1BI8B

Mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
VRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (kinase/inhibitor)
total genus 51
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
B PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bi8B00
3JUEA 4DX1A 3C5RA 5AAOA 2DVWA 1YCSB 2F37A 4DX2A 4DRXE 5ENPD 4GMRA 4QQIA 5AN8A 4O1OA 4U96D 5ENTD 5HS0A 1IXVA 2ETCA 5AQAA 3V30A 2BKGA 3J5PA 4O60A 5CBNA 2ETBA 3D9HA 4U8YD 1QYMA 1DC2A 1MX6A 4A63B 2MYOA 2PNNA 3UI2A 3UTMA 4N5QA 2Y0BG 2KXPC 2XZDG 5CECB 4K5CA 4J8YA 5EN5D 5HRYA 3W9GA 2RFMA 5KNHD 3ZUVB 4BETA 3T9KA 3LJNA 4YDWA 1BI7B 1IHBA 1S70B 5KWDA 1AP7A 2QC9A 4GPMA 3SO8A 3Q9NC 4HQDA 3ZU7B 5JMND 5EYPF 1TR4A 5AQBA 5FIOA 4ZHBA 3NOGD 1OT8A 2P2CP 1BLXB 5ENOD 1SVXA 4O1PA 5ENRD 2Y1LE 4U95D 3EU9A 3ZNGA 3HG0D 5CEDB 4OAUC 5EIBE 3DEOA 1DCQA 4BERA 2HE0A 4HLLA 4DX5D 2JABA 2ZGGA 2NYJA 1MX4A 3AAAC 1G3NB 5EILA 2XZTG 2XEEA 2RFAA 5AQ9A 4OAVB 2V5QC 3B95A 3JXIA 4F1PA 3TWWA 5BXUA 3J5QB 2V4HC 5EIDA 1SW6A 4HBDA 1UOHA 2DWZA 4Z68A 3V31A 4RLYA 3JXJA 5AARA 1MX2A 1OY3D 1NFIE 4HI8A 4JB8P 1YMPA 4LSZE 5HKPA 3V2OA 2ETAA 4BESA 3TWRA 2ZGDA 3V79K 1WG0A 1WDYA 1K1AA 4LNUD 2XENA 3TWTA 1D9SA 4HNAD 2BKKB 5BXOA 4TUMA 3T8KA 1N0QA 2DZOA 4U8VD 3IXEA 2DZNA 3DEPA 2KBXA 4BSZB 4CYMD 5CBOA 2AJAA 1K3ZD 2XEHA 3NBNB 2FO1E 5KNGA 4HRLA 3NOCD 3HRAA 5D66A 1BI8B 1BD8A 4NIKA 2QYJA 3F6QA 4HI9A 5JA4D 5KBAA 1MYOA 1BU9A 4UUCA 3W9FA 1A5EA 1N0RA 4DX7D 4K5AB 1YYHA 4ZFHA 4G8LA 4J7WA 5CEAA 4G8KA 4CZ2D 4LG6A 5AQ7A 3TWUA 2VGEA 5EYLA 5ENSD 1MJ0A 4ATZD 2J8SD 5FINA 4BEPA 4YDYA 4K5BA 2A5EA 3TWQA 3EHRA 3TWVA 1N11A 4HRMB 1K1BA 3AJIA 3Q9UC 3UXGA 1AWCB 4QFVA 4C48B 3V2XA 3KEAA 4HB5A 5ENQD 3TWXA 4DX6D 2B0OE 3EHQA 5CERB 4B93B 4F6RD 1IKND 2F8XK 2F8YA 2L6BA 5ITZF 3TWSA 4HRNA 3B7BA 4DUIA 3ZKJA
chains in the Genus database with same CATH superfamily
3LY8A 4L2LA 3HDXA 4U96D 2IF4A 1KPSB 1H19A 5BT1A 4XKBA 4EPZA 5CMWA 2HO1A 4BT8A 3HXBA 4TRQA 3ZPJA 2Y0BG 2J09A 2Y69E 2P9SG 3FUFA 2A5UA 4UWFA 2OVFA 3TXMA 4LCTA 3Q9NC 1TR4A 4PS8A 2NC9A 1H0AA 2P2CP 4O1PA 3HG0D 4JEUA 1H2TC 3FUJA 3Q79A 1E96B 3MGBA 3CK8A 5JHAA 4F1PA 3I4GA 3TWWA 5BXUA 4AVXA 1OWMA 3QAQA 1TJFA 3FP3A 1HE8A 4XE0A 2ZXWE 4BY6A 1KT1A 3RU0A 4DK5A 3TGOA 4CYMD 1NL4A 3IEGA 3UPVA 2QFCA 3ZVVA 2VGEA 1ZU2A 5EYLA 4YDYA 3EIJA 2OEWA 5ARGA 4JW1A 3P2BA 3DSVA 3KSLA 4ANXA 3MKRA 4B93B 4W9RA 3L9TA 1HFAA 1LF8A 4IYPA 5CMYA 2GROB 5ENTD 2VSXE 3JUIA 2ETCA 4WNDA 3TXNA 3L22A 1A17A 1OWPA 3PZ2A 3FTSA 4LEUA 2J49A 3G2TA 4AY5A 4NRHB 3C3OA 4GPMA 3CKCA 2IOLA 1W3BA 1UN9A 1OT8A 2P58C 5D0QD 1DCQA 4BERA 3DRAA 1MX4A 5EILA 3BQOA 4FADA 1D8EA 4GZCA 3T5VA 3R9MA 1SW6A 3E37A 5M72A 2AXUA 4CGWA 2WQ7A 5T3RA 3TWRA 2VSYA 2AVPA 4PS3A 4WNGA 3K9IA 3SY2A 2FO1E 3CHPA 4TUUA 4HORA 1BU9A 3EDTB 4N2QA 1N0RA 4GZ6A 1P5QA 3TG4A 4ILHB 3LKUA 5BV0A 3Q4AB 4UI9C 3I5PA 2LNIA 3FH7A 5FZQA 3DWLG 3Q47B 4E85A 5LCWJ 2PM6A 2MRIA 2WB2A 2DVWA 5KJKA 2R05A 3CHSA 4OVVA 3DSTA 4N5CA 3EU5A 3B7RL 3VTXA 2P9UG 2EIKE 2WXKA 4U8YD 4GTOA 3LPZA 5B3SE 3RK6A 3FU0A 4Y6CA 3FFLA 1QZ2A 1Q2ZA 1MQSA 2VGXB 2J08A 5KWDA 3HVEB 2R02A 1E8ZA 3UT8A 3UM2A 2EINE 2HE0A 3EIQC 3IKOB 3ZGQA 4DX5D 4UI9K 4M7CA 4TXQA 2XEEA 4L9PA 4DI3A 4ACLA 3JXJA 3UM1A 3DXKG 4BT9A 3L54A 3TWTA 2WQHA 1QQEA 3E34A 3SFZA 3MKQA 2HYZA 1OCRE 4MBGA 3ZYMA 4AP2A 5CCLA 2HR2A 4FA6A 5ARFA 3JCKC 3AU5A 3HXEA 4XI0A 2J9QA 2B0OE 2C2LA 1N4RA 3QWPA 2IU1A 5CRVA 1JCRA 3ZHEA 3KS2A 3MZLB 4PDXA 2F37A 1H2UA 5HS0A 2BKGA 3J5PA 3MCXA 1IYGA 4HOQA 3L16A 3RAUA 2X6IA 2KXPC 3ONLA 3X2QE 3ENEA 1ZBPA 1N52A 4J8SA 3BG1B 1SQMA 4JHKA 1S70B 3FTYA 1Y6IA 3S7DA 2R17C 3C72A 3URZA 1ELRA 4JL0A 3LEWA 4GTTA 4K0RA 1U3DA 4KZCA 1PC2A 3U3WA 4L2YA 3C3QA 2WXRA 3SBSA 1TN8A 2XRZA 3CVPA 3SHFA 4UQZA 4YVQC 4GU5A 3HRAA 1EF1C 3L08A 1MYOA 5CEAA 3SGHA 2X3MA 3FUHA 2I1JA 4HOUA 5D2MC 2PQNA 4LNBA 2DYSE 4ACKA 2AXZA 4G26A 4Y6WA 5CERB 4JHRA 3UKUG 3ULQA 4N3CA 4DI4A 5EX0A 4U63A 4HOTA 4JVSA 5JHBA 3APFA 3PUKA 4X8QA 3FY4A 1N4QA 3SD5A 4EECA 4XEIG 4J6IA 3LJNA 1BI7B 3PUJA 2M63A 3ZU7B 3VTYA 3BG0B 5FZSA 3GZ2A 3ZNGA 4U8HA 1LD8A 3AAAC 3CQCB 3ASFA 3Q5MA 1KZOA 4JHJA 1TJCA 5EIDA 3OAWA 2DWZA 4Z68A 3MA5A 5CCMA 4GMLA 3CLJA 2ZGDA 3V79K 4FLBA 3FTUA 3DEPA 3RJVA 5LP0A 2H6FA 1BD8A 3F6QA 5A6CA 5FQ8A 3FUMA 4WWPA 4RG6A 2WXNA 3FUIA 2KCKA 4GA2A 4WNFA 3TWUA 5LX8A 3LY7A 3B7UX 3LVQE 4K5BA 5EX3A 2RKKA 4ME2A 1K1BA 3ESLA 4TXPA 4F53A 3EJNA 4BSXA 1PAQA 3CVNA 4KZ0A 4CDMA 1INZA 1IKND 2I1KA 3QC1A 1SA5A 3AS8A 3TAXA 3PNTB 2XS8A 3FDHA 3KEZA 4CDNA 2IO3C 4MRUA 1OCCE 2OCCE 2NSZA 5EN5D 2XS1A 1IHBA 2AXVA 4HQDA 4A55A 3CEQA 2J4BA 4RVBA 4KBQA 4KVOA 5HQ8A 1TNUA 2ZGGA 4B0ZA 5AJLA 4YDEA 4G1TA 2R59A 4FULA 3ASGA 5KJNA 2P9PG 4GYWA 1FT2A 4ANWA 4E6HA 3PZ3A 1YMPA 4CGVA 2ETAA 2LO6A 1K1AA 4M3OA 2VSNA 5AENA 2KBXA 3D9IA 4BWRA 4HS2A 1YYHA 4JXTA 3E32A 4CZ2D 1QBQA 3ABME 4LG6A 2ILRA 4P29A 4OVUA 3UKRG 5IY5E 3EHNA 1N95A 3CHQA 3UQ3A 3UMVA 2A5EA 3TWVA 3I4RB 3AJIA 4GAAA 3V2XA 1MHQA 3ISMC 4AEZC 4DX6D 5G05J 3RO3A 3RRMB 3EHMA 4FJZA 4IN3B 2BUGA 3G2WA 4DX1A 3G2VA 2VTBB 3ZXSA 4EZKA 4I6JA 2IONA 1Z6TA 1Z5SC 3KAEA 2ETBA 1D8DA 3IBEA 3FUEA 4A63B 3UTMA 5FWQA 4YVOA 4PUCA 3ZUVB 4V3IA 3AS4A 2P9KG 3GYZA 3AG3E 3ZYLA 1H6OA 1BLXB 1OWNA 4LNGA 1U2VG 4OAUC 2WXPA 4B8AA 3LDZA 2NYJA 3BEEA 3D9MA 5AQ9A 4EZLA 1NA3A 4RSYA 2X6JA 3S2AA 4U7EB 1N94A 5B1AE 4RLYA 1OY3D 4HI8A 3QARA 4DLQA 4CT0A 1D9SA 1SZAA 3PRZA 4A1SA 4ANUA 1X81A 5JJ7A 4GYYA 4NIKA 4KXKB 3DPDA 1HG5A 1N54A 3FTWA 4U07A 4PH4B 5G55A 3R9AB 3ZN3A 4ATZD 3L17A 5JJ6A 1AWCB 3PS6A 3UIOC 1JWFA 3RKVA 3QWVA 1RW2A 2C0MA 4F7AA 1TN7A 3TJPA 4K03A 3RSEG 3PH0C 4GZ3A 2UWJG 3B7BA 4A3TA 4DUIA 1L5JA 3APCA 3JUEA 1JCSA 2XGSA 5G04J 3HXDA 4FHKA 2IOSA 1HXIA 5LOZA 3L13A 4O60A 1QYMA 1DC2A 2VSOE 5AJDA 1TYQG 1E7VA 1V55E 3P1UA 3R7QA 1RZ4A 1EPUA 2XEVA 2FBNA 4EQFA 2VJ8A 3PZDA 2PQRA 4ATGA 1O5MA 5CEDB 4U04A 3G2UA 1EDUA 2LXMA 3DEOA 4BTAA 4ILIA 3RRNB 2XZTG 2RFAA 4JD2G 3JXIA 5EDSA 2WQ6A 4FLHA 4H7XA 3UIPC 4YDOA 4RQIA 2WXIA 2P9LG 5FZRA 2WXFA 2EQXA 2X6HA 3IXEA 3NBNB 2AJAA 4XX5A 4N3BA 4A1GA 2AW6A 3D9NA 5KBAA 2F0YA 4GTMA 5G2NA 4UUCA 1E8XA 4TV3A 2CHWA 4ILGA 3QNKA 3CHRA 4B8CB 3ML9A 5ENSD 3L6AA 2KZTA 4UWLA 3KD7A 3D9OA 3TL5A 4HB5A 2WXHA 3EHQA 4KT6B 1H6KA 3SFYA 5ITZF 2V4LA 2ZU6B 4XKCA 3B13A 3RIBA 4EBAA 4DX2A 4MKTA 3APDA 3TG5A 1O1RA 3JQ0A 1S63A 3S7BA 3UI2A 4B89A 3DSSA 4GCNA 3NAWA 1ELWA 4I1AA 4I6GA 3U4TA 2IQCA 5JMND 1B89A 4JA9A 3QJZA 3FU3A 4FJYA 1G3NB 3NQPA 2XPIA 2VQ2A 2BF0X 3L82A 3B7TA 3HIZA 4GCOA 4DPRA 4R7LA 4LNUD 3ZRHA 4JC8A 5HI7A 1N0QA 4BFRA 2DZNA 4WWNA 4I43A 2B6CA 3NOCD 5ANRA 1NA0A 1A5EA 3BU8A 3GZ1A 4AOFA 3D9JA 4G8KA 3Q49B 3FTZA 2L9BA 3O48A 1N11A 1HF8A 2XQ0A 4ABNA 1KZPA 3FTXA 3NB2A 4F6RD 3LYAA 2OVBA 2AWIA 2FO7A 3FUKA 3CQGB 2XPYA 2R03A 4CEMA 3PZ4A 2X38A 4GZ5A 1S0PA 5J08A 3QDNA 3ZIMA 1BPOA 1FVFA 5FT9A 3KSQA 4BX8A 2Y4TA 3DSUA 4KMOA 2UY1A 5HRYA 4AY6A 4YDWA 3MKQB 1PY1A 2WPVA 1E90A 5FIOA 5ENOD 3Q15A 3ZYQA 5EIBE 1DVPA 4EBAG 4DLOA 1DCEA 2DCPA 4OAVB 4N3AA 2YINA 4UQXA 2WXGA 2J07A 1HZ4A 4BTBA 2CG2A 3FU6A 3IV0A 4I1OB 5AARA 3U9WA 2QYUA 4GA0A 2XHEA 4I9CA 2RG8A 3ZHEB 4TXRA 1OXJA 3T8KA 5FJYA 4HXIA 4N39A 5LFAA 1BI8B 3ASDA 1IQRA 4K5AB 4Q94A 3MV3B 3ZYKA 1WAO1 3D9PA 5ENNA 4KVMA 1HG2A 1WY6A 3MX3A 1JCQA 3D3MA 2E0IA 4HFGA 1U3CA 1OWLA 4AIFA 3Q7FA 3FTVA 3DBSA 4C9BB 1H6PA 2EILE 3MYVA 3Q73A 4GTPA 3Q7AA 1HO8A 4U0ZA 3BUAA 1YCSB 1E7UA 4HOSA 2LAHA 3ESKA 1V54E 5FQ7A 3T8MA 5CBNA 2WVIA 1XNFA 2KM4A 4MS6A 4GMJA 4UWKA 3SZ7A 4N5QA 4O6FA 1NI1A 4J8YA 4RG9A 3ZXPA 2DIWA 3T9KA 5T4YA 1Z3XA 2QC9A 1SZ9A 4NURA 3RO2A 2IEJA 2WXOA 3NOGD 1KLXA 3EU9A 2GRQB 3CVYA 4L1BA 2QY7A 3CR3A 4B94A 3O4ZA 2V5QC 4BX9A 3B7SA 3C3RA 4L7TA 4HBDA 2PM7A 5B1BE 3HXFA 5FTPA 2GGFA 1Y8MA 1OUVA 3V31A 2CHXA 5BW8C 3VLEA 3FHEA 5DBKA 1UJJA 1OCOE 3IHVA 3ABLE 3QK0A 1KT0A 1WDYA 1WG0A 3E33A 3CHOA 4I2WA 4G25A 4BSZB 2WMOA 3ULYA 3FWVA 4HI9A 4L23A 3G2SA 2HM8A 3FUDA 2A4ZA 3FH5A 3I3NA 1ELKA 3FEXA 2JLBA 5AQ7A 3UM0A 4C0EA 4HLEA 5G04C 3C98A 4I9EA 1MJ0A 4U0SA 4CDRA 5JJTA 3CVXA 4GYOA 3AG4E 1N4PA 5C2YA 3T5XA 4AM9A 2GRNB 2KC7A 3CIAA 2MHKA 2F8XK 2CG3A 2QZAA 3OXGA 1LTXA 3ZKJA 3ASHA 5LCWC 2OEVA 1X5BA 3C5RA 5AAOA 3ASNE 3QKYA 2FEZA 4O1OA 2CHZA 4LUNU 3UX4A 1ZB1A 5EKQD 1TNOA 3CSTA 5CRUA 4XZ4A 5FQ6A 3SI5A 4I2ZA 5AQBA 1JUQA 4ZHBA 3ZW3A 1HX8A 2I2OA 1UJKA 1JPLA 5KJLA 2JABA 2IFUA 3OTNA 5ANLA 1TNYA 1EYHA 1UOHA 3SFXA 5BV1A 2WXLA 2KCVA 2H6IA 5D0OD 2DZOA 5CBOA 1K3ZD 4HRLA 4J0UA 2X6FA 2EIJE 3HHMA 4G2VA 2VGXA 3HVEA 4ZFHA 4Q96A 1O1TA 2XPZA 3Q78A 3UUXA 2J8SD 3EHRA 2WXMA 1E8YA 3ASOE 3HYMB 4EZJA 4QFVA 3KEAA 4F3VA 3UM3A 4CT4A 3D9LA 4FP7A 2YQ8A 5J90A 4PS7A 3UINC 4U0UA 4APOA 1HU3A 3ZFWA 4AJWA 4QQIA 2YHEA 2ZIRA 3OXFA 2YNQA 3QB2A 3PE3A 3PVLA 1K8KG 2PZIA 3WXXA 5KNHD 4WUYA 3NZUA 5BUZA 5ENRD 4ANVA 4GZDA 1UG3A 3CSFA 2ONDA 1TN6A 4UWGA 3CK7A 2LUHA 1SA4A 4C0MA 1HS6A 2Y3AA 3LY9A 1NFIE 2VGYA 2L0IA 3V2OA 1MZCA 2C0LA 4H7YA 1YA0A 1H2VC 2ZISA 2XEHA 4AXHA 5KJMA 5KNGA 2L0TB 4IRUA 3DSWA 3SNXA 4DX7D 1LD7A 4I6EA 3U64A 3AG2E 5H7PA 5FINA 3PNLB 2DYRE 4HRMB 2NXPA 2L6JA 3QOUA 3DSXA 4WWOA 1IQUA 1O1SA 4OYSA 5AYWD 2GW1A 5AN8A 2WXJA 5AQAA 3V30A 3R7RA 4GTQA 3DXMG 1MX6A 3GW4A 1E8WA 2PNNA 2FF4A 2V8SE 2GRPB 5CECB 4K5CA 3PEVB 2KCLA 2RFMA 2XGOA 3SO8A 2R2LA 2IJGX 5EYPF 3CVVA 2GRRB 3IHYA 3JYSA 2P9NG 2BEDA 4XI9A 2V4HC 3LVRE 2H6HA 3NF1A 5E76A 2LXLA 3CVUA 4BESA 4HNAD 4I17A 2LSVA 3AU4A 1HH8A 2RD0A 3ULEG 2BTDA 4CRWA 4G23A 2QYJA 4KYOB 5JA4D 2XCBA 3D9KA 1S64A 4GTRA 2WXQA 3CVLA 4G8LA 2WMNA 3FU5A 4GTSA 5T8IA 2LAIA 4BEPA 4J8DA 3PZ1A 3PDNA 4LRZA 3CK9A 3Q9UC 2CFZA 2IO2C 4C48B 1QNFA 2I6HA 3MV2B 2P9IG 5E75A 4URKA 2F8YA 3S7FA 4JPSA 2XCCA 4UI9J 4GA1A 3RRUA 1UN8A 1OWOA 2FI7A 2VYIA 1IXVA 3CHMA 2I9CA 4Q69A 2MYOA 3DPYA 2XRYA 3HXCA 3AG1E 2OV8A 4BETA 3CGHA 3ABKE 4JA7A 1AP7A 4JZYA 3AS5A 3N71A 4HVBA 1VDYA 3EUVA 4WAFA 1SVXA 3UT4A 3S7JA 3ZEFA 1GW6A 3FEYA 5CHEE 2KZTB 5BNWA 4APFA 5C1DA 3B95A 3WG7E 2YHCA 3J5QB 3FUNA 2CFUA 3QWWA 1MX2A 3PEUB 4JB8P 2DBAA 4F1SA 4FC8A 2XENA 2FULA 5BXOA 1UW4B 1OCZE 1TNBA 4UWHA 4U8VD 4EHMA 3PREA 3U66A 3FH8A 1NP7A 3E4BA 1FPPA 3VLDA 2XGMA 3PE4A 5DIZA 3E30A 4NQ0A 4J7WA 2JEKA 4D10C 3LXUX 2OOEA 1N9AA 3ML8A 3TWQA 3CVWA 4I1MA 4XIFA 3UXGA 3CVQA 4LERA 5BPPA 5ENQD 3TWXA 2X6KA 1FVHA 3VLFA 3SF4A 4AV7A 4NACA 3OXLA 5G05C 4GPKA 4GTVA 1DNPA 4A3VA 2KATA 4DRXE 5ENPD 4GMRA 3FULA 3Q75A 1WM5A 1IHGA 3D9HA 4G11A 4J8FA 4JEHA 5A23A 3NZSA 4IULA 2GRMA 3LCAA 2XZDG 1N4SA 3JQ1A 3W9GA 2EIME 2PL2A 4CCAA 3UT7A 2Q7FA 3MJWA 4FHJA 2Y1LE 4U95D 5AIJA 3ONKA 2MOWA 4HLLA 4WNEA 2VTBA 3SBTB 2GRLA 4G24A 4YNDA 4LSZE 5HKPA 4J8EA 2R5SA 2WM9A 4GB9A 2BKKB 4TUMA 4FU3A 2J4DA 2H6GA 1JWGA 1FT1A 1NZNA 3LS8A 5D66A 3LJ3A 4DJAA 2E2EA 3SQVA 4N2SA 4MLPA 3W9FA 3CV0A 3MEKA 2Y4UA 2LSUA 5KCMA 1Z3YA 1XGWA 2UY1B 3CKBA 2IY0C 1FCHA 4UQYA 5A7DB 1TNZA 1TEZA 3GZSA 2V0PA 2L6BA 3TWSA 4HRNA 5FQ4A 2V5FA
chains in the Genus database with same CATH topology
3JUEA 4DX1A 3C5RA 5AAOA 2DVWA 1YCSB 2F37A 4DX2A 4DRXE 5ENPD 4GMRA 4QQIA 5AN8A 4O1OA 4U96D 5ENTD 5HS0A 1IXVA 2ETCA 5AQAA 3V30A 2BKGA 3J5PA 4O60A 5CBNA 2ETBA 3D9HA 4U8YD 1QYMA 1DC2A 1MX6A 4A63B 2MYOA 2PNNA 3UI2A 3UTMA 4N5QA 2Y0BG 2KXPC 2XZDG 5CECB 4K5CA 4J8YA 5EN5D 5HRYA 3W9GA 2RFMA 5KNHD 3ZUVB 4BETA 3T9KA 3LJNA 4YDWA 1BI7B 1IHBA 1S70B 5KWDA 1AP7A 2QC9A 4GPMA 3SO8A 3Q9NC 4HQDA 3ZU7B 5JMND 5EYPF 1TR4A 5AQBA 5FIOA 4ZHBA 3NOGD 1OT8A 2P2CP 1BLXB 5ENOD 1SVXA 4O1PA 5ENRD 2Y1LE 4U95D 3EU9A 3ZNGA 3HG0D 5CEDB 4OAUC 5EIBE 3DEOA 1DCQA 4BERA 2HE0A 4HLLA 4DX5D 2JABA 2ZGGA 2NYJA 1MX4A 3AAAC 1G3NB 5EILA 2XZTG 2XEEA 2RFAA 5AQ9A 4OAVB 2V5QC 3B95A 3JXIA 4F1PA 3TWWA 5BXUA 3J5QB 2V4HC 5EIDA 1SW6A 4HBDA 1UOHA 2DWZA 4Z68A 3V31A 4RLYA 3JXJA 5AARA 1MX2A 1OY3D 1NFIE 4HI8A 4JB8P 1YMPA 4LSZE 5HKPA 3V2OA 2ETAA 4BESA 3TWRA 2ZGDA 3V79K 1WG0A 1WDYA 1K1AA 4LNUD 2XENA 3TWTA 1D9SA 4HNAD 2BKKB 5BXOA 4TUMA 3T8KA 1N0QA 2DZOA 4U8VD 3IXEA 2DZNA 3DEPA 2KBXA 4BSZB 4CYMD 5CBOA 2AJAA 1K3ZD 2XEHA 3NBNB 2FO1E 5KNGA 4HRLA 3NOCD 3HRAA 5D66A 1BI8B 1BD8A 4NIKA 2QYJA 3F6QA 4HI9A 5JA4D 5KBAA 1MYOA 1BU9A 4UUCA 3W9FA 1A5EA 1N0RA 4DX7D 4K5AB 1YYHA 4ZFHA 4G8LA 4J7WA 5CEAA 4G8KA 4CZ2D 4LG6A 5AQ7A 3TWUA 2VGEA 5EYLA 5ENSD 1MJ0A 4ATZD 2J8SD 5FINA 4BEPA 4YDYA 4K5BA 2A5EA 3TWQA 3EHRA 3TWVA 1N11A 4HRMB 1K1BA 3AJIA 3Q9UC 3UXGA 1AWCB 4QFVA 4C48B 3V2XA 3KEAA 4HB5A 5ENQD 3TWXA 4DX6D 2B0OE 3EHQA 5CERB 4B93B 4F6RD 1IKND 2F8XK 2F8YA 2L6BA 5ITZF 3TWSA 4HRNA 3B7BA 4DUIA 3ZKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUE A;  4DX1 A;  3C5R A;  5AAO A;  2DVW A;  1YCS B;  2F37 A;  4DX2 A;  4DRX E;  5ENP D;  4GMR A;  4QQI A;  5AN8 A;  4O1O A;  4U96 D;  5ENT D;  5HS0 A;  1IXV A;  2ETC A;  5AQA A;  3V30 A;  2BKG A;  3J5P A;  4O60 A;  5CBN A;  2ETB A;  3D9H A;  4U8Y D;  1QYM A;  1DC2 A;  1MX6 A;  4A63 B;  2MYO A;  2PNN A;  3UI2 A;  3UTM A;  4N5Q A;  2Y0B G;  2KXP C;  2XZD G;  5CEC B;  4K5C A;  4J8Y A;  5EN5 D;  5HRY A;  3W9G A;  2RFM A;  5KNH D;  3ZUV B;  4BET A;  3T9K A;  3LJN A;  4YDW A;  1BI7 B;  1IHB A;  1S70 B;  5KWD A;  1AP7 A;  2QC9 A;  4GPM A;  3SO8 A;  3Q9N C;  4HQD A;  3ZU7 B;  5JMN D;  5EYP F;  1TR4 A;  5AQB A;  5FIO A;  4ZHB A;  3NOG D;  1OT8 A;  2P2C P;  1BLX B;  5ENO D;  1SVX A;  4O1P A;  5ENR D;  2Y1L E;  4U95 D;  3EU9 A;  3ZNG A;  3HG0 D;  5CED B;  4OAU C;  5EIB E;  3DEO A;  1DCQ A;  4BER A;  2HE0 A;  4HLL A;  4DX5 D;  2JAB A;  2ZGG A;  2NYJ A;  1MX4 A;  3AAA C;  1G3N B;  5EIL A;  2XZT G;  2XEE A;  2RFA A;  5AQ9 A;  4OAV B;  2V5Q C;  3B95 A;  3JXI A;  4F1P A;  3TWW A;  5BXU A;  3J5Q B;  2V4H C;  5EID A;  1SW6 A;  4HBD A;  1UOH A;  2DWZ A;  4Z68 A;  3V31 A;  4RLY A;  3JXJ A;  5AAR A;  1MX2 A;  1OY3 D;  1NFI E;  4HI8 A;  4JB8 P;  1YMP A;  4LSZ E;  5HKP A;  3V2O A;  2ETA A;  4BES A;  3TWR A;  2ZGD A;  3V79 K;  1WG0 A;  1WDY A;  1K1A A;  4LNU D;  2XEN A;  3TWT A;  1D9S A;  4HNA D;  2BKK B;  5BXO A;  4TUM A;  3T8K A;  1N0Q A;  2DZO A;  4U8V D;  3IXE A;  2DZN A;  3DEP A;  2KBX A;  4BSZ B;  4CYM D;  5CBO A;  2AJA A;  1K3Z D;  2XEH A;  3NBN B;  2FO1 E;  5KNG A;  4HRL A;  3NOC D;  3HRA A;  5D66 A;  1BI8 B;  1BD8 A;  4NIK A;  2QYJ A;  3F6Q A;  4HI9 A;  5JA4 D;  5KBA A;  1MYO A;  1BU9 A;  4UUC A;  3W9F A;  1A5E A;  1N0R A;  4DX7 D;  4K5A B;  1YYH A;  4ZFH A;  4G8L A;  4J7W A;  5CEA A;  4G8K A;  4CZ2 D;  4LG6 A;  5AQ7 A;  3TWU A;  2VGE A;  5EYL A;  5ENS D;  1MJ0 A;  4ATZ D;  2J8S D;  5FIN A;  4BEP A;  4YDY A;  4K5B A;  2A5E A;  3TWQ A;  3EHR A;  3TWV A;  1N11 A;  4HRM B;  1K1B A;  3AJI A;  3Q9U C;  3UXG A;  1AWC B;  4QFV A;  4C48 B;  3V2X A;  3KEA A;  4HB5 A;  5ENQ D;  3TWX A;  4DX6 D;  2B0O E;  3EHQ A;  5CER B;  4B93 B;  4F6R D;  1IKN D;  2F8X K;  2F8Y A;  2L6B A;  5ITZ F;  3TWS A;  4HRN A;  3B7B A;  4DUI A;  3ZKJ A; 
#chains in the Genus database with same CATH topology
 3LY8 A;  4L2L A;  3HDX A;  4U96 D;  2IF4 A;  1KPS B;  1H19 A;  5BT1 A;  4XKB A;  4EPZ A;  5CMW A;  2HO1 A;  4BT8 A;  3HXB A;  4TRQ A;  3ZPJ A;  2Y0B G;  2J09 A;  2Y69 E;  2P9S G;  3FUF A;  2A5U A;  4UWF A;  2OVF A;  3TXM A;  4LCT A;  3Q9N C;  1TR4 A;  4PS8 A;  2NC9 A;  1H0A A;  2P2C P;  4O1P A;  3HG0 D;  4JEU A;  1H2T C;  3FUJ A;  3Q79 A;  1E96 B;  3MGB A;  3CK8 A;  5JHA A;  4F1P A;  3I4G A;  3TWW A;  5BXU A;  4AVX A;  1OWM A;  3QAQ A;  1TJF A;  3FP3 A;  1HE8 A;  4XE0 A;  2ZXW E;  4BY6 A;  1KT1 A;  3RU0 A;  4DK5 A;  3TGO A;  4CYM D;  1NL4 A;  3IEG A;  3UPV A;  2QFC A;  3ZVV A;  2VGE A;  1ZU2 A;  5EYL A;  4YDY A;  3EIJ A;  2OEW A;  5ARG A;  4JW1 A;  3P2B A;  3DSV A;  3KSL A;  4ANX A;  3MKR A;  4B93 B;  4W9R A;  3L9T A;  1HFA A;  1LF8 A;  4IYP A;  5CMY A;  2GRO B;  5ENT D;  2VSX E;  3JUI A;  2ETC A;  4WND A;  3TXN A;  3L22 A;  1A17 A;  1OWP A;  3PZ2 A;  3FTS A;  4LEU A;  2J49 A;  3G2T A;  4AY5 A;  4NRH B;  3C3O A;  4GPM A;  3CKC A;  2IOL A;  1W3B A;  1UN9 A;  1OT8 A;  2P58 C;  5D0Q D;  1DCQ A;  4BER A;  3DRA A;  1MX4 A;  5EIL A;  3BQO A;  4FAD A;  1D8E A;  4GZC A;  3T5V A;  3R9M A;  1SW6 A;  3E37 A;  5M72 A;  2AXU A;  4CGW A;  2WQ7 A;  5T3R A;  3TWR A;  2VSY A;  2AVP A;  4PS3 A;  4WNG A;  3K9I A;  3SY2 A;  2FO1 E;  3CHP A;  4TUU A;  4HOR A;  1BU9 A;  3EDT B;  4N2Q A;  1N0R A;  4GZ6 A;  1P5Q A;  3TG4 A;  4ILH B;  3LKU A;  5BV0 A;  3Q4A B;  4UI9 C;  3I5P A;  2LNI A;  3FH7 A;  5FZQ A;  3DWL G;  3Q47 B;  4E85 A;  5LCW J;  2PM6 A;  2MRI A;  2WB2 A;  2DVW A;  5KJK A;  2R05 A;  3CHS A;  4OVV A;  3DST A;  4N5C A;  3EU5 A;  3B7R L;  3VTX A;  2P9U G;  2EIK E;  2WXK A;  4U8Y D;  4GTO A;  3LPZ A;  5B3S E;  3RK6 A;  3FU0 A;  4Y6C A;  3FFL A;  1QZ2 A;  1Q2Z A;  1MQS A;  2VGX B;  2J08 A;  5KWD A;  3HVE B;  2R02 A;  1E8Z A;  3UT8 A;  3UM2 A;  2EIN E;  2HE0 A;  3EIQ C;  3IKO B;  3ZGQ A;  4DX5 D;  4UI9 K;  4M7C A;  4TXQ A;  2XEE A;  4L9P A;  4DI3 A;  4ACL A;  3JXJ A;  3UM1 A;  3DXK G;  4BT9 A;  3L54 A;  3TWT A;  2WQH A;  1QQE A;  3E34 A;  3SFZ A;  3MKQ A;  2HYZ A;  1OCR E;  4MBG A;  3ZYM A;  4AP2 A;  5CCL A;  2HR2 A;  4FA6 A;  5ARF A;  3JCK C;  3AU5 A;  3HXE A;  4XI0 A;  2J9Q A;  2B0O E;  2C2L A;  1N4R A;  3QWP A;  2IU1 A;  5CRV A;  1JCR A;  3ZHE A;  3KS2 A;  3MZL B;  4PDX A;  2F37 A;  1H2U A;  5HS0 A;  2BKG A;  3J5P A;  3MCX A;  1IYG A;  4HOQ A;  3L16 A;  3RAU A;  2X6I A;  2KXP C;  3ONL A;  3X2Q E;  3ENE A;  1ZBP A;  1N52 A;  4J8S A;  3BG1 B;  1SQM A;  4JHK A;  1S70 B;  3FTY A;  1Y6I A;  3S7D A;  2R17 C;  3C72 A;  3URZ A;  1ELR A;  4JL0 A;  3LEW A;  4GTT A;  4K0R A;  1U3D A;  4KZC A;  1PC2 A;  3U3W A;  4L2Y A;  3C3Q A;  2WXR A;  3SBS A;  1TN8 A;  2XRZ A;  3CVP A;  3SHF A;  4UQZ A;  4YVQ C;  4GU5 A;  3HRA A;  1EF1 C;  3L08 A;  1MYO A;  5CEA A;  3SGH A;  2X3M A;  3FUH A;  2I1J A;  4HOU A;  5D2M C;  2PQN A;  4LNB A;  2DYS E;  4ACK A;  2AXZ A;  4G26 A;  4Y6W A;  5CER B;  4JHR A;  3UKU G;  3ULQ A;  4N3C A;  4DI4 A;  5EX0 A;  4U63 A;  4HOT A;  4JVS A;  5JHB A;  3APF A;  3PUK A;  4X8Q A;  3FY4 A;  1N4Q A;  3SD5 A;  4EEC A;  4XEI G;  4J6I A;  3LJN A;  1BI7 B;  3PUJ A;  2M63 A;  3ZU7 B;  3VTY A;  3BG0 B;  5FZS A;  3GZ2 A;  3ZNG A;  4U8H A;  1LD8 A;  3AAA C;  3CQC B;  3ASF A;  3Q5M A;  1KZO A;  4JHJ A;  1TJC A;  5EID A;  3OAW A;  2DWZ A;  4Z68 A;  3MA5 A;  5CCM A;  4GML A;  3CLJ A;  2ZGD A;  3V79 K;  4FLB A;  3FTU A;  3DEP A;  3RJV A;  5LP0 A;  2H6F A;  1BD8 A;  3F6Q A;  5A6C A;  5FQ8 A;  3FUM A;  4WWP A;  4RG6 A;  2WXN A;  3FUI A;  2KCK A;  4GA2 A;  4WNF A;  3TWU A;  5LX8 A;  3LY7 A;  3B7U X;  3LVQ E;  4K5B A;  5EX3 A;  2RKK A;  4ME2 A;  1K1B A;  3ESL A;  4TXP A;  4F53 A;  3EJN A;  4BSX A;  1PAQ A;  3CVN A;  4KZ0 A;  4CDM A;  1INZ A;  1IKN D;  2I1K A;  3QC1 A;  1SA5 A;  3AS8 A;  3TAX A;  3PNT B;  2XS8 A;  3FDH A;  3KEZ A;  4CDN A;  2IO3 C;  4MRU A;  1OCC E;  2OCC E;  2NSZ A;  5EN5 D;  2XS1 A;  1IHB A;  2AXV A;  4HQD A;  4A55 A;  3CEQ A;  2J4B A;  4RVB A;  4KBQ A;  4KVO A;  5HQ8 A;  1TNU A;  2ZGG A;  4B0Z A;  5AJL A;  4YDE A;  4G1T A;  2R59 A;  4FUL A;  3ASG A;  5KJN A;  2P9P G;  4GYW A;  1FT2 A;  4ANW A;  4E6H A;  3PZ3 A;  1YMP A;  4CGV A;  2ETA A;  2LO6 A;  1K1A A;  4M3O A;  2VSN A;  5AEN A;  2KBX A;  3D9I A;  4BWR A;  4HS2 A;  1YYH A;  4JXT A;  3E32 A;  4CZ2 D;  1QBQ A;  3ABM E;  4LG6 A;  2ILR A;  4P29 A;  4OVU A;  3UKR G;  5IY5 E;  3EHN A;  1N95 A;  3CHQ A;  3UQ3 A;  3UMV A;  2A5E A;  3TWV A;  3I4R B;  3AJI A;  4GAA A;  3V2X A;  1MHQ A;  3ISM C;  4AEZ C;  4DX6 D;  5G05 J;  3RO3 A;  3RRM B;  3EHM A;  4FJZ A;  4IN3 B;  2BUG A;  3G2W A;  4DX1 A;  3G2V A;  2VTB B;  3ZXS A;  4EZK A;  4I6J A;  2ION A;  1Z6T A;  1Z5S C;  3KAE A;  2ETB A;  1D8D A;  3IBE A;  3FUE A;  4A63 B;  3UTM A;  5FWQ A;  4YVO A;  4PUC A;  3ZUV B;  4V3I A;  3AS4 A;  2P9K G;  3GYZ A;  3AG3 E;  3ZYL A;  1H6O A;  1BLX B;  1OWN A;  4LNG A;  1U2V G;  4OAU C;  2WXP A;  4B8A A;  3LDZ A;  2NYJ A;  3BEE A;  3D9M A;  5AQ9 A;  4EZL A;  1NA3 A;  4RSY A;  2X6J A;  3S2A A;  4U7E B;  1N94 A;  5B1A E;  4RLY A;  1OY3 D;  4HI8 A;  3QAR A;  4DLQ A;  4CT0 A;  1D9S A;  1SZA A;  3PRZ A;  4A1S A;  4ANU A;  1X81 A;  5JJ7 A;  4GYY A;  4NIK A;  4KXK B;  3DPD A;  1HG5 A;  1N54 A;  3FTW A;  4U07 A;  4PH4 B;  5G55 A;  3R9A B;  3ZN3 A;  4ATZ D;  3L17 A;  5JJ6 A;  1AWC B;  3PS6 A;  3UIO C;  1JWF A;  3RKV A;  3QWV A;  1RW2 A;  2C0M A;  4F7A A;  1TN7 A;  3TJP A;  4K03 A;  3RSE G;  3PH0 C;  4GZ3 A;  2UWJ G;  3B7B A;  4A3T A;  4DUI A;  1L5J A;  3APC A;  3JUE A;  1JCS A;  2XGS A;  5G04 J;  3HXD A;  4FHK A;  2IOS A;  1HXI A;  5LOZ A;  3L13 A;  4O60 A;  1QYM A;  1DC2 A;  2VSO E;  5AJD A;  1TYQ G;  1E7V A;  1V55 E;  3P1U A;  3R7Q A;  1RZ4 A;  1EPU A;  2XEV A;  2FBN A;  4EQF A;  2VJ8 A;  3PZD A;  2PQR A;  4ATG A;  1O5M A;  5CED B;  4U04 A;  3G2U A;  1EDU A;  2LXM A;  3DEO A;  4BTA A;  4ILI A;  3RRN B;  2XZT G;  2RFA A;  4JD2 G;  3JXI A;  5EDS A;  2WQ6 A;  4FLH A;  4H7X A;  3UIP C;  4YDO A;  4RQI A;  2WXI A;  2P9L G;  5FZR A;  2WXF A;  2EQX A;  2X6H A;  3IXE A;  3NBN B;  2AJA A;  4XX5 A;  4N3B A;  4A1G A;  2AW6 A;  3D9N A;  5KBA A;  2F0Y A;  4GTM A;  5G2N A;  4UUC A;  1E8X A;  4TV3 A;  2CHW A;  4ILG A;  3QNK A;  3CHR A;  4B8C B;  3ML9 A;  5ENS D;  3L6A A;  2KZT A;  4UWL A;  3KD7 A;  3D9O A;  3TL5 A;  4HB5 A;  2WXH A;  3EHQ A;  4KT6 B;  1H6K A;  3SFY A;  5ITZ F;  2V4L A;  2ZU6 B;  4XKC A;  3B13 A;  3RIB A;  4EBA A;  4DX2 A;  4MKT A;  3APD A;  3TG5 A;  1O1R A;  3JQ0 A;  1S63 A;  3S7B A;  3UI2 A;  4B89 A;  3DSS A;  4GCN A;  3NAW A;  1ELW A;  4I1A A;  4I6G A;  3U4T A;  2IQC A;  5JMN D;  1B89 A;  4JA9 A;  3QJZ A;  3FU3 A;  4FJY A;  1G3N B;  3NQP A;  2XPI A;  2VQ2 A;  2BF0 X;  3L82 A;  3B7T A;  3HIZ A;  4GCO A;  4DPR A;  4R7L A;  4LNU D;  3ZRH A;  4JC8 A;  5HI7 A;  1N0Q A;  4BFR A;  2DZN A;  4WWN A;  4I43 A;  2B6C A;  3NOC D;  5ANR A;  1NA0 A;  1A5E A;  3BU8 A;  3GZ1 A;  4AOF A;  3D9J A;  4G8K A;  3Q49 B;  3FTZ A;  2L9B A;  3O48 A;  1N11 A;  1HF8 A;  2XQ0 A;  4ABN A;  1KZP A;  3FTX A;  3NB2 A;  4F6R D;  3LYA A;  2OVB A;  2AWI A;  2FO7 A;  3FUK A;  3CQG B;  2XPY A;  2R03 A;  4CEM A;  3PZ4 A;  2X38 A;  4GZ5 A;  1S0P A;  5J08 A;  3QDN A;  3ZIM A;  1BPO A;  1FVF A;  5FT9 A;  3KSQ A;  4BX8 A;  2Y4T A;  3DSU A;  4KMO A;  2UY1 A;  5HRY A;  4AY6 A;  4YDW A;  3MKQ B;  1PY1 A;  2WPV A;  1E90 A;  5FIO A;  5ENO D;  3Q15 A;  3ZYQ A;  5EIB E;  1DVP A;  4EBA G;  4DLO A;  1DCE A;  2DCP A;  4OAV B;  4N3A A;  2YIN A;  4UQX A;  2WXG A;  2J07 A;  1HZ4 A;  4BTB A;  2CG2 A;  3FU6 A;  3IV0 A;  4I1O B;  5AAR A;  3U9W A;  2QYU A;  4GA0 A;  2XHE A;  4I9C A;  2RG8 A;  3ZHE B;  4TXR A;  1OXJ A;  3T8K A;  5FJY A;  4HXI A;  4N39 A;  5LFA A;  1BI8 B;  3ASD A;  1IQR A;  4K5A B;  4Q94 A;  3MV3 B;  3ZYK A;  1WAO 1;  3D9P A;  5ENN A;  4KVM A;  1HG2 A;  1WY6 A;  3MX3 A;  1JCQ A;  3D3M A;  2E0I A;  4HFG A;  1U3C A;  1OWL A;  4AIF A;  3Q7F A;  3FTV A;  3DBS A;  4C9B B;  1H6P A;  2EIL E;  3MYV A;  3Q73 A;  4GTP A;  3Q7A A;  1HO8 A;  4U0Z A;  3BUA A;  1YCS B;  1E7U A;  4HOS A;  2LAH A;  3ESK A;  1V54 E;  5FQ7 A;  3T8M A;  5CBN A;  2WVI A;  1XNF A;  2KM4 A;  4MS6 A;  4GMJ A;  4UWK A;  3SZ7 A;  4N5Q A;  4O6F A;  1NI1 A;  4J8Y A;  4RG9 A;  3ZXP A;  2DIW A;  3T9K A;  5T4Y A;  1Z3X A;  2QC9 A;  1SZ9 A;  4NUR A;  3RO2 A;  2IEJ A;  2WXO A;  3NOG D;  1KLX A;  3EU9 A;  2GRQ B;  3CVY A;  4L1B A;  2QY7 A;  3CR3 A;  4B94 A;  3O4Z A;  2V5Q C;  4BX9 A;  3B7S A;  3C3R A;  4L7T A;  4HBD A;  2PM7 A;  5B1B E;  3HXF A;  5FTP A;  2GGF A;  1Y8M A;  1OUV A;  3V31 A;  2CHX A;  5BW8 C;  3VLE A;  3FHE A;  5DBK A;  1UJJ A;  1OCO E;  3IHV A;  3ABL E;  3QK0 A;  1KT0 A;  1WDY A;  1WG0 A;  3E33 A;  3CHO A;  4I2W A;  4G25 A;  4BSZ B;  2WMO A;  3ULY A;  3FWV A;  4HI9 A;  4L23 A;  3G2S A;  2HM8 A;  3FUD A;  2A4Z A;  3FH5 A;  3I3N A;  1ELK A;  3FEX A;  2JLB A;  5AQ7 A;  3UM0 A;  4C0E A;  4HLE A;  5G04 C;  3C98 A;  4I9E A;  1MJ0 A;  4U0S A;  4CDR A;  5JJT A;  3CVX A;  4GYO A;  3AG4 E;  1N4P A;  5C2Y A;  3T5X A;  4AM9 A;  2GRN B;  2KC7 A;  3CIA A;  2MHK A;  2F8X K;  2CG3 A;  2QZA A;  3OXG A;  1LTX A;  3ZKJ A;  3ASH A;  5LCW C;  2OEV A;  1X5B A;  3C5R A;  5AAO A;  3ASN E;  3QKY A;  2FEZ A;  4O1O A;  2CHZ A;  4LUN U;  3UX4 A;  1ZB1 A;  5EKQ D;  1TNO A;  3CST A;  5CRU A;  4XZ4 A;  5FQ6 A;  3SI5 A;  4I2Z A;  5AQB A;  1JUQ A;  4ZHB A;  3ZW3 A;  1HX8 A;  2I2O A;  1UJK A;  1JPL A;  5KJL A;  2JAB A;  2IFU A;  3OTN A;  5ANL A;  1TNY A;  1EYH A;  1UOH A;  3SFX A;  5BV1 A;  2WXL A;  2KCV A;  2H6I A;  5D0O D;  2DZO A;  5CBO A;  1K3Z D;  4HRL A;  4J0U A;  2X6F A;  2EIJ E;  3HHM A;  4G2V A;  2VGX A;  3HVE A;  4ZFH A;  4Q96 A;  1O1T A;  2XPZ A;  3Q78 A;  3UUX A;  2J8S D;  3EHR A;  2WXM A;  1E8Y A;  3ASO E;  3HYM B;  4EZJ A;  4QFV A;  3KEA A;  4F3V A;  3UM3 A;  4CT4 A;  3D9L A;  4FP7 A;  2YQ8 A;  5J90 A;  4PS7 A;  3UIN C;  4U0U A;  4APO A;  1HU3 A;  3ZFW A;  4AJW A;  4QQI A;  2YHE A;  2ZIR A;  3OXF A;  2YNQ A;  3QB2 A;  3PE3 A;  3PVL A;  1K8K G;  2PZI A;  3WXX A;  5KNH D;  4WUY A;  3NZU A;  5BUZ A;  5ENR D;  4ANV A;  4GZD A;  1UG3 A;  3CSF A;  2OND A;  1TN6 A;  4UWG A;  3CK7 A;  2LUH A;  1SA4 A;  4C0M A;  1HS6 A;  2Y3A A;  3LY9 A;  1NFI E;  2VGY A;  2L0I A;  3V2O A;  1MZC A;  2C0L A;  4H7Y A;  1YA0 A;  1H2V C;  2ZIS A;  2XEH A;  4AXH A;  5KJM A;  5KNG A;  2L0T B;  4IRU A;  3DSW A;  3SNX A;  4DX7 D;  1LD7 A;  4I6E A;  3U64 A;  3AG2 E;  5H7P A;  5FIN A;  3PNL B;  2DYR E;  4HRM B;  2NXP A;  2L6J A;  3QOU A;  3DSX A;  4WWO A;  1IQU A;  1O1S A;  4OYS A;  5AYW D;  2GW1 A;  5AN8 A;  2WXJ A;  5AQA A;  3V30 A;  3R7R A;  4GTQ A;  3DXM G;  1MX6 A;  3GW4 A;  1E8W A;  2PNN A;  2FF4 A;  2V8S E;  2GRP B;  5CEC B;  4K5C A;  3PEV B;  2KCL A;  2RFM A;  2XGO A;  3SO8 A;  2R2L A;  2IJG X;  5EYP F;  3CVV A;  2GRR B;  3IHY A;  3JYS A;  2P9N G;  2BED A;  4XI9 A;  2V4H C;  3LVR E;  2H6H A;  3NF1 A;  5E76 A;  2LXL A;  3CVU A;  4BES A;  4HNA D;  4I17 A;  2LSV A;  3AU4 A;  1HH8 A;  2RD0 A;  3ULE G;  2BTD A;  4CRW A;  4G23 A;  2QYJ A;  4KYO B;  5JA4 D;  2XCB A;  3D9K A;  1S64 A;  4GTR A;  2WXQ A;  3CVL A;  4G8L A;  2WMN A;  3FU5 A;  4GTS A;  5T8I A;  2LAI A;  4BEP A;  4J8D A;  3PZ1 A;  3PDN A;  4LRZ A;  3CK9 A;  3Q9U C;  2CFZ A;  2IO2 C;  4C48 B;  1QNF A;  2I6H A;  3MV2 B;  2P9I G;  5E75 A;  4URK A;  2F8Y A;  3S7F A;  4JPS A;  2XCC A;  4UI9 J;  4GA1 A;  3RRU A;  1UN8 A;  1OWO A;  2FI7 A;  2VYI A;  1IXV A;  3CHM A;  2I9C A;  4Q69 A;  2MYO A;  3DPY A;  2XRY A;  3HXC A;  3AG1 E;  2OV8 A;  4BET A;  3CGH A;  3ABK E;  4JA7 A;  1AP7 A;  4JZY A;  3AS5 A;  3N71 A;  4HVB A;  1VDY A;  3EUV A;  4WAF A;  1SVX A;  3UT4 A;  3S7J A;  3ZEF A;  1GW6 A;  3FEY A;  5CHE E;  2KZT B;  5BNW A;  4APF A;  5C1D A;  3B95 A;  3WG7 E;  2YHC A;  3J5Q B;  3FUN A;  2CFU A;  3QWW A;  1MX2 A;  3PEU B;  4JB8 P;  2DBA A;  4F1S A;  4FC8 A;  2XEN A;  2FUL A;  5BXO A;  1UW4 B;  1OCZ E;  1TNB A;  4UWH A;  4U8V D;  4EHM A;  3PRE A;  3U66 A;  3FH8 A;  1NP7 A;  3E4B A;  1FPP A;  3VLD A;  2XGM A;  3PE4 A;  5DIZ A;  3E30 A;  4NQ0 A;  4J7W A;  2JEK A;  4D10 C;  3LXU X;  2OOE A;  1N9A A;  3ML8 A;  3TWQ A;  3CVW A;  4I1M A;  4XIF A;  3UXG A;  3CVQ A;  4LER A;  5BPP A;  5ENQ D;  3TWX A;  2X6K A;  1FVH A;  3VLF A;  3SF4 A;  4AV7 A;  4NAC A;  3OXL A;  5G05 C;  4GPK A;  4GTV A;  1DNP A;  4A3V A;  2KAT A;  4DRX E;  5ENP D;  4GMR A;  3FUL A;  3Q75 A;  1WM5 A;  1IHG A;  3D9H A;  4G11 A;  4J8F A;  4JEH A;  5A23 A;  3NZS A;  4IUL A;  2GRM A;  3LCA A;  2XZD G;  1N4S A;  3JQ1 A;  3W9G A;  2EIM E;  2PL2 A;  4CCA A;  3UT7 A;  2Q7F A;  3MJW A;  4FHJ A;  2Y1L E;  4U95 D;  5AIJ A;  3ONK A;  2MOW A;  4HLL A;  4WNE A;  2VTB A;  3SBT B;  2GRL A;  4G24 A;  4YND A;  4LSZ E;  5HKP A;  4J8E A;  2R5S A;  2WM9 A;  4GB9 A;  2BKK B;  4TUM A;  4FU3 A;  2J4D A;  2H6G A;  1JWG A;  1FT1 A;  1NZN A;  3LS8 A;  5D66 A;  3LJ3 A;  4DJA A;  2E2E A;  3SQV A;  4N2S A;  4MLP A;  3W9F A;  3CV0 A;  3MEK A;  2Y4U A;  2LSU A;  5KCM A;  1Z3Y A;  1XGW A;  2UY1 B;  3CKB A;  2IY0 C;  1FCH A;  4UQY A;  5A7D B;  1TNZ A;  1TEZ A;  3GZS A;  2V0P A;  2L6B A;  3TWS A;  4HRN A;  5FQ4 A;  2V5F A; 
#chains in the Genus database with same CATH homology
 3JUE A;  4DX1 A;  3C5R A;  5AAO A;  2DVW A;  1YCS B;  2F37 A;  4DX2 A;  4DRX E;  5ENP D;  4GMR A;  4QQI A;  5AN8 A;  4O1O A;  4U96 D;  5ENT D;  5HS0 A;  1IXV A;  2ETC A;  5AQA A;  3V30 A;  2BKG A;  3J5P A;  4O60 A;  5CBN A;  2ETB A;  3D9H A;  4U8Y D;  1QYM A;  1DC2 A;  1MX6 A;  4A63 B;  2MYO A;  2PNN A;  3UI2 A;  3UTM A;  4N5Q A;  2Y0B G;  2KXP C;  2XZD G;  5CEC B;  4K5C A;  4J8Y A;  5EN5 D;  5HRY A;  3W9G A;  2RFM A;  5KNH D;  3ZUV B;  4BET A;  3T9K A;  3LJN A;  4YDW A;  1BI7 B;  1IHB A;  1S70 B;  5KWD A;  1AP7 A;  2QC9 A;  4GPM A;  3SO8 A;  3Q9N C;  4HQD A;  3ZU7 B;  5JMN D;  5EYP F;  1TR4 A;  5AQB A;  5FIO A;  4ZHB A;  3NOG D;  1OT8 A;  2P2C P;  1BLX B;  5ENO D;  1SVX A;  4O1P A;  5ENR D;  2Y1L E;  4U95 D;  3EU9 A;  3ZNG A;  3HG0 D;  5CED B;  4OAU C;  5EIB E;  3DEO A;  1DCQ A;  4BER A;  2HE0 A;  4HLL A;  4DX5 D;  2JAB A;  2ZGG A;  2NYJ A;  1MX4 A;  3AAA C;  1G3N B;  5EIL A;  2XZT G;  2XEE A;  2RFA A;  5AQ9 A;  4OAV B;  2V5Q C;  3B95 A;  3JXI A;  4F1P A;  3TWW A;  5BXU A;  3J5Q B;  2V4H C;  5EID A;  1SW6 A;  4HBD A;  1UOH A;  2DWZ A;  4Z68 A;  3V31 A;  4RLY A;  3JXJ A;  5AAR A;  1MX2 A;  1OY3 D;  1NFI E;  4HI8 A;  4JB8 P;  1YMP A;  4LSZ E;  5HKP A;  3V2O A;  2ETA A;  4BES A;  3TWR A;  2ZGD A;  3V79 K;  1WG0 A;  1WDY A;  1K1A A;  4LNU D;  2XEN A;  3TWT A;  1D9S A;  4HNA D;  2BKK B;  5BXO A;  4TUM A;  3T8K A;  1N0Q A;  2DZO A;  4U8V D;  3IXE A;  2DZN A;  3DEP A;  2KBX A;  4BSZ B;  4CYM D;  5CBO A;  2AJA A;  1K3Z D;  2XEH A;  3NBN B;  2FO1 E;  5KNG A;  4HRL A;  3NOC D;  3HRA A;  5D66 A;  1BI8 B;  1BD8 A;  4NIK A;  2QYJ A;  3F6Q A;  4HI9 A;  5JA4 D;  5KBA A;  1MYO A;  1BU9 A;  4UUC A;  3W9F A;  1A5E A;  1N0R A;  4DX7 D;  4K5A B;  1YYH A;  4ZFH A;  4G8L A;  4J7W A;  5CEA A;  4G8K A;  4CZ2 D;  4LG6 A;  5AQ7 A;  3TWU A;  2VGE A;  5EYL A;  5ENS D;  1MJ0 A;  4ATZ D;  2J8S D;  5FIN A;  4BEP A;  4YDY A;  4K5B A;  2A5E A;  3TWQ A;  3EHR A;  3TWV A;  1N11 A;  4HRM B;  1K1B A;  3AJI A;  3Q9U C;  3UXG A;  1AWC B;  4QFV A;  4C48 B;  3V2X A;  3KEA A;  4HB5 A;  5ENQ D;  3TWX A;  4DX6 D;  2B0O E;  3EHQ A;  5CER B;  4B93 B;  4F6R D;  1IKN D;  2F8X K;  2F8Y A;  2L6B A;  5ITZ F;  3TWS A;  4HRN A;  3B7B A;  4DUI A;  3ZKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...