B7BA 3Q9UC 2A5EA 4K5BA 5HS0A 1SW6A 3JXJA 4HI9A 5HKPA 4DX7D 4F1PA 5ITZF 2QC9A 1MJ0A 4J8YA 5AQBA 4C48B 2RFMA 2XENA 4J7WA 4BERA 5BXOA 1A5EA 4DX6D 4Z68A 4HRMB 3ZNGA 5CECB 4DX1A 5AAOA 3TWRA 2DZOA 2XEHA 2BKGA 3UXGA 2QYJA 1OT8A 5JMND 1AP7A 4U8YD 4O60A 4ATZD 3LJNA 4O1OA 5KWDA 3TWWA 1G3NB 1OY3D 4NIKA 2DZNA 5CBOA 2MYOA 1IHBA 3TWSA 1D9SA 2BKKB 3DEPA 2Y1LE 4BESA 2JABA 4F6RD 5ENSD 2ZGGA 5CEDB 1IKND 2F8XK 1SVXA 3Q9NC 4JB8P 3TWTA 4OAUC 5BXUA 3TWQA 4RLYA 2AJAA 2V4HC 3UTMA 1K1BA 3ZU7B 4OAVB 1N0RA 3F6QA 1AWCB 3T9KA 2ETAA 1BLXB 4DX2A 1BI8B 3V30A 1S70B 1MX6A 4K5AB 1YYHA 2KXPC 2ZGDA 4UUCA 2P2CP 3EHQA 4YDWA 3V2OA 4HLLA 4HB5A 3V2XA 4BETA 5ENQD 2J8SD 3NBNB 4QFVA 2V5QC 3NOGD 5AN8A 1N11A 5HRYA 5ENOD 2VGEA 4QQIA 4U95D 5KNGA 3SO8A 1MX2A 5AQ9A 4DRXE 3B95A 4O1PA 3AJIA 4CYMD 1K3ZD 4BEPA 2F37A 4LNUD 4HRLA 1BD8A 4YDYA 3T8KA 2F8YA 3IXEA 2B0OE 3TWXA 2XZDG 2RFAA 5CERB 2ETBA 1MYOA 3V79K 2PNNA 5AARA 3AAAC 1NFIE 4LSZE
chains in the Genus database with same CATH superfamily
3P2BA 4HLEA 2XHEA 3IHVA 5FZSA 3HIZA 4I6GA 4G23A 2QYUA 4RVBA 4B93B 4RG6A 5B3SE 3HRAA 3NZUA 4UQXA 2IFUA 4G11A 3CHMA 3ULYA 5BV1A 2J4DA 2IOSA 3LPZA 3J5PA 2GW1A 4GZCA 2FF4A 2J4BA 5EIBE 4KYOB 1HO8A 3U64A 2QC9A 3MGBA 3B7SA 2X6FA 4AIFA 3C3OA 4AOFA 2XGOA 3LJNA 1UN8A 3ENEA 4MRUA 3ZEFA 3E33A 3C72A 3ZHEB 4HS2A 4JB8P 3L13A 2MOWA 5BT1A 3LVRE 1MHQA 1SZ9A 2I9CA 4HXIA 4AY5A 1E8XA 1RZ4A 3UIOC 3E32A 3V2OA 5C2YA 4P29A 3SY2A 2P9SG 3AG2E 3FU5A 3VTYA 4K0RA 5HRYA 2I1JA 4F3VA 1MX2A 3RIBA 1K3ZD 4N3BA 4NURA 3FU6A 4BSXA 3QJZA 2PNNA 1NFIE 3U4TA 1BI7B 5AENA 4APFA 3MKRA 1OCRE 4LUNU 4WWPA 3FTWA 5FZRA 2Y3AA 4N2QA 1IXVA 3EHRA 3ASOE 3UI2A 3U3WA 3L6AA 4ATGA 5KNHD 2L6JA 1K1AA 1BU9A 3ASFA 3PEVB 4UI9K 3L9TA 1YMPA 4KT6B 5EN5D 5CMWA 3PZ1A 2BF0X 2VGXB 2X3MA 3Q9UC 4TXPA 3UIPC 4JA9A 5HS0A 3ZFWA 1MJ0A 4C48B 2RFMA 4G25A 3MYVA 3SNXA 2DZOA 4JXTA 2XEHA 3EUVA 2F0YA 4U8YD 2LXLA 2XEVA 3TWWA 1TN8A 2ZISA 3NB2A 2Y1LE 1PY1A 1DVPA 2L0IA 3ZU7B 1AWCB 3JYSA 2GRMA 3SF4A 1MX6A 4K5AB 1OXJA 4KXKB 1QQEA 4G24A 4XKCA 2J8SD 4EZLA 1U3CA 2DIWA 3DSVA 4ACLA 4CGWA 3G2TA 1N95A 4GTTA 4B0ZA 2LNIA 4G2VA 4UQYA 4ME2A 4HI8A 2NXPA 2IJGX 4U04A 2R59A 4CDRA 2V0PA 3S7JA 1FCHA 4BTAA 5ENRD 1N94A 3NQPA 4YVQC 3QB2A 4MS6A 3UT4A 4BFRA 4GMRA 1O1RA 1HXIA 5AJLA 2GRQB 5EILA 3ASDA 3IKOB 3G2VA 4RG9A 2IQCA 1Z3XA 3FTSA 4I9EA 4HOQA 2QFCA 3FDHA 3AU5A 3ZYKA 4JEUA 2XCCA 3CSFA 4ABNA 4DX6D 3LDZA 5AAOA 4A1SA 4A3VA 1BPOA 2PZIA 1IHBA 5FQ7A 4KZ0A 4KVOA 2R5SA 1W3BA 3ZXPA 1ELKA 1FVHA 2PL2A 4I6EA 3ZVVA 5KJMA 4EPZA 1E90A 4BETA 3S7BA 3EDTB 5ANRA 3SO8A 3B95A 3KAEA 2F37A 3T8KA 4AY6A 3DSWA 3FUEA 3L22A 3TG4A 1IQUA 1V54E 3SFXA 3EU9A 4UI9J 5CRVA 5BUZA 5IY5E 3TWVA 2WPVA 1B89A 5AQ7A 3CVYA 3AS8A 3Q47B 3VLFA 5G04C 1H0AA 4YNDA 3UM0A 5JA4D 4FLHA 2P9UG 3PZDA 1UN9A 4D10C 3S7FA 4GZ5A 4I2ZA 3DXKG 5ANLA 3TWRA 4AJWA 4GTRA 3RK6A 2I6HA 1LF8A 4F53A 2RKKA 3CHRA 5CEDB 3EU5A 2F8XK 1TN6A 3UM3A 2FI7A 1K1BA 3F6QA 2WXJA 3U9WA 1N4RA 3V30A 1INZA 3QARA 3ASHA 3SHFA 4J6IA 4BT9A 2P9PG 3G2WA 3V2XA 1HF8A 4DRXE 3FH7A 3AJIA 2BEDA 2JLBA 4PH4B 3E34A 1HFAA 1H2TC 5C1DA 4KVMA 5FQ4A 5FINA 3PRZA 2CG2A 3OXGA 2KM4A 3AS5A 4FADA 3FUIA 1XGWA 1OUVA 3KSQA 2E2EA 2Y4UA 1O5MA 3PE3A 4ILIA 3RKVA 2R02A 2WXIA 2DYSE 4YDOA 5FIOA 5G05C 1SA4A 3I4GA 4GTOA 1OCZE 5CMYA 3LY8A 2LO6A 3JUEA 3Q49B 4E85A 2IO3C 4Q94A 1TNUA 1HG2A 1OWLA 1OWMA 2GRNB 4GTQA 3PNTB 4J7WA 4XKBA 4TRQA 4Z68A 3ISMC 4DX1A 5FT9A 5G04J 2BKGA 3UXGA 3FFLA 4UWKA 5BV0A 2WQHA 2DZNA 2OVBA 4U0UA 1HE8A 1UG3A 2GGFA 2ZGGA 2ZXWE 3HXBA 2P9NG 4RLYA 2X38A 3CR3A 4V3IA 3MKQB 1S70B 5T4YA 3QOUA 3UPVA 3ZYQA 1YYHA 4EQFA 3FY4A 3FUKA 5AIJA 2QY7A 3FUNA 5CCMA 4HLLA 3CK8A 2GRRB 4JZYA 4E6HA 2AXZA 2GRPB 4FP7A 3IHYA 2VGEA 3ASGA 3CEQA 3E30A 4WNGA 3FTXA 2L9BA 4H7YA 2XZDG 3TXMA 2WMOA 4G1TA 1KPSB 1NP7A 3APFA 3K9IA 1Y8MA 1DCQA 4TXRA 5FTPA 1WAO1 3Q79A 1S64A 5KBAA 3AU4A 4DPRA 5H7PA 5FZQA 2A5UA 4N5CA 2IF4A 3ZYLA 1HX8A 3KSLA 3C5RA 1WG0A 3PNLB 1QYMA 1OWPA 4BSZB 4Y6WA 3R7QA 2XEEA 1OWOA 5KCMA 3AS4A 1E7UA 3PREA 2FO1E 3BG1B 2VYIA 5J90A 3HVEB 5EX0A 4PDXA 2YQ8A 2WQ7A 1V55E 3S7DA 3ABME 1NL4A 1LD7A 5B1AE 3MZLB 4O1OA 5KWDA 2EIKE 3UT7A 5ENSD 1SVXA 2ZU6B 3HDXA 2C2LA 4JC8A 1N0RA 2XGMA 1BLXB 4C0EA 4LEUA 4UWLA 2P2CP 3GZ2A 4AP2A 1ZBPA 4YDWA 2VSOE 5CCLA 3C3QA 1N54A 2WXKA 4UWHA 3FU0A 3NOGD 3RO2A 2AWIA 2X6JA 5AQ9A 2UY1B 3NZSA 4YDYA 3D9NA 4CDMA 1OCCE 4BX8A 3B7RL 3MJWA 4BX9A 1DC2A 4IYPA 5A23A 2DVWA 3UX4A 4L2YA 2XPIA 3NAWA 4F1SA 1KZOA 3ZXSA 4FLBA 5CEAA 1TNBA 1XNFA 3CSTA 3ZYMA 3AG4E 3FWVA 4TUMA 2WB2A 2A4ZA 4BWRA 4ANUA 1PC2A 2WQ6A 5HI7A 3SI5A 5G05J 1N0QA 2AXUA 4HRNA 3KEAA 4DUIA 1JWGA 3CVLA 1TNOA 4B94A 3B7BA 3RU0A 5FQ8A 4WNEA 4TUUA 1LTXA 1TEZA 2XENA 3G2UA 4HRMB 4GYWA 5M72A 2FO7A 5B1BE 3HXDA 3LY7A 3SGHA 3LXUX 5CHEE 1G3NB 2AVPA 1D9SA 4I2WA 3BG0B 3UKUG 3HYMB 2V4HC 1EDUA 1BI8B 2X6IA 3VLDA 4GMLA 2NC9A 4GTMA 3NBNB 4GA0A 3SBTB 2YINA 3EIJA 3TJPA 5G55A 2XQ0A 2P9KG 3LEWA 3TWXA 3C98A 3L08A 1N9AA 1IHGA 4OVUA 5BW8C 4ANWA 1S0PA 4JD2G 3KD7A 1SQMA 3TXNA 4CGVA 4DI3A 2OCCE 4FHKA 4MLPA 3CK7A 3ZIMA 3PZ4A 2FEZA 2AW6A 4GTPA 3FHEA 3CKBA 3NOCD 3Q15A 3CVWA 4JHRA 5ENPD 4OYSA 4L1BA 2KATA 4LERA 3EJNA 2Y4TA 3T5XA 4FA6A 5A6CA 4J8DA 4G8LA 2J07A 4L7TA 3CVXA 3IV0A 5ITZF 3N71A 4EBAA 3FUMA 2EQXA 5BXOA 2BTDA 5CECB 2KCVA 2OEVA 2R05A 1H6OA 1JWFA 3PZ3A 1TNZA 2BKKB 4XEIG 2JABA 4NACA 4UWGA 4LNBA 4OAVB 4GA2A 1NI1A 1QNFA 2J9QA 2IU1A 3URZA 2P9LG 2IOLA 4HB5A 2IY0C 4GZ6A 1ZB1A 1JCSA 3CIAA 1EYHA 1D8DA 2FULA 5DBKA 3R9MA 4BEPA 2XGSA 2VSXE 4LNUD 4ANXA 4WAFA 3L82A 2J09A 3PH0C 2EIME 4CCAA 3BEEA 2CHXA 4LRZA 2KBXA 4GB9A 4JVSA 4I6JA 3D9MA 3T8MA 2IONA 3MX3A 3UINC 4LG6A 4HBDA 4FULA 3E4BA 4CZ2D 2NYJA 3RO3A 4RSYA 4AEZC 1IQRA 2XCBA 4FC8A 1MZCA 2V5FA 2ETCA 5CBNA 3UT8A 4ILGA 2ILRA 5D66A 4IRUA 3ZUVB 3FTYA 4GTVA 3Q5MA 5KJKA 3FP3A 3SQVA 2A5EA 2EINE 4DX7D 2R03A 4F1PA 4H7XA 5JJTA 3FUJA 3QWVA 2WM9A 3QNKA 4BT8A 3ZW3A 3ESLA 4O60A 4Q96A 3QDNA 2YHEA 1S63A 2VSYA 1IKND 2FBNA 3UMVA 4APOA 2XS8A 1TN7A 2HM8A 5ENQD 5LX8A 4U8HA 4GCOA 3OXLA 3R7RA 2VQ2A 4I1AA 3L17A 3PVLA 3AG3E 3IXEA 3UM2A 3QWPA 4C9BB 2KCKA 1H19A 4EBAG 2LUHA 3CVQA 4RQIA 3Q73A 4J0UA 4KZCA 2LAHA 2OVFA 5KJLA 1HG5A 3RRUA 4URKA 4CRWA 2L6BA 1IYGA 3L16A 3HXCA 3HG0D 1NA0A 3MA5A 3U66A 4U8VD 4B8CB 1JCQA 4KMOA 4EECA 5ENTD 2XRZA 4M3OA 5ENNA 3PS6A 5T3RA 4DI4A 4DX5D 4ZHBA 3CHSA 3FU3A 4U63A 4L2LA 5ARGA 4O6FA 2P9IG 5HKPA 2Y69E 3CHQA 5D0OD 4J8YA 3CQCB 5JJ6A 2ONDA 4HORA 4ACKA 5EX3A 4J8FA 2LAIA 5JMND 1AP7A 2VSNA 2J08A 3BUAA 2WVIA 3Q9NC 5FWQA 3BQOA 2HR2A 1EPUA 3DXMG 4WNDA 3TGOA 2LSUA 3O4ZA 5HQ8A 3GW4A 1PAQA 2QZAA 5JHAA 2PM6A 3PUJA 1U2VG 2CFUA 3O48A 3EHNA 4IULA 1D8EA 5CERB 2ETBA 3V79K 3FULA 4N39A 4KBQA 4FHJA 3DEOA 3I4RB 4HOUA 3FH8A 3MEKA 3CVNA 3Q4AB 5AJDA 5CRUA 4GPMA 4N3AA 1TJCA 1E8WA 3HVEA 2WXHA 3DSUA 3QAQA 5KJNA 2H6HA 2LXMA 1UOHA 3UUXA 1LD8A 2HE0A 4I43A 1MQSA 3SD5A 1WY6A 1JPLA 3PUKA 4F7AA 1HH8A 3PE4A 3NF1A 1H2UA 4PS7A 2XS1A 2ZIRA 1A5EA 3ZNGA 1HU3A 4DLQA 3GZ1A 3MV3B 2I2OA 4WUYA 4GYOA 4XI9A 3FUHA 3D9PA 4X8QA 2V8SE 4CEMA 3EHQA 1K8KG 3DSXA 1JCRA 5ENOD 1A17A 4U95D 5KNGA 3VTXA 1SA5A 2VGYA 1BD8A 4I1MA 1H2VC 4GCNA 3LVQE 4XX5A 2HYZA 4FU3A 4LCTA 2NSZA 4FJYA 3CVVA 3G2SA 4GMJA 3FEXA 3RJVA 2Y0BG 3WXXA 4WWNA 4N2SA 1P5QA 3ONLA 4XI0A 1EF1C 2E0IA 2UWJG 1WM5A 2H6FA 3IEGA 3KEZA 3RAUA 4JHKA 4JEHA 3C3RA 4A63B 5A7DB 3ZN3A 4GYYA 2OOEA 1ELWA 1N52A 2PM7A 1Y6IA 1Z5SC 3LJ3A 3FTVA 4GPKA 4JA7A 2WXFA 4Y6CA 3CK9A 4JL0A 3VLEA 2BUGA 5CBOA 2MYOA 2Q7FA 3TWSA 4HOTA 1KT1A 5AYWD 3TWTA 3I3NA 4OAUC 3E37A 1HS6A 4DX2A 3MCXA 2VTBB 4G26A 4WWOA 1HZ4A 3D9OA 4LNGA 1OCOE 1VDYA 3UQ3A 5ARFA 2V5QC 5E76A 2DBAA 4CYMD 3FUDA 1Q2ZA 4HRLA 4CDNA 2B0OE 4UWFA 1KLXA 5D2MC 3B7TA 3SZ7A 4LSZE 1SZAA 1NA3A 1N4SA 3Q78A 3ZKJA 3DSSA 2YHCA 2R17C 3ABKE 4YVOA 4XIFA 4ANVA 1ELRA 3SFZA 4I17A 3ZHEA 4HVBA 2EILE 1QZ2A 2RG8A 3W9FA 4BTBA 4U7EB 3PDNA 2X6HA 5LCWC 3EIQC 3UM1A 4IN3B 3JCKC 3L54A 4C0MA 1ZU2A 3QWWA 2GRLA 4U96D 1DNPA 3Q7FA 4AVXA 2DYRE 2UY1A 5AQBA 3APCA 4BERA 3ZGQA 2CG3A 3CKCA 3TG5A 5E75A 5T8IA 3SFYA 4PUCA 1NZNA 4CT0A 1L5JA 4K03A 3DEPA 1Z6TA 1U3DA 5BXUA 1H6PA 4U0SA 4A3TA 4HFGA 3T9KA 4NQ0A 4PS8A 2WXGA 3DPDA 1GW6A 2KXPC 2ZGDA 1FT1A 5G2NA 2P58C 5LOZA 3DRAA 3JQ0A 3HHMA 3FEYA 3Q7AA 1QBQA 3CQGB 4GA1A 2GROB 2KCLA 3QK0A 3I5PA 4UI9C 2WXRA 2WXLA 4MBGA 3GYZA 2XRYA 3ZPJA 3W9GA 1E8YA 4XZ4A 1KZPA 5AQAA 2KZTA 1UW4B 4GZ3A 3RRNB 1TJFA 3ESKA 3SBSA 1MX4A 2HO1A 1TYQG 2I1KA 5FQ6A 1N4QA 1JUQA 1WDYA 4JW1A 4ILHB 3OAWA 3AG1E 3APDA 3LKUA 2DCPA 4JHJA 4GAAA 4BY6A 3CVPA 3V31A 3JQ1A 4U07A 2IEJA 2PQNA 3HXEA 3JUIA 3ML9A 2CHZA 2RD0A 4K5BA 4L9PA 4HI9A 5J08A 2VTBA 2XPYA 3ULEG 3QKYA 3DBSA 3D3MA 3EHMA 2QYJA 4AM9A 3UKRG 4ATZD 3OXFA 4NIKA 2AXVA 1FPPA 3RSEG 2CFZA 4Q69A 2AJAA 3UTMA 4J8EA 4JPSA 3DPYA 3PZ2A 2ETAA 3PEUB 1Z3YA 3MKQA 1UJKA 2H6IA 4UUCA 3B13A 3IBEA 2PQRA 3D9LA 4HOSA 5AN8A 1N11A 4TXQA 3ONKA 4FJZA 4I1OB 4QQIA 4A1GA 2VGXA 3CHPA 2OV8A 2C0LA 2F8YA 2RFAA 3DSTA 4B89A 4EHMA 5EIDA 2WXOA 1YCSB 1X81A 3D9HA 3GZSA 2LSVA 2IO2C 4HQDA 2XZTG 2EIJE 2MHKA 5JJ7A 2R2LA 3B7UX 2DWZA 2WXMA 4G8KA 3DWLG 2J49A 3TWUA 5FJYA 4NRHB 3JXIA 3KS2A 4N5QA 3CVUA 3FUFA 3CHOA 3ZRHA 2X6KA 3ML8A 4MKTA 3R9AB 4ZFHA 5LCWJ 4HNAD 4OVVA 2CHWA 1UJJA 3D9KA 3ASNE 3S2AA 1YA0A 4GU5A 4WNFA 3BU8A 5LFAA 5BPPA 4EZKA 3RRMB 4L23A 3CV0A 4GTSA 5JHBA 2L0TB 4F6RD 3TWQA 1O1TA 1TNYA 2MRIA 3ULQA 5DIZA 2VJ8A 5D0QD 3P1UA 2KC7A 1DCEA 3CLJA 2M63A 4N3CA 2B6CA 4B8AA 4GZDA 1O1SA 4QFVA 4O1PA 2WXQA 3D9IA 4CT4A 4AXHA 1MYOA 1RW2A 5BNWA 5AARA 2H6GA 3AAAC 2JEKA 1N4PA 3TL5A 4AV7A 3LYAA 3ABLE 5EDSA 2WMNA 3T5VA 3LCAA 5EYPF 3CGHA 1E8ZA 3J5QB 4A55A 3QC1A 2WXPA 4J8SA 1FT2A 4K5CA 1TR4A 5LP0A 5EYLA 4U0ZA 4R7LA 3MV2B 4DLOA 4M7CA 2V4LA 4DJAA 2C0MA 3TAXA 1SW6A 3JXJA 1E7VA 4DK5A 2XPZA 3LS8A 1OT8A 4I9CA 3Q75A 4TV3A 3HXFA 1OY3D 4BESA 2YNQA 3FTUA 5EKQD 3D9JA 1X5BA 3WG7E 1E96B 1FVFA 2KZTB 1OWNA 3FTZA 4EZJA 4PS3A 3OTNA 4YDEA 4W9RA 3LY9A 4UQZA 1H6KA 1KT0A 3FH5A 2OEWA 4XE0A 3X2QE 2WXNA
chains in the Genus database with same CATH topology
5FINA 1BI7B 3DEOA 3EU9A 1DC2A 5EIDA 1DCQA 2Y0BG 3W9GA 2KBXA 2DVWA 4HI8A 3ZKJA 1YCSB 3TWVA 5KBAA 5AQ7A 5AQAA 1IXVA 3D9HA 3EHRA 5EYPF 2L6BA 3UI2A 3J5QB 4LG6A 5CEAA 4B93B 4HBDA 3HG0D 4CZ2D 2NYJA 5FIOA 3HRAA 4HQDA 1MX4A 2XZTG 4U8VD 3C5RA 1WG0A 4GPMA 1QYMA 5ENTD 5ENRD 3NOCD 5KNHD 2DWZA 4TUMA 3W9FA 4K5CA 1WDYA 2ETCA 4G8KA 5ENPD 5CBNA 4BSZB 3JUEA 3TWUA 5D66A 1TR4A 1K1AA 4DX5D 4GMRA 5JA4D 3J5PA 2XEEA 3JXIA 5EYLA 1BU9A 1UOHA 4N5QA 3ZUVB 3V31A 2HE0A 1N0QA 4ZHBA 5EILA 4HRNA 3KEAA 1YMPA 4A63B 4DUIA 5EN5D 4U96D 2FO1E 4ZFHA 4G8LA 5EIBE 4HNAD 3B7BA 3Q9UC 2A5EA 4K5BA 5HS0A 1SW6A 3JXJA 4HI9A 5HKPA 4DX7D 4F1PA 5ITZF 2QC9A 1MJ0A 4J8YA 5AQBA 4C48B 2RFMA 2XENA 4J7WA 4BERA 5BXOA 1A5EA 4DX6D 4Z68A 4HRMB 3ZNGA 5CECB 4DX1A 5AAOA 3TWRA 2DZOA 2XEHA 2BKGA 3UXGA 2QYJA 1OT8A 5JMND 1AP7A 4U8YD 4O60A 4ATZD 3LJNA 4O1OA 5KWDA 3TWWA 1G3NB 1OY3D 4NIKA 2DZNA 5CBOA 2MYOA 1IHBA 3TWSA 1D9SA 2BKKB 3DEPA 2Y1LE 4BESA 2JABA 4F6RD 5ENSD 2ZGGA 5CEDB 1IKND 2F8XK 1SVXA 3Q9NC 4JB8P 3TWTA 4OAUC 5BXUA 3TWQA 4RLYA 2AJAA 2V4HC 3UTMA 1K1BA 3ZU7B 4OAVB 1N0RA 3F6QA 1AWCB 3T9KA 2ETAA 1BLXB 4DX2A 1BI8B 3V30A 1S70B 1MX6A 4K5AB 1YYHA 2KXPC 2ZGDA 4UUCA 2P2CP 3EHQA 4YDWA 3V2OA 4HLLA 4HB5A 3V2XA 4BETA 5ENQD 2J8SD 3NBNB 4QFVA 2V5QC 3NOGD 5AN8A 1N11A 5HRYA 5ENOD 2VGEA 4QQIA 4U95D 5KNGA 3SO8A 1MX2A 5AQ9A 4DRXE 3B95A 4O1PA 3AJIA 4CYMD 1K3ZD 4BEPA 2F37A 4LNUD 4HRLA 1BD8A 4YDYA 3T8KA 2F8YA 3IXEA 2B0OE 3TWXA 2XZDG 2RFAA 5CERB 2ETBA 1MYOA 3V79K 2PNNA 5AARA 3AAAC 1NFIE 4LSZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FIN A;  1BI7 B;  3DEO A;  3EU9 A;  1DC2 A;  5EID A;  1DCQ A;  2Y0B G;  3W9G A;  2KBX A;  2DVW A;  4HI8 A;  3ZKJ A;  1YCS B;  3TWV A;  5KBA A;  5AQ7 A;  5AQA A;  1IXV A;  3D9H A;  3EHR A;  5EYP F;  2L6B A;  3UI2 A;  3J5Q B;  4LG6 A;  5CEA A;  4B93 B;  4HBD A;  3HG0 D;  4CZ2 D;  2NYJ A;  5FIO A;  3HRA A;  4HQD A;  1MX4 A;  2XZT G;  4U8V D;  3C5R A;  1WG0 A;  4GPM A;  1QYM A;  5ENT D;  5ENR D;  3NOC D;  5KNH D;  2DWZ A;  4TUM A;  3W9F A;  4K5C A;  1WDY A;  2ETC A;  4G8K A;  5ENP D;  5CBN A;  4BSZ B;  3JUE A;  3TWU A;  5D66 A;  1TR4 A;  1K1A A;  4DX5 D;  4GMR A;  5JA4 D;  3J5P A;  2XEE A;  3JXI A;  5EYL A;  1BU9 A;  1UOH A;  4N5Q A;  3ZUV B;  3V31 A;  2HE0 A;  1N0Q A;  4ZHB A;  5EIL A;  4HRN A;  3KEA A;  1YMP A;  4A63 B;  4DUI A;  5EN5 D;  4U96 D;  2FO1 E;  4ZFH A;  4G8L A;  5EIB E;  4HNA D;  3B7B A;  3Q9U C;  2A5E A;  4K5B A;  5HS0 A;  1SW6 A;  3JXJ A;  4HI9 A;  5HKP A;  4DX7 D;  4F1P A;  5ITZ F;  2QC9 A;  1MJ0 A;  4J8Y A;  5AQB A;  4C48 B;  2RFM A;  2XEN A;  4J7W A;  4BER A;  5BXO A;  1A5E A;  4DX6 D;  4Z68 A;  4HRM B;  3ZNG A;  5CEC B;  4DX1 A;  5AAO A;  3TWR A;  2DZO A;  2XEH A;  2BKG A;  3UXG A;  2QYJ A;  1OT8 A;  5JMN D;  1AP7 A;  4U8Y D;  4O60 A;  4ATZ D;  3LJN A;  4O1O A;  5KWD A;  3TWW A;  1G3N B;  1OY3 D;  4NIK A;  2DZN A;  5CBO A;  2MYO A;  1IHB A;  3TWS A;  1D9S A;  2BKK B;  3DEP A;  2Y1L E;  4BES A;  2JAB A;  4F6R D;  5ENS D;  2ZGG A;  5CED B;  1IKN D;  2F8X K;  1SVX A;  3Q9N C;  4JB8 P;  3TWT A;  4OAU C;  5BXU A;  3TWQ A;  4RLY A;  2AJA A;  2V4H C;  3UTM A;  1K1B A;  3ZU7 B;  4OAV B;  1N0R A;  3F6Q A;  1AWC B;  3T9K A;  2ETA A;  1BLX B;  4DX2 A;  1BI8 B;  3V30 A;  1S70 B;  1MX6 A;  4K5A B;  1YYH A;  2KXP C;  2ZGD A;  4UUC A;  2P2C P;  3EHQ A;  4YDW A;  3V2O A;  4HLL A;  4HB5 A;  3V2X A;  4BET A;  5ENQ D;  2J8S D;  3NBN B;  4QFV A;  2V5Q C;  3NOG D;  5AN8 A;  1N11 A;  5HRY A;  5ENO D;  2VGE A;  4QQI A;  4U95 D;  5KNG A;  3SO8 A;  1MX2 A;  5AQ9 A;  4DRX E;  3B95 A;  4O1P A;  3AJI A;  4CYM D;  1K3Z D;  4BEP A;  2F37 A;  4LNU D;  4HRL A;  1BD8 A;  4YDY A;  3T8K A;  2F8Y A;  3IXE A;  2B0O E;  3TWX A;  2XZD G;  2RFA A;  5CER B;  2ETB A;  1MYO A;  3V79 K;  2PNN A;  5AAR A;  3AAA C;  1NFI E;  4LSZ E; 
#chains in the Genus database with same CATH topology
 3P2B A;  4HLE A;  2XHE A;  3IHV A;  5FZS A;  3HIZ A;  4I6G A;  4G23 A;  2QYU A;  4RVB A;  4B93 B;  4RG6 A;  5B3S E;  3HRA A;  3NZU A;  4UQX A;  2IFU A;  4G11 A;  3CHM A;  3ULY A;  5BV1 A;  2J4D A;  2IOS A;  3LPZ A;  3J5P A;  2GW1 A;  4GZC A;  2FF4 A;  2J4B A;  5EIB E;  4KYO B;  1HO8 A;  3U64 A;  2QC9 A;  3MGB A;  3B7S A;  2X6F A;  4AIF A;  3C3O A;  4AOF A;  2XGO A;  3LJN A;  1UN8 A;  3ENE A;  4MRU A;  3ZEF A;  3E33 A;  3C72 A;  3ZHE B;  4HS2 A;  4JB8 P;  3L13 A;  2MOW A;  5BT1 A;  3LVR E;  1MHQ A;  1SZ9 A;  2I9C A;  4HXI A;  4AY5 A;  1E8X A;  1RZ4 A;  3UIO C;  3E32 A;  3V2O A;  5C2Y A;  4P29 A;  3SY2 A;  2P9S G;  3AG2 E;  3FU5 A;  3VTY A;  4K0R A;  5HRY A;  2I1J A;  4F3V A;  1MX2 A;  3RIB A;  1K3Z D;  4N3B A;  4NUR A;  3FU6 A;  4BSX A;  3QJZ A;  2PNN A;  1NFI E;  3U4T A;  1BI7 B;  5AEN A;  4APF A;  3MKR A;  1OCR E;  4LUN U;  4WWP A;  3FTW A;  5FZR A;  2Y3A A;  4N2Q A;  1IXV A;  3EHR A;  3ASO E;  3UI2 A;  3U3W A;  3L6A A;  4ATG A;  5KNH D;  2L6J A;  1K1A A;  1BU9 A;  3ASF A;  3PEV B;  4UI9 K;  3L9T A;  1YMP A;  4KT6 B;  5EN5 D;  5CMW A;  3PZ1 A;  2BF0 X;  2VGX B;  2X3M A;  3Q9U C;  4TXP A;  3UIP C;  4JA9 A;  5HS0 A;  3ZFW A;  1MJ0 A;  4C48 B;  2RFM A;  4G25 A;  3MYV A;  3SNX A;  2DZO A;  4JXT A;  2XEH A;  3EUV A;  2F0Y A;  4U8Y D;  2LXL A;  2XEV A;  3TWW A;  1TN8 A;  2ZIS A;  3NB2 A;  2Y1L E;  1PY1 A;  1DVP A;  2L0I A;  3ZU7 B;  1AWC B;  3JYS A;  2GRM A;  3SF4 A;  1MX6 A;  4K5A B;  1OXJ A;  4KXK B;  1QQE A;  4G24 A;  4XKC A;  2J8S D;  4EZL A;  1U3C A;  2DIW A;  3DSV A;  4ACL A;  4CGW A;  3G2T A;  1N95 A;  4GTT A;  4B0Z A;  2LNI A;  4G2V A;  4UQY A;  4ME2 A;  4HI8 A;  2NXP A;  2IJG X;  4U04 A;  2R59 A;  4CDR A;  2V0P A;  3S7J A;  1FCH A;  4BTA A;  5ENR D;  1N94 A;  3NQP A;  4YVQ C;  3QB2 A;  4MS6 A;  3UT4 A;  4BFR A;  4GMR A;  1O1R A;  1HXI A;  5AJL A;  2GRQ B;  5EIL A;  3ASD A;  3IKO B;  3G2V A;  4RG9 A;  2IQC A;  1Z3X A;  3FTS A;  4I9E A;  4HOQ A;  2QFC A;  3FDH A;  3AU5 A;  3ZYK A;  4JEU A;  2XCC A;  3CSF A;  4ABN A;  4DX6 D;  3LDZ A;  5AAO A;  4A1S A;  4A3V A;  1BPO A;  2PZI A;  1IHB A;  5FQ7 A;  4KZ0 A;  4KVO A;  2R5S A;  1W3B A;  3ZXP A;  1ELK A;  1FVH A;  2PL2 A;  4I6E A;  3ZVV A;  5KJM A;  4EPZ A;  1E90 A;  4BET A;  3S7B A;  3EDT B;  5ANR A;  3SO8 A;  3B95 A;  3KAE A;  2F37 A;  3T8K A;  4AY6 A;  3DSW A;  3FUE A;  3L22 A;  3TG4 A;  1IQU A;  1V54 E;  3SFX A;  3EU9 A;  4UI9 J;  5CRV A;  5BUZ A;  5IY5 E;  3TWV A;  2WPV A;  1B89 A;  5AQ7 A;  3CVY A;  3AS8 A;  3Q47 B;  3VLF A;  5G04 C;  1H0A A;  4YND A;  3UM0 A;  5JA4 D;  4FLH A;  2P9U G;  3PZD A;  1UN9 A;  4D10 C;  3S7F A;  4GZ5 A;  4I2Z A;  3DXK G;  5ANL A;  3TWR A;  4AJW A;  4GTR A;  3RK6 A;  2I6H A;  1LF8 A;  4F53 A;  2RKK A;  3CHR A;  5CED B;  3EU5 A;  2F8X K;  1TN6 A;  3UM3 A;  2FI7 A;  1K1B A;  3F6Q A;  2WXJ A;  3U9W A;  1N4R A;  3V30 A;  1INZ A;  3QAR A;  3ASH A;  3SHF A;  4J6I A;  4BT9 A;  2P9P G;  3G2W A;  3V2X A;  1HF8 A;  4DRX E;  3FH7 A;  3AJI A;  2BED A;  2JLB A;  4PH4 B;  3E34 A;  1HFA A;  1H2T C;  5C1D A;  4KVM A;  5FQ4 A;  5FIN A;  3PRZ A;  2CG2 A;  3OXG A;  2KM4 A;  3AS5 A;  4FAD A;  3FUI A;  1XGW A;  1OUV A;  3KSQ A;  2E2E A;  2Y4U A;  1O5M A;  3PE3 A;  4ILI A;  3RKV A;  2R02 A;  2WXI A;  2DYS E;  4YDO A;  5FIO A;  5G05 C;  1SA4 A;  3I4G A;  4GTO A;  1OCZ E;  5CMY A;  3LY8 A;  2LO6 A;  3JUE A;  3Q49 B;  4E85 A;  2IO3 C;  4Q94 A;  1TNU A;  1HG2 A;  1OWL A;  1OWM A;  2GRN B;  4GTQ A;  3PNT B;  4J7W A;  4XKB A;  4TRQ A;  4Z68 A;  3ISM C;  4DX1 A;  5FT9 A;  5G04 J;  2BKG A;  3UXG A;  3FFL A;  4UWK A;  5BV0 A;  2WQH A;  2DZN A;  2OVB A;  4U0U A;  1HE8 A;  1UG3 A;  2GGF A;  2ZGG A;  2ZXW E;  3HXB A;  2P9N G;  4RLY A;  2X38 A;  3CR3 A;  4V3I A;  3MKQ B;  1S70 B;  5T4Y A;  3QOU A;  3UPV A;  3ZYQ A;  1YYH A;  4EQF A;  3FY4 A;  3FUK A;  5AIJ A;  2QY7 A;  3FUN A;  5CCM A;  4HLL A;  3CK8 A;  2GRR B;  4JZY A;  4E6H A;  2AXZ A;  2GRP B;  4FP7 A;  3IHY A;  2VGE A;  3ASG A;  3CEQ A;  3E30 A;  4WNG A;  3FTX A;  2L9B A;  4H7Y A;  2XZD G;  3TXM A;  2WMO A;  4G1T A;  1KPS B;  1NP7 A;  3APF A;  3K9I A;  1Y8M A;  1DCQ A;  4TXR A;  5FTP A;  1WAO 1;  3Q79 A;  1S64 A;  5KBA A;  3AU4 A;  4DPR A;  5H7P A;  5FZQ A;  2A5U A;  4N5C A;  2IF4 A;  3ZYL A;  1HX8 A;  3KSL A;  3C5R A;  1WG0 A;  3PNL B;  1QYM A;  1OWP A;  4BSZ B;  4Y6W A;  3R7Q A;  2XEE A;  1OWO A;  5KCM A;  3AS4 A;  1E7U A;  3PRE A;  2FO1 E;  3BG1 B;  2VYI A;  5J90 A;  3HVE B;  5EX0 A;  4PDX A;  2YQ8 A;  2WQ7 A;  1V55 E;  3S7D A;  3ABM E;  1NL4 A;  1LD7 A;  5B1A E;  3MZL B;  4O1O A;  5KWD A;  2EIK E;  3UT7 A;  5ENS D;  1SVX A;  2ZU6 B;  3HDX A;  2C2L A;  4JC8 A;  1N0R A;  2XGM A;  1BLX B;  4C0E A;  4LEU A;  4UWL A;  2P2C P;  3GZ2 A;  4AP2 A;  1ZBP A;  4YDW A;  2VSO E;  5CCL A;  3C3Q A;  1N54 A;  2WXK A;  4UWH A;  3FU0 A;  3NOG D;  3RO2 A;  2AWI A;  2X6J A;  5AQ9 A;  2UY1 B;  3NZS A;  4YDY A;  3D9N A;  4CDM A;  1OCC E;  4BX8 A;  3B7R L;  3MJW A;  4BX9 A;  1DC2 A;  4IYP A;  5A23 A;  2DVW A;  3UX4 A;  4L2Y A;  2XPI A;  3NAW A;  4F1S A;  1KZO A;  3ZXS A;  4FLB A;  5CEA A;  1TNB A;  1XNF A;  3CST A;  3ZYM A;  3AG4 E;  3FWV A;  4TUM A;  2WB2 A;  2A4Z A;  4BWR A;  4ANU A;  1PC2 A;  2WQ6 A;  5HI7 A;  3SI5 A;  5G05 J;  1N0Q A;  2AXU A;  4HRN A;  3KEA A;  4DUI A;  1JWG A;  3CVL A;  1TNO A;  4B94 A;  3B7B A;  3RU0 A;  5FQ8 A;  4WNE A;  4TUU A;  1LTX A;  1TEZ A;  2XEN A;  3G2U A;  4HRM B;  4GYW A;  5M72 A;  2FO7 A;  5B1B E;  3HXD A;  3LY7 A;  3SGH A;  3LXU X;  5CHE E;  1G3N B;  2AVP A;  1D9S A;  4I2W A;  3BG0 B;  3UKU G;  3HYM B;  2V4H C;  1EDU A;  1BI8 B;  2X6I A;  3VLD A;  4GML A;  2NC9 A;  4GTM A;  3NBN B;  4GA0 A;  3SBT B;  2YIN A;  3EIJ A;  3TJP A;  5G55 A;  2XQ0 A;  2P9K G;  3LEW A;  3TWX A;  3C98 A;  3L08 A;  1N9A A;  1IHG A;  4OVU A;  5BW8 C;  4ANW A;  1S0P A;  4JD2 G;  3KD7 A;  1SQM A;  3TXN A;  4CGV A;  4DI3 A;  2OCC E;  4FHK A;  4MLP A;  3CK7 A;  3ZIM A;  3PZ4 A;  2FEZ A;  2AW6 A;  4GTP A;  3FHE A;  3CKB A;  3NOC D;  3Q15 A;  3CVW A;  4JHR A;  5ENP D;  4OYS A;  4L1B A;  2KAT A;  4LER A;  3EJN A;  2Y4T A;  3T5X A;  4FA6 A;  5A6C A;  4J8D A;  4G8L A;  2J07 A;  4L7T A;  3CVX A;  3IV0 A;  5ITZ F;  3N71 A;  4EBA A;  3FUM A;  2EQX A;  5BXO A;  2BTD A;  5CEC B;  2KCV A;  2OEV A;  2R05 A;  1H6O A;  1JWF A;  3PZ3 A;  1TNZ A;  2BKK B;  4XEI G;  2JAB A;  4NAC A;  4UWG A;  4LNB A;  4OAV B;  4GA2 A;  1NI1 A;  1QNF A;  2J9Q A;  2IU1 A;  3URZ A;  2P9L G;  2IOL A;  4HB5 A;  2IY0 C;  4GZ6 A;  1ZB1 A;  1JCS A;  3CIA A;  1EYH A;  1D8D A;  2FUL A;  5DBK A;  3R9M A;  4BEP A;  2XGS A;  2VSX E;  4LNU D;  4ANX A;  4WAF A;  3L82 A;  2J09 A;  3PH0 C;  2EIM E;  4CCA A;  3BEE A;  2CHX A;  4LRZ A;  2KBX A;  4GB9 A;  4JVS A;  4I6J A;  3D9M A;  3T8M A;  2ION A;  3MX3 A;  3UIN C;  4LG6 A;  4HBD A;  4FUL A;  3E4B A;  4CZ2 D;  2NYJ A;  3RO3 A;  4RSY A;  4AEZ C;  1IQR A;  2XCB A;  4FC8 A;  1MZC A;  2V5F A;  2ETC A;  5CBN A;  3UT8 A;  4ILG A;  2ILR A;  5D66 A;  4IRU A;  3ZUV B;  3FTY A;  4GTV A;  3Q5M A;  5KJK A;  3FP3 A;  3SQV A;  2A5E A;  2EIN E;  4DX7 D;  2R03 A;  4F1P A;  4H7X A;  5JJT A;  3FUJ A;  3QWV A;  2WM9 A;  3QNK A;  4BT8 A;  3ZW3 A;  3ESL A;  4O60 A;  4Q96 A;  3QDN A;  2YHE A;  1S63 A;  2VSY A;  1IKN D;  2FBN A;  3UMV A;  4APO A;  2XS8 A;  1TN7 A;  2HM8 A;  5ENQ D;  5LX8 A;  4U8H A;  4GCO A;  3OXL A;  3R7R A;  2VQ2 A;  4I1A A;  3L17 A;  3PVL A;  3AG3 E;  3IXE A;  3UM2 A;  3QWP A;  4C9B B;  2KCK A;  1H19 A;  4EBA G;  2LUH A;  3CVQ A;  4RQI A;  3Q73 A;  4J0U A;  4KZC A;  2LAH A;  2OVF A;  5KJL A;  1HG5 A;  3RRU A;  4URK A;  4CRW A;  2L6B A;  1IYG A;  3L16 A;  3HXC A;  3HG0 D;  1NA0 A;  3MA5 A;  3U66 A;  4U8V D;  4B8C B;  1JCQ A;  4KMO A;  4EEC A;  5ENT D;  2XRZ A;  4M3O A;  5ENN A;  3PS6 A;  5T3R A;  4DI4 A;  4DX5 D;  4ZHB A;  3CHS A;  3FU3 A;  4U63 A;  4L2L A;  5ARG A;  4O6F A;  2P9I G;  5HKP A;  2Y69 E;  3CHQ A;  5D0O D;  4J8Y A;  3CQC B;  5JJ6 A;  2OND A;  4HOR A;  4ACK A;  5EX3 A;  4J8F A;  2LAI A;  5JMN D;  1AP7 A;  2VSN A;  2J08 A;  3BUA A;  2WVI A;  3Q9N C;  5FWQ A;  3BQO A;  2HR2 A;  1EPU A;  3DXM G;  4WND A;  3TGO A;  2LSU A;  3O4Z A;  5HQ8 A;  3GW4 A;  1PAQ A;  2QZA A;  5JHA A;  2PM6 A;  3PUJ A;  1U2V G;  2CFU A;  3O48 A;  3EHN A;  4IUL A;  1D8E A;  5CER B;  2ETB A;  3V79 K;  3FUL A;  4N39 A;  4KBQ A;  4FHJ A;  3DEO A;  3I4R B;  4HOU A;  3FH8 A;  3MEK A;  3CVN A;  3Q4A B;  5AJD A;  5CRU A;  4GPM A;  4N3A A;  1TJC A;  1E8W A;  3HVE A;  2WXH A;  3DSU A;  3QAQ A;  5KJN A;  2H6H A;  2LXM A;  1UOH A;  3UUX A;  1LD8 A;  2HE0 A;  4I43 A;  1MQS A;  3SD5 A;  1WY6 A;  1JPL A;  3PUK A;  4F7A A;  1HH8 A;  3PE4 A;  3NF1 A;  1H2U A;  4PS7 A;  2XS1 A;  2ZIR A;  1A5E A;  3ZNG A;  1HU3 A;  4DLQ A;  3GZ1 A;  3MV3 B;  2I2O A;  4WUY A;  4GYO A;  4XI9 A;  3FUH A;  3D9P A;  4X8Q A;  2V8S E;  4CEM A;  3EHQ A;  1K8K G;  3DSX A;  1JCR A;  5ENO D;  1A17 A;  4U95 D;  5KNG A;  3VTX A;  1SA5 A;  2VGY A;  1BD8 A;  4I1M A;  1H2V C;  4GCN A;  3LVQ E;  4XX5 A;  2HYZ A;  4FU3 A;  4LCT A;  2NSZ A;  4FJY A;  3CVV A;  3G2S A;  4GMJ A;  3FEX A;  3RJV A;  2Y0B G;  3WXX A;  4WWN A;  4N2S A;  1P5Q A;  3ONL A;  4XI0 A;  1EF1 C;  2E0I A;  2UWJ G;  1WM5 A;  2H6F A;  3IEG A;  3KEZ A;  3RAU A;  4JHK A;  4JEH A;  3C3R A;  4A63 B;  5A7D B;  3ZN3 A;  4GYY A;  2OOE A;  1ELW A;  1N52 A;  2PM7 A;  1Y6I A;  1Z5S C;  3LJ3 A;  3FTV A;  4GPK A;  4JA7 A;  2WXF A;  4Y6C A;  3CK9 A;  4JL0 A;  3VLE A;  2BUG A;  5CBO A;  2MYO A;  2Q7F A;  3TWS A;  4HOT A;  1KT1 A;  5AYW D;  3TWT A;  3I3N A;  4OAU C;  3E37 A;  1HS6 A;  4DX2 A;  3MCX A;  2VTB B;  4G26 A;  4WWO A;  1HZ4 A;  3D9O A;  4LNG A;  1OCO E;  1VDY A;  3UQ3 A;  5ARF A;  2V5Q C;  5E76 A;  2DBA A;  4CYM D;  3FUD A;  1Q2Z A;  4HRL A;  4CDN A;  2B0O E;  4UWF A;  1KLX A;  5D2M C;  3B7T A;  3SZ7 A;  4LSZ E;  1SZA A;  1NA3 A;  1N4S A;  3Q78 A;  3ZKJ A;  3DSS A;  2YHC A;  2R17 C;  3ABK E;  4YVO A;  4XIF A;  4ANV A;  1ELR A;  3SFZ A;  4I17 A;  3ZHE A;  4HVB A;  2EIL E;  1QZ2 A;  2RG8 A;  3W9F A;  4BTB A;  4U7E B;  3PDN A;  2X6H A;  5LCW C;  3EIQ C;  3UM1 A;  4IN3 B;  3JCK C;  3L54 A;  4C0M A;  1ZU2 A;  3QWW A;  2GRL A;  4U96 D;  1DNP A;  3Q7F A;  4AVX A;  2DYR E;  2UY1 A;  5AQB A;  3APC A;  4BER A;  3ZGQ A;  2CG3 A;  3CKC A;  3TG5 A;  5E75 A;  5T8I A;  3SFY A;  4PUC A;  1NZN A;  4CT0 A;  1L5J A;  4K03 A;  3DEP A;  1Z6T A;  1U3D A;  5BXU A;  1H6P A;  4U0S A;  4A3T A;  4HFG A;  3T9K A;  4NQ0 A;  4PS8 A;  2WXG A;  3DPD A;  1GW6 A;  2KXP C;  2ZGD A;  1FT1 A;  5G2N A;  2P58 C;  5LOZ A;  3DRA A;  3JQ0 A;  3HHM A;  3FEY A;  3Q7A A;  1QBQ A;  3CQG B;  4GA1 A;  2GRO B;  2KCL A;  3QK0 A;  3I5P A;  4UI9 C;  2WXR A;  2WXL A;  4MBG A;  3GYZ A;  2XRY A;  3ZPJ A;  3W9G A;  1E8Y A;  4XZ4 A;  1KZP A;  5AQA A;  2KZT A;  1UW4 B;  4GZ3 A;  3RRN B;  1TJF A;  3ESK A;  3SBS A;  1MX4 A;  2HO1 A;  1TYQ G;  2I1K A;  5FQ6 A;  1N4Q A;  1JUQ A;  1WDY A;  4JW1 A;  4ILH B;  3OAW A;  3AG1 E;  3APD A;  3LKU A;  2DCP A;  4JHJ A;  4GAA A;  4BY6 A;  3CVP A;  3V31 A;  3JQ1 A;  4U07 A;  2IEJ A;  2PQN A;  3HXE A;  3JUI A;  3ML9 A;  2CHZ A;  2RD0 A;  4K5B A;  4L9P A;  4HI9 A;  5J08 A;  2VTB A;  2XPY A;  3ULE G;  3QKY A;  3DBS A;  3D3M A;  3EHM A;  2QYJ A;  4AM9 A;  3UKR G;  4ATZ D;  3OXF A;  4NIK A;  2AXV A;  1FPP A;  3RSE G;  2CFZ A;  4Q69 A;  2AJA A;  3UTM A;  4J8E A;  4JPS A;  3DPY A;  3PZ2 A;  2ETA A;  3PEU B;  1Z3Y A;  3MKQ A;  1UJK A;  2H6I A;  4UUC A;  3B13 A;  3IBE A;  2PQR A;  3D9L A;  4HOS A;  5AN8 A;  1N11 A;  4TXQ A;  3ONK A;  4FJZ A;  4I1O B;  4QQI A;  4A1G A;  2VGX A;  3CHP A;  2OV8 A;  2C0L A;  2F8Y A;  2RFA A;  3DST A;  4B89 A;  4EHM A;  5EID A;  2WXO A;  1YCS B;  1X81 A;  3D9H A;  3GZS A;  2LSV A;  2IO2 C;  4HQD A;  2XZT G;  2EIJ E;  2MHK A;  5JJ7 A;  2R2L A;  3B7U X;  2DWZ A;  2WXM A;  4G8K A;  3DWL G;  2J49 A;  3TWU A;  5FJY A;  4NRH B;  3JXI A;  3KS2 A;  4N5Q A;  3CVU A;  3FUF A;  3CHO A;  3ZRH A;  2X6K A;  3ML8 A;  4MKT A;  3R9A B;  4ZFH A;  5LCW J;  4HNA D;  4OVV A;  2CHW A;  1UJJ A;  3D9K A;  3ASN E;  3S2A A;  1YA0 A;  4GU5 A;  4WNF A;  3BU8 A;  5LFA A;  5BPP A;  4EZK A;  3RRM B;  4L23 A;  3CV0 A;  4GTS A;  5JHB A;  2L0T B;  4F6R D;  3TWQ A;  1O1T A;  1TNY A;  2MRI A;  3ULQ A;  5DIZ A;  2VJ8 A;  5D0Q D;  3P1U A;  2KC7 A;  1DCE A;  3CLJ A;  2M63 A;  4N3C A;  2B6C A;  4B8A A;  4GZD A;  1O1S A;  4QFV A;  4O1P A;  2WXQ A;  3D9I A;  4CT4 A;  4AXH A;  1MYO A;  1RW2 A;  5BNW A;  5AAR A;  2H6G A;  3AAA C;  2JEK A;  1N4P A;  3TL5 A;  4AV7 A;  3LYA A;  3ABL E;  5EDS A;  2WMN A;  3T5V A;  3LCA A;  5EYP F;  3CGH A;  1E8Z A;  3J5Q B;  4A55 A;  3QC1 A;  2WXP A;  4J8S A;  1FT2 A;  4K5C A;  1TR4 A;  5LP0 A;  5EYL A;  4U0Z A;  4R7L A;  3MV2 B;  4DLO A;  4M7C A;  2V4L A;  4DJA A;  2C0M A;  3TAX A;  1SW6 A;  3JXJ A;  1E7V A;  4DK5 A;  2XPZ A;  3LS8 A;  1OT8 A;  4I9C A;  3Q75 A;  4TV3 A;  3HXF A;  1OY3 D;  4BES A;  2YNQ A;  3FTU A;  5EKQ D;  3D9J A;  1X5B A;  3WG7 E;  1E96 B;  1FVF A;  2KZT B;  1OWN A;  3FTZ A;  4EZJ A;  4PS3 A;  3OTN A;  4YDE A;  4W9R A;  3LY9 A;  4UQZ A;  1H6K A;  1KT0 A;  3FH5 A;  2OEW A;  4XE0 A;  3X2Q E;  2WXN A; 
#chains in the Genus database with same CATH homology
 5FIN A;  1BI7 B;  3DEO A;  3EU9 A;  1DC2 A;  5EID A;  1DCQ A;  2Y0B G;  3W9G A;  2KBX A;  2DVW A;  4HI8 A;  3ZKJ A;  1YCS B;  3TWV A;  5KBA A;  5AQ7 A;  5AQA A;  1IXV A;  3D9H A;  3EHR A;  5EYP F;  2L6B A;  3UI2 A;  3J5Q B;  4LG6 A;  5CEA A;  4B93 B;  4HBD A;  3HG0 D;  4CZ2 D;  2NYJ A;  5FIO A;  3HRA A;  4HQD A;  1MX4 A;  2XZT G;  4U8V D;  3C5R A;  1WG0 A;  4GPM A;  1QYM A;  5ENT D;  5ENR D;  3NOC D;  5KNH D;  2DWZ A;  4TUM A;  3W9F A;  4K5C A;  1WDY A;  2ETC A;  4G8K A;  5ENP D;  5CBN A;  4BSZ B;  3JUE A;  3TWU A;  5D66 A;  1TR4 A;  1K1A A;  4DX5 D;  4GMR A;  5JA4 D;  3J5P A;  2XEE A;  3JXI A;  5EYL A;  1BU9 A;  1UOH A;  4N5Q A;  3ZUV B;  3V31 A;  2HE0 A;  1N0Q A;  4ZHB A;  5EIL A;  4HRN A;  3KEA A;  1YMP A;  4A63 B;  4DUI A;  5EN5 D;  4U96 D;  2FO1 E;  4ZFH A;  4G8L A;  5EIB E;  4HNA D;  3B7B A;  3Q9U C;  2A5E A;  4K5B A;  5HS0 A;  1SW6 A;  3JXJ A;  4HI9 A;  5HKP A;  4DX7 D;  4F1P A;  5ITZ F;  2QC9 A;  1MJ0 A;  4J8Y A;  5AQB A;  4C48 B;  2RFM A;  2XEN A;  4J7W A;  4BER A;  5BXO A;  1A5E A;  4DX6 D;  4Z68 A;  4HRM B;  3ZNG A;  5CEC B;  4DX1 A;  5AAO A;  3TWR A;  2DZO A;  2XEH A;  2BKG A;  3UXG A;  2QYJ A;  1OT8 A;  5JMN D;  1AP7 A;  4U8Y D;  4O60 A;  4ATZ D;  3LJN A;  4O1O A;  5KWD A;  3TWW A;  1G3N B;  1OY3 D;  4NIK A;  2DZN A;  5CBO A;  2MYO A;  1IHB A;  3TWS A;  1D9S A;  2BKK B;  3DEP A;  2Y1L E;  4BES A;  2JAB A;  4F6R D;  5ENS D;  2ZGG A;  5CED B;  1IKN D;  2F8X K;  1SVX A;  3Q9N C;  4JB8 P;  3TWT A;  4OAU C;  5BXU A;  3TWQ A;  4RLY A;  2AJA A;  2V4H C;  3UTM A;  1K1B A;  3ZU7 B;  4OAV B;  1N0R A;  3F6Q A;  1AWC B;  3T9K A;  2ETA A;  1BLX B;  4DX2 A;  1BI8 B;  3V30 A;  1S70 B;  1MX6 A;  4K5A B;  1YYH A;  2KXP C;  2ZGD A;  4UUC A;  2P2C P;  3EHQ A;  4YDW A;  3V2O A;  4HLL A;  4HB5 A;  3V2X A;  4BET A;  5ENQ D;  2J8S D;  3NBN B;  4QFV A;  2V5Q C;  3NOG D;  5AN8 A;  1N11 A;  5HRY A;  5ENO D;  2VGE A;  4QQI A;  4U95 D;  5KNG A;  3SO8 A;  1MX2 A;  5AQ9 A;  4DRX E;  3B95 A;  4O1P A;  3AJI A;  4CYM D;  1K3Z D;  4BEP A;  2F37 A;  4LNU D;  4HRL A;  1BD8 A;  4YDY A;  3T8K A;  2F8Y A;  3IXE A;  2B0O E;  3TWX A;  2XZD G;  2RFA A;  5CER B;  2ETB A;  1MYO A;  3V79 K;  2PNN A;  5AAR A;  3AAA C;  1NFI E;  4LSZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...