1BI8B

Mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
b'VRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (kinase/inhibitor)
total genus 51
structure length 155
sequence length 155
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12796 Ank_2 Ankyrin repeats (3 copies)
B PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bi8B00
2V4HC 5BXUA 4CYMD 5KNHD 5JMND 5CERB 4DUIA 4DX2A 1BI8B 5EYLA 4BESA 4NIKA 3C5RA 3V30A 4BERA 1IKND 4HNAD 5CECB 2JABA 5D66A 5FINA 4C48B 3Q9UC 4HLLA 3ZU7B 2NYJA 3SO8A 5HRYA 4TUMA 5ENRD 1SVXA 5EYPF 5HS0A 5JA4D 2MYOA 2P2CP 3ZNGA 5CBOA 5FIOA 2DZOA 4J8YA 4OAVB 2Y0BG 4O1OA 4GMRA 3JXJA 4HRMB 4F1PA 5ITZF 4HRLA 3TWRA 2V5QC 4LG6A 3W9GA 5KWDA 3TWVA 2A5EA 5ENOD 5EIDA 4K5AB 2VGEA 2RFMA 5AQBA 3ZKJA 1AP7A 4G8LA 5HKPA 4DRXE 1MX6A 5EIBE 2DVWA 2F8YA 4U95D 3TWWA 4U96D 4A63B 5KNGA 1N0RA 5CBNA 4O1PA 1N11A 3AJIA 3TWSA 3DEOA 1DCQA 3AAAC 2BKGA 2PNNA 1G3NB 5ENTD 5AQ7A 3IXEA 5CEAA 1DC2A 1MJ0A 5AAOA 3F6QA 4O60A 1N0QA 2B0OE 1UOHA 1YMPA 5AN8A 5AARA 3LJNA 5AQ9A 2F8XK 1WDYA 5ENQD 2HE0A 1TR4A 1OY3D 4BEPA 2XEHA 3UXGA 4HQDA 2XZDG 3HG0D 3V2XA 1MX2A 1QYMA 3DEPA 4LSZE 3B7BA 4HI8A 3JUEA 2ZGDA 1IXVA 4N5QA 3UTMA 3KEAA 2AJAA 1K1BA 3B95A 4B93B 2QYJA 1YCSB 2J8SD 3T9KA 2QC9A 4GPMA 5EN5D 3JXIA 3TWXA 3UI2A 3V79K 3NOGD 4HBDA 3Q9NC 1BLXB 2XEEA 3NOCD 4RLYA 1K3ZD 4HI9A 3ZUVB 4DX6D 1A5EA 3NBNB 5EILA 4HRNA 3EU9A 3T8KA 2FO1E 4QFVA 2RFAA 2DWZA 2F37A 4LNUD 4U8VD 2Y1LE 2ETCA 5AQAA 3TWQA 4DX7D 2L6BA 3EHQA 3D9HA 5BXOA 3J5PA 3TWUA 4Z68A 4ZFHA 5ENPD 1AWCB 4YDWA 4CZ2D 2XENA 5KBAA 1BD8A 4QQIA 4ATZD 4OAUC 1OT8A 2XZTG 3EHRA 3HRAA 4DX5D 5CEDB 4BETA 4K5BA 1MYOA 1MX4A 1BI7B 2ZGGA 1IHBA 1BU9A 1K1AA 2ETBA 2KBXA 4JB8P 3V31A 1SW6A 2DZNA 4HB5A 4F6RD 1S70B 4U8YD 2ETAA 4UUCA 4YDYA 2BKKB 4J7WA 3W9FA 1WG0A 3TWTA 4G8KA 1NFIE 3J5QB 1YYHA 3V2OA 4DX1A 4K5CA 5ENSD 4BSZB 4ZHBA 1D9SA 2KXPC
chains in the Genus database with same CATH superfamily
1NA3A 1Q2ZA 1BI8B 3CQGB 4L1BA 4NIKA 4GAAA 3ZYLA 4I2WA 5CECB 3FU5A 3G2TA 3FHEA 3U66A 5JHAA 1TYQG 5JA4D 3E33A 1YA0A 2GRQB 3MEKA 3CK8A 2DIWA 4GMJA 5KWDA 2BF0X 2L6JA 4GZ5A 3X2QE 2AXUA 1OCZE 2DVWA 3P2BA 4TUUA 3ASDA 5CBNA 1FT2A 4A55A 3DSVA 3TL5A 3AAAC 5ARGA 2I1JA 3P1UA 4UWFA 1HX8A 3NAWA 5J08A 4HORA 3NF1A 4DLOA 3EU5A 2X6FA 3MZLB 3ZEFA 4U0ZA 3SI5A 2WXPA 1HU3A 3HXCA 3SY2A 3ASHA 4EQFA 2EIKE 4GYYA 5BPPA 4GTPA 4JD2G 5CMYA 3FUFA 3L17A 4CT4A 1WM5A 3FTXA 1NL4A 4UQZA 5LCWC 2I1KA 3RJVA 2VSXE 3PS6A 4CCAA 1Z3XA 1MZCA 5ENPD 2XENA 4PDXA 4JXTA 2UWJG 3QARA 4OAUC 3PEUB 3FTYA 3OTNA 1MYOA 1BI7B 3OXLA 1IHBA 1N95A 3CIAA 4AXHA 4I1MA 2BUGA 4GTSA 4ANVA 3NZUA 1YYHA 2WMOA 3UT4A 3HXEA 3ZU7B 3CK9A 3FH8A 2NXPA 1E8XA 4O1OA 3EIJA 2J08A 5DIZA 3ULYA 5HI7A 4DRXE 4L2LA 4KZCA 4WNDA 4WAFA 5CCMA 2CHWA 4J8SA 5ENNA 4G26A 1H19A 2ZU6B 3FY4A 2KCKA 3OXGA 2UY1B 3TAXA 2GRPB 3IV0A 5A23A 3LCAA 4HQDA 3I5PA 2KCLA 4LSZE 3QWWA 4GU5A 1JPLA 3UTMA 3N71A 3CR3A 3LVRE 3S7JA 1HZ4A 4GYOA 1OWNA 2WXMA 3EU9A 3JQ0A 2R59A 3EHMA 1E96B 3AG3E 4F53A 2GRMA 1DNPA 3NB2A 4QQIA 5G05J 2ZGGA 4XI0A 2IOSA 2R05A 4HB5A 3RSEG 4J7WA 4RVBA 1WAO1 2PQNA 5KNHD 2ZIRA 4DUIA 2PQRA 3ULQA 4FULA 4GA1A 4X8QA 3L13A 4CEMA 4HLLA 5ENRD 2XS8A 3EIQC 3ZNGA 2LUHA 3VLDA 2AWIA 2FEZA 3FTZA 3ASOE 4HRMB 3ULEG 4EHMA 3VTXA 2J4DA 3CHSA 2FI7A 3T5VA 3U4TA 4G8LA 2F8YA 4KVOA 3QJZA 4JHRA 3CVUA 5J90A 2MOWA 4JA9A 2PNNA 2NC9A 3T5XA 4GYWA 3SFYA 4DK5A 1WDYA 2YHEA 3GW4A 4PS3A 1JCQA 3ZPJA 2E0IA 1QYMA 1S64A 2XGSA 4N5QA 5LP0A 2AJAA 1K1BA 4BT9A 4B93B 2Y4TA 2WXKA 3CLJA 3HHMA 3ONLA 4HBDA 4AY5A 3RRNB 2WVIA 1HG5A 4HI9A 5FQ8A 2XHEA 3RIBA 3CVLA 3Q78A 3PH0C 3L82A 2F37A 4AY6A 3CK7A 3J5PA 1UJKA 5ANRA 4GZ3A 4A3TA 3ZIMA 2XPZA 2OEVA 2CFZA 3URZA 3ESLA 4AEZC 2R02A 2R03A 4GTOA 1EF1C 3D9MA 1JWGA 1O5MA 3E32A 4GTTA 4CYMD 1E8WA 5KJNA 4E6HA 4MBGA 3KSQA 1E7VA 3Q9UC 3RU0A 2P2CP 3DXMG 2R2LA 1QZ2A 5C1DA 2LAIA 4L2YA 3QK0A 1P5QA 4IRUA 4K5AB 4A1SA 4RSYA 3D9NA 5FTPA 2C0LA 2I6HA 1TNBA 1N94A 4ME2A 5E76A 2AXZA 2BKGA 2IU1A 1RZ4A 4I1OB 3LJNA 3SD5A 3DPDA 2HE0A 5JJTA 1SZ9A 3CHQA 4JZYA 2RG8A 2A5UA 3RRMB 2P9KG 2AVPA 3EHNA 3ABME 4JL0A 3UM3A 3BG0B 3UI2A 1H2UA 3JXIA 1KLXA 1BLXB 2XEEA 3ZUVB 1O1SA 3NBNB 4I9EA 5BUZA 2XS1A 4TXQA 3FDHA 3G2WA 3LKUA 2DYRE 3LJ3A 4WWPA 2A4ZA 4ABNA 3FH7A 2MRIA 4WNEA 1VDYA 1TJFA 2P9IG 4BX8A 1D8DA 2KC7A 4A3VA 5T8IA 1UW4B 4I6JA 1WG0A 3GZSA 5B1AE 3E30A 3CSTA 2ONDA 4FP7A 3VLFA 4BWRA 4H7XA 1ELRA 4BESA 3V30A 2IO2C 2L9BA 5LCWJ 2X6JA 4JHKA 3RK6A 2F0YA 4JC8A 3UMVA 5CBOA 3U3WA 4EPZA 3TWRA 2YINA 2I9CA 2VGEA 5BV0A 1U3CA 5KNGA 2L0IA 4O1PA 1HE8A 3T8MA 2X6IA 1PC2A 4I2ZA 1G3NB 5AAOA 5AARA 1TR4A 4ILGA 1N9AA 1LTXA 4EBAG 2RKKA 3SF4A 4TXPA 4RLYA 3Q7AA 3FP3A 3FUEA 3PZDA 4KMOA 2DWZA 2C2LA 1BPOA 4MRUA 4L23A 4CZ2D 4R7LA 5E75A 5G55A 3ZYKA 1V55E 1OXJA 2KBXA 4F6RD 2DZNA 1S70B 3DWLG 4HXIA 1OCCE 3MCXA 5D0OD 3B7UX 3CV0A 1H2VC 3D9JA 2GW1A 2E2EA 1LF8A 4BSXA 1E90A 1SQMA 4HNAD 4U07A 3LY8A 3SO8A 4LNGA 4EZLA 3FUNA 3UUXA 3NZSA 1FVFA 2H6FA 2VSOE 4N3AA 2WMNA 4AOFA 2VGXB 2IY0C 1UN8A 2J09A 3FTWA 5EX3A 4WNFA 4FA6A 1FT1A 4XIFA 3AJIA 2EIME 2YQ8A 3Q4AB 4GTMA 2QZAA 4B89A 2XCBA 4HOTA 4BEPA 4GZ6A 3FUIA 4ANUA 2VTBA 3ZYMA 4CDMA 4PUCA 3I3NA 4JHJA 3ASFA 2P58C 3LY7A 3HXDA 3CVNA 4UI9K 3D9HA 3MV3B 2J9QA 2OVBA 3JCKC 3FUDA 3ZFWA 2LSUA 2R17C 2V5FA 5AYWD 3FUHA 5AENA 4MLPA 3SNXA 3UIOC 2BEDA 1PAQA 3Q79A 4PH4B 3V2OA 3J5QB 5ENSD 1ZBPA 2V4HC 5M72A 4IN3B 4HOQA 3BU8A 4ANWA 4DX2A 4EZJA 3WXXA 3L6AA 3PEVB 4BERA 5FINA 3EUVA 4C48B 4OAVB 1XNFA 3CEQA 3IEGA 4F1PA 4HRLA 4I1AA 4H7YA 5AJLA 2FULA 4XKBA 3IBEA 5ENOD 4XI9A 3DPYA 4CGVA 3S7BA 1SZAA 4C0MA 3AS5A 4U96D 4A63B 1NP7A 5FT9A 3CGHA 3ZYQA 3RAUA 2XEVA 3Q7FA 5ENTD 3FEYA 4O60A 5ENQD 4ACLA 2WM9A 4BFRA 1MX2A 3DEPA 2OV8A 4IULA 2FF4A 4E85A 1U3DA 2MHKA 2YNQA 1LD7A 3ZXSA 2KCVA 2VSYA 3ABLE 5AJDA 5FQ4A 4NQ0A 4L9PA 4W9RA 5A7DB 2DBAA 2XZTG 2I2OA 2HM8A 5EX0A 4WWOA 2C0MA 5LFAA 3CVPA 4U63A 3CVWA 4XE0A 3VLEA 2KM4A 5C2YA 4DX1A 4D10C 4EBAA 4AV7A 2H6HA 1D9SA 3B7SA 2CFUA 1FVHA 1SA4A 5CERB 4GZCA 2XPIA 1Y8MA 1HS6A 3DBSA 2JABA 2ZISA 3HVEA 5BW8C 3GZ1A 2V5QC 3UT7A 5B3SE 3FUMA 4G11A 3ENEA 1PY1A 2PZIA 5JJ6A 1ELKA 4V3IA 1KPSB 2Y4UA 4JW1A 4EZKA 5BT1A 3PUKA 4Q96A 4P29A 3ZVVA 2IOLA 3CKBA 3SZ7A 4MS6A 3B7BA 3MX3A 4TRQA 3TG4A 4NACA 3S7FA 4CGWA 3PZ4A 3Q15A 2WXQA 5EN5D 3R9MA 3Q9NC 2WPVA 1JCSA 3FU6A 3MGBA 2Y1LE 5AQAA 2L6BA 3ZN3A 3Q47B 2KZTA 4DI3A 3UINC 1HF8A 1BD8A 4C9BB 2WXJA 2PL2A 2ILRA 1KT0A 2JLBA 1IQRA 1NA0A 4F3VA 4EECA 3QNKA 3U64A 4U0SA 5JHBA 1HXIA 1IHGA 5D2MC 3C5RA 2PM6A 4U04A 3U9WA 2WXIA 4RG6A 2GRRB 5FIOA 3QWVA 3WG7E 2B6CA 3ZKJA 3DRAA 5HKPA 1MX6A 1H2TC 3TWSA 2LAHA 4N2SA 1Z6TA 3F6QA 4UI9J 5AQ9A 2EIJE 3Q73A 3CKCA 2XEHA 2CG2A 2M63A 3UXGA 3HG0D 3LXUX 4HI8A 4N2QA 2P9SG 3JUIA 2HYZA 5CHEE 3UT8A 3TXNA 2FO7A 2IQCA 1NI1A 2L0TB 3T8KA 2FO1E 4QFVA 3UM2A 2XGMA 3B7RL 5KJLA 4NURA 4OVVA 3SQVA 4DI4A 4FJZA 3Q5MA 4ZFHA 5KBAA 2LO6A 4HOUA 4K0RA 2WXFA 3DSSA 4NRHB 2QYUA 4K5BA 1H6PA 4Y6WA 3QWPA 1BU9A 2ETBA 2HO1A 1JUQA 3L9TA 3BUAA 2BKKB 3FFLA 3SHFA 2Y69E 4Q94A 3HXBA 4K5CA 3FWVA 3LS8A 5JMND 3IHYA 1TN8A 3FUJA 2JEKA 3ZW3A 1DCEA 3R7RA 2VQ2A 1L5JA 1U2VG 3HXFA 5EYPF 4J8YA 3OXFA 4FHKA 3C3QA 2Y3AA 1TNUA 1INZA 3G2UA 1ELWA 3FTUA 3D9PA 4UWGA 4XZ4A 3E34A 4BTBA 3QAQA 1DC2A 1OCOE 3RRUA 2B0OE 1UOHA 1YMPA 5AN8A 4B8AA 3LVQE 5LX8A 3QOUA 3QB2A 2LSVA 3VTYA 3HDXA 2UY1A 1N54A 1TN7A 4K03A 4KT6B 2ZGDA 2OOEA 4MKTA 3AG2E 4JEUA 3RKVA 2OEWA 4N5CA 3G2SA 4YVOA 1K3ZD 4APOA 4J0UA 4Q69A 1E8YA 4UWLA 3D9OA 3MKQA 4RQIA 1OWLA 2OCCE 4PS7A 4BY6A 5CEDB 4HOSA 3TXMA 4GCOA 3UX4A 3DXKG 4UUCA 2XRYA 1RW2A 3O48A 4FJYA 3AU4A 3TWTA 2X6HA 2WXNA 4UQYA 3QKYA 5BXUA 5FZQA 3B13A 5ARFA 4DJAA 2WXLA 5EYLA 1NZNA 4ACKA 5AIJA 2WXGA 4L7TA 3EDTB 2X38A 3AG1E 1TNYA 3L54A 5HS0A 1N4RA 4LUNU 3FU0A 5ITZF 2AW6A 3TWVA 3PREA 3RO2A 1TNOA 3ZGQA 4TXRA 1N0RA 4ATGA 4U0UA 3O4ZA 4KVMA 2LXMA 3DEOA 2KZTB 1JWFA 3IXEA 4FHJA 3UQ3A 3UPVA 2GROB 5BV1A 4FADA 3UKUG 4LRZA 2QFCA 4BTAA 4DLQA 3T9KA 3PZ3A 1FPPA 5FWQA 5EILA 3C3RA 3TG5A 5DBKA 4JEHA 3TWQA 4Z68A 4ATZD 4BT8A 3HRAA 4CRWA 3I4GA 3DSUA 4OVUA 4FLBA 5FQ6A 5FQ7A 2P9UG 5T4YA 4N3CA 3ASNE 4XEIG 5EDSA 4GA2A 4ZHBA 1DCQA 2ZXWE 4J8FA 3RO3A 2WQ6A 3D9KA 2V0PA 3KS2A 3C72A 3MJWA 3L16A 1OCRE 3CVXA 1MHQA 5HRYA 4TUMA 3UIPC 1SVXA 1LD8A 2MYOA 2J49A 3PZ2A 1UG3A 1E7UA 5FJYA 5A6CA 4LG6A 2VGYA 4IYPA 5EIDA 1X5BA 3S2AA 2WQ7A 2WXHA 3L22A 3TWWA 2FBNA 5G04C 3IHVA 5G2NA 4GMLA 5KJMA 4WWNA 5CMWA 3CHOA 4I9CA 2XZDG 3ML9A 3ONKA 5HQ8A 1N4QA 4CDNA 2PM7A 4I17A 1QQEA 3DSWA 2QC9A 3MYVA 4GPMA 3V79K 1XGWA 2GRNB 3KEZA 3UM0A 3D9LA 5JJ7A 3R7QA 3LPZA 3D9IA 4AP2A 4U8VD 2XGOA 3ML8A 4LEUA 4O6FA 3GYZA 5BXOA 3D3MA 4J8DA 3AS4A 2R5SA 3B7TA 2V4LA 3R9AB 4BETA 1OUVA 1K8KG 1S63A 4G24A 1E8ZA 2AXVA 4APFA 1SW6A 5KCMA 3AU5A 2GRLA 3E37A 1NFIE 4AIFA 4URKA 3FEXA 3FH5A 5BNWA 3CQCB 3PRZA 4U8HA 1O1TA 2KATA 4I43A 3TJPA 3ZHEA 4YDOA 3SBSA 1OWPA 2DZOA 1TNZA 4GMRA 4YVQC 4ANXA 4N39A 1FCHA 3MV2B 4BX9A 1X81A 1Z3YA 3W9GA 2P9LG 3PNLB 2RFMA 4M3OA 4HVBA 1OWOA 3MKQB 4C0EA 3KAEA 2IFUA 4U7EB 1QNFA 4HLEA 1N0QA 2CG3A 3Q49B 3I4RB 3KEAA 3FULA 5ANLA 3BQOA 5IY5E 3NOCD 4N3BA 4RG9A 4HRNA 3QDNA 4G1TA 3K9IA 4FC8A 2ETCA 3FUKA 3EHQA 1AWCB 2WXOA 4KBQA 4I6GA 1HO8A 5T3RA 1O1RA 3SBTB 3PE4A 1D8EA 1DVPA 1HG2A 4ILHB 1K1AA 3E4BA 4JB8P 4ILIA 1UJJA 2ETAA 4YDYA 3ISMC 4M7CA 2KXPC 2VSNA 5CRUA 4AVXA 5FZSA 1KT1A 5D66A 3SGHA 2NYJA 3GZ2A 3KD7A 3FTVA 1S0PA 2Y0BG 3JXJA 3OAWA 3PZ1A 4CT0A 2V8SE 4F1SA 3CVQA 3HYMB 4XKCA 3TGOA 2IONA 5AQBA 5EIBE 3CVVA 2XPYA 2CHXA 3QC1A 2VTBB 2DCPA 2VGXA 1MJ0A 4JPSA 3APCA 2P9PG 3PNTB 5B1BE 3ASGA 1H0AA 3V2XA 2HR2A 1N52A 5CRVA 3NQPA 3B95A 2H6IA 4AJWA 3APFA 4DX6D 4FU3A 3DSTA 4GTVA 5LOZA 4I6EA 2RFAA 1EDUA 4LNUD 4GB9A 3ZRHA 4LCTA 4DX7D 1HFAA 2EQXA 3MKRA 3TWUA 4GA0A 2J07A 3DSXA 3EHRA 1W3BA 1Z5SC 4LERA 2Q7FA 5CCLA 4TV3A 4B8CB 2X3MA 1H6KA 2XRZA 5EKQD 4G8KA 4WUYA 3PUJA 1N4PA 4BSZB 3CHRA 3JQ1A 1IYGA 3PDNA 4GZDA 3IKOB 1JCRA 1EYHA 4KYOB 2IO3C 4FLHA 3CSFA 4GTQA 1AP7A 3PVLA 4DPRA 2H6GA 3CVYA 1QBQA 3BG1B 3UM1A 5AQ7A 3KSLA 5CEAA 1UN9A 2EINE 2F8XK 1OY3D 4B0ZA 3LEWA 2IF4A 3AG4E 1SA5A 5D0QD 5G05C 1IXVA 1V54E 4J8EA 3JYSA 3S7DA 2QYJA 1YCSB 1A5EA 3CHPA 2XCCA 3ESKA 3BEEA 4OYSA 5G04J 3HIZA 1GW6A 2X6KA 3G2VA 3ZHEB 1OWMA 1A17A 3LY9A 3UKRG 4G23A 3FU3A 1OT8A 1IQUA 4HS2A 4B94A 4G2VA 4GCNA 5KJKA 4LNBA 4WNGA 3HVEB 4YNDA 2RD0A 1TN6A 3ABKE 1ZU2A 1TEZA 2GGFA 1IKND 3EJNA 1B89A 2CHZA 2NSZA 2VYIA 1MQSA 2QY7A 3MA5A 4JA7A 1KZOA 3AS8A 2A5EA 1Y6IA 2VJ8A 4U95D 1ZB1A 1EPUA 3FTSA 1N11A 2OVFA 1H6OA 2EILE 4AM9A 3SFXA 1TJCA 3SFZA 4F7AA 2YHCA 2WXRA 2J4BA 3JUEA 1N4SA 4CDRA 4HFGA 2IEJA 4G25A 4KXKB 2J8SD 3LYAA 4UQXA 2BTDA 3TWXA 3NOGD 3CHMA 2P9NG 4Y6CA 4UWHA 2LXLA 1WY6A 4J6IA 1KZPA 3C3OA 4A1GA 4KZ0A 3L08A 5H7PA 3APDA 4UI9C 4YDWA 4JVSA 3Q75A 2LNIA 2XQ0A 3C98A 4YDEA 3ZXPA 1HH8A 4DX5D 1MX4A 2IJGX 4XX5A 2WB2A 4GPKA 3V31A 2WQHA 4U8YD 4PS8A 3LDZA 3W9FA 2DYSE 4UWKA 4GTRA 5FZRA 3PE3A
chains in the Genus database with same CATH topology
2V4HC 5BXUA 4CYMD 5KNHD 5JMND 5CERB 4DUIA 4DX2A 1BI8B 5EYLA 4BESA 4NIKA 3C5RA 3V30A 4BERA 1IKND 4HNAD 5CECB 2JABA 5D66A 5FINA 4C48B 3Q9UC 4HLLA 3ZU7B 2NYJA 3SO8A 5HRYA 4TUMA 5ENRD 1SVXA 5EYPF 5HS0A 5JA4D 2MYOA 2P2CP 3ZNGA 5CBOA 5FIOA 2DZOA 4J8YA 4OAVB 2Y0BG 4O1OA 4GMRA 3JXJA 4HRMB 4F1PA 5ITZF 4HRLA 3TWRA 2V5QC 4LG6A 3W9GA 5KWDA 3TWVA 2A5EA 5ENOD 5EIDA 4K5AB 2VGEA 2RFMA 5AQBA 3ZKJA 1AP7A 4G8LA 5HKPA 4DRXE 1MX6A 5EIBE 2DVWA 2F8YA 4U95D 3TWWA 4U96D 4A63B 5KNGA 1N0RA 5CBNA 4O1PA 1N11A 3AJIA 3TWSA 3DEOA 1DCQA 3AAAC 2BKGA 2PNNA 1G3NB 5ENTD 5AQ7A 3IXEA 5CEAA 1DC2A 1MJ0A 5AAOA 3F6QA 4O60A 1N0QA 2B0OE 1UOHA 1YMPA 5AN8A 5AARA 3LJNA 5AQ9A 2F8XK 1WDYA 5ENQD 2HE0A 1TR4A 1OY3D 4BEPA 2XEHA 3UXGA 4HQDA 2XZDG 3HG0D 3V2XA 1MX2A 1QYMA 3DEPA 4LSZE 3B7BA 4HI8A 3JUEA 2ZGDA 1IXVA 4N5QA 3UTMA 3KEAA 2AJAA 1K1BA 3B95A 4B93B 2QYJA 1YCSB 2J8SD 3T9KA 2QC9A 4GPMA 5EN5D 3JXIA 3TWXA 3UI2A 3V79K 3NOGD 4HBDA 3Q9NC 1BLXB 2XEEA 3NOCD 4RLYA 1K3ZD 4HI9A 3ZUVB 4DX6D 1A5EA 3NBNB 5EILA 4HRNA 3EU9A 3T8KA 2FO1E 4QFVA 2RFAA 2DWZA 2F37A 4LNUD 4U8VD 2Y1LE 2ETCA 5AQAA 3TWQA 4DX7D 2L6BA 3EHQA 3D9HA 5BXOA 3J5PA 3TWUA 4Z68A 4ZFHA 5ENPD 1AWCB 4YDWA 4CZ2D 2XENA 5KBAA 1BD8A 4QQIA 4ATZD 4OAUC 1OT8A 2XZTG 3EHRA 3HRAA 4DX5D 5CEDB 4BETA 4K5BA 1MYOA 1MX4A 1BI7B 2ZGGA 1IHBA 1BU9A 1K1AA 2ETBA 2KBXA 4JB8P 3V31A 1SW6A 2DZNA 4HB5A 4F6RD 1S70B 4U8YD 2ETAA 4UUCA 4YDYA 2BKKB 4J7WA 3W9FA 1WG0A 3TWTA 4G8KA 1NFIE 3J5QB 1YYHA 3V2OA 4DX1A 4K5CA 5ENSD 4BSZB 4ZHBA 1D9SA 2KXPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4H C;  5BXU A;  4CYM D;  5KNH D;  5JMN D;  5CER B;  4DUI A;  4DX2 A;  1BI8 B;  5EYL A;  4BES A;  4NIK A;  3C5R A;  3V30 A;  4BER A;  1IKN D;  4HNA D;  5CEC B;  2JAB A;  5D66 A;  5FIN A;  4C48 B;  3Q9U C;  4HLL A;  3ZU7 B;  2NYJ A;  3SO8 A;  5HRY A;  4TUM A;  5ENR D;  1SVX A;  5EYP F;  5HS0 A;  5JA4 D;  2MYO A;  2P2C P;  3ZNG A;  5CBO A;  5FIO A;  2DZO A;  4J8Y A;  4OAV B;  2Y0B G;  4O1O A;  4GMR A;  3JXJ A;  4HRM B;  4F1P A;  5ITZ F;  4HRL A;  3TWR A;  2V5Q C;  4LG6 A;  3W9G A;  5KWD A;  3TWV A;  2A5E A;  5ENO D;  5EID A;  4K5A B;  2VGE A;  2RFM A;  5AQB A;  3ZKJ A;  1AP7 A;  4G8L A;  5HKP A;  4DRX E;  1MX6 A;  5EIB E;  2DVW A;  2F8Y A;  4U95 D;  3TWW A;  4U96 D;  4A63 B;  5KNG A;  1N0R A;  5CBN A;  4O1P A;  1N11 A;  3AJI A;  3TWS A;  3DEO A;  1DCQ A;  3AAA C;  2BKG A;  2PNN A;  1G3N B;  5ENT D;  5AQ7 A;  3IXE A;  5CEA A;  1DC2 A;  1MJ0 A;  5AAO A;  3F6Q A;  4O60 A;  1N0Q A;  2B0O E;  1UOH A;  1YMP A;  5AN8 A;  5AAR A;  3LJN A;  5AQ9 A;  2F8X K;  1WDY A;  5ENQ D;  2HE0 A;  1TR4 A;  1OY3 D;  4BEP A;  2XEH A;  3UXG A;  4HQD A;  2XZD G;  3HG0 D;  3V2X A;  1MX2 A;  1QYM A;  3DEP A;  4LSZ E;  3B7B A;  4HI8 A;  3JUE A;  2ZGD A;  1IXV A;  4N5Q A;  3UTM A;  3KEA A;  2AJA A;  1K1B A;  3B95 A;  4B93 B;  2QYJ A;  1YCS B;  2J8S D;  3T9K A;  2QC9 A;  4GPM A;  5EN5 D;  3JXI A;  3TWX A;  3UI2 A;  3V79 K;  3NOG D;  4HBD A;  3Q9N C;  1BLX B;  2XEE A;  3NOC D;  4RLY A;  1K3Z D;  4HI9 A;  3ZUV B;  4DX6 D;  1A5E A;  3NBN B;  5EIL A;  4HRN A;  3EU9 A;  3T8K A;  2FO1 E;  4QFV A;  2RFA A;  2DWZ A;  2F37 A;  4LNU D;  4U8V D;  2Y1L E;  2ETC A;  5AQA A;  3TWQ A;  4DX7 D;  2L6B A;  3EHQ A;  3D9H A;  5BXO A;  3J5P A;  3TWU A;  4Z68 A;  4ZFH A;  5ENP D;  1AWC B;  4YDW A;  4CZ2 D;  2XEN A;  5KBA A;  1BD8 A;  4QQI A;  4ATZ D;  4OAU C;  1OT8 A;  2XZT G;  3EHR A;  3HRA A;  4DX5 D;  5CED B;  4BET A;  4K5B A;  1MYO A;  1MX4 A;  1BI7 B;  2ZGG A;  1IHB A;  1BU9 A;  1K1A A;  2ETB A;  2KBX A;  4JB8 P;  3V31 A;  1SW6 A;  2DZN A;  4HB5 A;  4F6R D;  1S70 B;  4U8Y D;  2ETA A;  4UUC A;  4YDY A;  2BKK B;  4J7W A;  3W9F A;  1WG0 A;  3TWT A;  4G8K A;  1NFI E;  3J5Q B;  1YYH A;  3V2O A;  4DX1 A;  4K5C A;  5ENS D;  4BSZ B;  4ZHB A;  1D9S A;  2KXP C; 
#chains in the Genus database with same CATH topology
 1NA3 A;  1Q2Z A;  1BI8 B;  3CQG B;  4L1B A;  4NIK A;  4GAA A;  3ZYL A;  4I2W A;  5CEC B;  3FU5 A;  3G2T A;  3FHE A;  3U66 A;  5JHA A;  1TYQ G;  5JA4 D;  3E33 A;  1YA0 A;  2GRQ B;  3MEK A;  3CK8 A;  2DIW A;  4GMJ A;  5KWD A;  2BF0 X;  2L6J A;  4GZ5 A;  3X2Q E;  2AXU A;  1OCZ E;  2DVW A;  3P2B A;  4TUU A;  3ASD A;  5CBN A;  1FT2 A;  4A55 A;  3DSV A;  3TL5 A;  3AAA C;  5ARG A;  2I1J A;  3P1U A;  4UWF A;  1HX8 A;  3NAW A;  5J08 A;  4HOR A;  3NF1 A;  4DLO A;  3EU5 A;  2X6F A;  3MZL B;  3ZEF A;  4U0Z A;  3SI5 A;  2WXP A;  1HU3 A;  3HXC A;  3SY2 A;  3ASH A;  4EQF A;  2EIK E;  4GYY A;  5BPP A;  4GTP A;  4JD2 G;  5CMY A;  3FUF A;  3L17 A;  4CT4 A;  1WM5 A;  3FTX A;  1NL4 A;  4UQZ A;  5LCW C;  2I1K A;  3RJV A;  2VSX E;  3PS6 A;  4CCA A;  1Z3X A;  1MZC A;  5ENP D;  2XEN A;  4PDX A;  4JXT A;  2UWJ G;  3QAR A;  4OAU C;  3PEU B;  3FTY A;  3OTN A;  1MYO A;  1BI7 B;  3OXL A;  1IHB A;  1N95 A;  3CIA A;  4AXH A;  4I1M A;  2BUG A;  4GTS A;  4ANV A;  3NZU A;  1YYH A;  2WMO A;  3UT4 A;  3HXE A;  3ZU7 B;  3CK9 A;  3FH8 A;  2NXP A;  1E8X A;  4O1O A;  3EIJ A;  2J08 A;  5DIZ A;  3ULY A;  5HI7 A;  4DRX E;  4L2L A;  4KZC A;  4WND A;  4WAF A;  5CCM A;  2CHW A;  4J8S A;  5ENN A;  4G26 A;  1H19 A;  2ZU6 B;  3FY4 A;  2KCK A;  3OXG A;  2UY1 B;  3TAX A;  2GRP B;  3IV0 A;  5A23 A;  3LCA A;  4HQD A;  3I5P A;  2KCL A;  4LSZ E;  3QWW A;  4GU5 A;  1JPL A;  3UTM A;  3N71 A;  3CR3 A;  3LVR E;  3S7J A;  1HZ4 A;  4GYO A;  1OWN A;  2WXM A;  3EU9 A;  3JQ0 A;  2R59 A;  3EHM A;  1E96 B;  3AG3 E;  4F53 A;  2GRM A;  1DNP A;  3NB2 A;  4QQI A;  5G05 J;  2ZGG A;  4XI0 A;  2IOS A;  2R05 A;  4HB5 A;  3RSE G;  4J7W A;  4RVB A;  1WAO 1;  2PQN A;  5KNH D;  2ZIR A;  4DUI A;  2PQR A;  3ULQ A;  4FUL A;  4GA1 A;  4X8Q A;  3L13 A;  4CEM A;  4HLL A;  5ENR D;  2XS8 A;  3EIQ C;  3ZNG A;  2LUH A;  3VLD A;  2AWI A;  2FEZ A;  3FTZ A;  3ASO E;  4HRM B;  3ULE G;  4EHM A;  3VTX A;  2J4D A;  3CHS A;  2FI7 A;  3T5V A;  3U4T A;  4G8L A;  2F8Y A;  4KVO A;  3QJZ A;  4JHR A;  3CVU A;  5J90 A;  2MOW A;  4JA9 A;  2PNN A;  2NC9 A;  3T5X A;  4GYW A;  3SFY A;  4DK5 A;  1WDY A;  2YHE A;  3GW4 A;  4PS3 A;  1JCQ A;  3ZPJ A;  2E0I A;  1QYM A;  1S64 A;  2XGS A;  4N5Q A;  5LP0 A;  2AJA A;  1K1B A;  4BT9 A;  4B93 B;  2Y4T A;  2WXK A;  3CLJ A;  3HHM A;  3ONL A;  4HBD A;  4AY5 A;  3RRN B;  2WVI A;  1HG5 A;  4HI9 A;  5FQ8 A;  2XHE A;  3RIB A;  3CVL A;  3Q78 A;  3PH0 C;  3L82 A;  2F37 A;  4AY6 A;  3CK7 A;  3J5P A;  1UJK A;  5ANR A;  4GZ3 A;  4A3T A;  3ZIM A;  2XPZ A;  2OEV A;  2CFZ A;  3URZ A;  3ESL A;  4AEZ C;  2R02 A;  2R03 A;  4GTO A;  1EF1 C;  3D9M A;  1JWG A;  1O5M A;  3E32 A;  4GTT A;  4CYM D;  1E8W A;  5KJN A;  4E6H A;  4MBG A;  3KSQ A;  1E7V A;  3Q9U C;  3RU0 A;  2P2C P;  3DXM G;  2R2L A;  1QZ2 A;  5C1D A;  2LAI A;  4L2Y A;  3QK0 A;  1P5Q A;  4IRU A;  4K5A B;  4A1S A;  4RSY A;  3D9N A;  5FTP A;  2C0L A;  2I6H A;  1TNB A;  1N94 A;  4ME2 A;  5E76 A;  2AXZ A;  2BKG A;  2IU1 A;  1RZ4 A;  4I1O B;  3LJN A;  3SD5 A;  3DPD A;  2HE0 A;  5JJT A;  1SZ9 A;  3CHQ A;  4JZY A;  2RG8 A;  2A5U A;  3RRM B;  2P9K G;  2AVP A;  3EHN A;  3ABM E;  4JL0 A;  3UM3 A;  3BG0 B;  3UI2 A;  1H2U A;  3JXI A;  1KLX A;  1BLX B;  2XEE A;  3ZUV B;  1O1S A;  3NBN B;  4I9E A;  5BUZ A;  2XS1 A;  4TXQ A;  3FDH A;  3G2W A;  3LKU A;  2DYR E;  3LJ3 A;  4WWP A;  2A4Z A;  4ABN A;  3FH7 A;  2MRI A;  4WNE A;  1VDY A;  1TJF A;  2P9I G;  4BX8 A;  1D8D A;  2KC7 A;  4A3V A;  5T8I A;  1UW4 B;  4I6J A;  1WG0 A;  3GZS A;  5B1A E;  3E30 A;  3CST A;  2OND A;  4FP7 A;  3VLF A;  4BWR A;  4H7X A;  1ELR A;  4BES A;  3V30 A;  2IO2 C;  2L9B A;  5LCW J;  2X6J A;  4JHK A;  3RK6 A;  2F0Y A;  4JC8 A;  3UMV A;  5CBO A;  3U3W A;  4EPZ A;  3TWR A;  2YIN A;  2I9C A;  2VGE A;  5BV0 A;  1U3C A;  5KNG A;  2L0I A;  4O1P A;  1HE8 A;  3T8M A;  2X6I A;  1PC2 A;  4I2Z A;  1G3N B;  5AAO A;  5AAR A;  1TR4 A;  4ILG A;  1N9A A;  1LTX A;  4EBA G;  2RKK A;  3SF4 A;  4TXP A;  4RLY A;  3Q7A A;  3FP3 A;  3FUE A;  3PZD A;  4KMO A;  2DWZ A;  2C2L A;  1BPO A;  4MRU A;  4L23 A;  4CZ2 D;  4R7L A;  5E75 A;  5G55 A;  3ZYK A;  1V55 E;  1OXJ A;  2KBX A;  4F6R D;  2DZN A;  1S70 B;  3DWL G;  4HXI A;  1OCC E;  3MCX A;  5D0O D;  3B7U X;  3CV0 A;  1H2V C;  3D9J A;  2GW1 A;  2E2E A;  1LF8 A;  4BSX A;  1E90 A;  1SQM A;  4HNA D;  4U07 A;  3LY8 A;  3SO8 A;  4LNG A;  4EZL A;  3FUN A;  3UUX A;  3NZS A;  1FVF A;  2H6F A;  2VSO E;  4N3A A;  2WMN A;  4AOF A;  2VGX B;  2IY0 C;  1UN8 A;  2J09 A;  3FTW A;  5EX3 A;  4WNF A;  4FA6 A;  1FT1 A;  4XIF A;  3AJI A;  2EIM E;  2YQ8 A;  3Q4A B;  4GTM A;  2QZA A;  4B89 A;  2XCB A;  4HOT A;  4BEP A;  4GZ6 A;  3FUI A;  4ANU A;  2VTB A;  3ZYM A;  4CDM A;  4PUC A;  3I3N A;  4JHJ A;  3ASF A;  2P58 C;  3LY7 A;  3HXD A;  3CVN A;  4UI9 K;  3D9H A;  3MV3 B;  2J9Q A;  2OVB A;  3JCK C;  3FUD A;  3ZFW A;  2LSU A;  2R17 C;  2V5F A;  5AYW D;  3FUH A;  5AEN A;  4MLP A;  3SNX A;  3UIO C;  2BED A;  1PAQ A;  3Q79 A;  4PH4 B;  3V2O A;  3J5Q B;  5ENS D;  1ZBP A;  2V4H C;  5M72 A;  4IN3 B;  4HOQ A;  3BU8 A;  4ANW A;  4DX2 A;  4EZJ A;  3WXX A;  3L6A A;  3PEV B;  4BER A;  5FIN A;  3EUV A;  4C48 B;  4OAV B;  1XNF A;  3CEQ A;  3IEG A;  4F1P A;  4HRL A;  4I1A A;  4H7Y A;  5AJL A;  2FUL A;  4XKB A;  3IBE A;  5ENO D;  4XI9 A;  3DPY A;  4CGV A;  3S7B A;  1SZA A;  4C0M A;  3AS5 A;  4U96 D;  4A63 B;  1NP7 A;  5FT9 A;  3CGH A;  3ZYQ A;  3RAU A;  2XEV A;  3Q7F A;  5ENT D;  3FEY A;  4O60 A;  5ENQ D;  4ACL A;  2WM9 A;  4BFR A;  1MX2 A;  3DEP A;  2OV8 A;  4IUL A;  2FF4 A;  4E85 A;  1U3D A;  2MHK A;  2YNQ A;  1LD7 A;  3ZXS A;  2KCV A;  2VSY A;  3ABL E;  5AJD A;  5FQ4 A;  4NQ0 A;  4L9P A;  4W9R A;  5A7D B;  2DBA A;  2XZT G;  2I2O A;  2HM8 A;  5EX0 A;  4WWO A;  2C0M A;  5LFA A;  3CVP A;  4U63 A;  3CVW A;  4XE0 A;  3VLE A;  2KM4 A;  5C2Y A;  4DX1 A;  4D10 C;  4EBA A;  4AV7 A;  2H6H A;  1D9S A;  3B7S A;  2CFU A;  1FVH A;  1SA4 A;  5CER B;  4GZC A;  2XPI A;  1Y8M A;  1HS6 A;  3DBS A;  2JAB A;  2ZIS A;  3HVE A;  5BW8 C;  3GZ1 A;  2V5Q C;  3UT7 A;  5B3S E;  3FUM A;  4G11 A;  3ENE A;  1PY1 A;  2PZI A;  5JJ6 A;  1ELK A;  4V3I A;  1KPS B;  2Y4U A;  4JW1 A;  4EZK A;  5BT1 A;  3PUK A;  4Q96 A;  4P29 A;  3ZVV A;  2IOL A;  3CKB A;  3SZ7 A;  4MS6 A;  3B7B A;  3MX3 A;  4TRQ A;  3TG4 A;  4NAC A;  3S7F A;  4CGW A;  3PZ4 A;  3Q15 A;  2WXQ A;  5EN5 D;  3R9M A;  3Q9N C;  2WPV A;  1JCS A;  3FU6 A;  3MGB A;  2Y1L E;  5AQA A;  2L6B A;  3ZN3 A;  3Q47 B;  2KZT A;  4DI3 A;  3UIN C;  1HF8 A;  1BD8 A;  4C9B B;  2WXJ A;  2PL2 A;  2ILR A;  1KT0 A;  2JLB A;  1IQR A;  1NA0 A;  4F3V A;  4EEC A;  3QNK A;  3U64 A;  4U0S A;  5JHB A;  1HXI A;  1IHG A;  5D2M C;  3C5R A;  2PM6 A;  4U04 A;  3U9W A;  2WXI A;  4RG6 A;  2GRR B;  5FIO A;  3QWV A;  3WG7 E;  2B6C A;  3ZKJ A;  3DRA A;  5HKP A;  1MX6 A;  1H2T C;  3TWS A;  2LAH A;  4N2S A;  1Z6T A;  3F6Q A;  4UI9 J;  5AQ9 A;  2EIJ E;  3Q73 A;  3CKC A;  2XEH A;  2CG2 A;  2M63 A;  3UXG A;  3HG0 D;  3LXU X;  4HI8 A;  4N2Q A;  2P9S G;  3JUI A;  2HYZ A;  5CHE E;  3UT8 A;  3TXN A;  2FO7 A;  2IQC A;  1NI1 A;  2L0T B;  3T8K A;  2FO1 E;  4QFV A;  3UM2 A;  2XGM A;  3B7R L;  5KJL A;  4NUR A;  4OVV A;  3SQV A;  4DI4 A;  4FJZ A;  3Q5M A;  4ZFH A;  5KBA A;  2LO6 A;  4HOU A;  4K0R A;  2WXF A;  3DSS A;  4NRH B;  2QYU A;  4K5B A;  1H6P A;  4Y6W A;  3QWP A;  1BU9 A;  2ETB A;  2HO1 A;  1JUQ A;  3L9T A;  3BUA A;  2BKK B;  3FFL A;  3SHF A;  2Y69 E;  4Q94 A;  3HXB A;  4K5C A;  3FWV A;  3LS8 A;  5JMN D;  3IHY A;  1TN8 A;  3FUJ A;  2JEK A;  3ZW3 A;  1DCE A;  3R7R A;  2VQ2 A;  1L5J A;  1U2V G;  3HXF A;  5EYP F;  4J8Y A;  3OXF A;  4FHK A;  3C3Q A;  2Y3A A;  1TNU A;  1INZ A;  3G2U A;  1ELW A;  3FTU A;  3D9P A;  4UWG A;  4XZ4 A;  3E34 A;  4BTB A;  3QAQ A;  1DC2 A;  1OCO E;  3RRU A;  2B0O E;  1UOH A;  1YMP A;  5AN8 A;  4B8A A;  3LVQ E;  5LX8 A;  3QOU A;  3QB2 A;  2LSV A;  3VTY A;  3HDX A;  2UY1 A;  1N54 A;  1TN7 A;  4K03 A;  4KT6 B;  2ZGD A;  2OOE A;  4MKT A;  3AG2 E;  4JEU A;  3RKV A;  2OEW A;  4N5C A;  3G2S A;  4YVO A;  1K3Z D;  4APO A;  4J0U A;  4Q69 A;  1E8Y A;  4UWL A;  3D9O A;  3MKQ A;  4RQI A;  1OWL A;  2OCC E;  4PS7 A;  4BY6 A;  5CED B;  4HOS A;  3TXM A;  4GCO A;  3UX4 A;  3DXK G;  4UUC A;  2XRY A;  1RW2 A;  3O48 A;  4FJY A;  3AU4 A;  3TWT A;  2X6H A;  2WXN A;  4UQY A;  3QKY A;  5BXU A;  5FZQ A;  3B13 A;  5ARF A;  4DJA A;  2WXL A;  5EYL A;  1NZN A;  4ACK A;  5AIJ A;  2WXG A;  4L7T A;  3EDT B;  2X38 A;  3AG1 E;  1TNY A;  3L54 A;  5HS0 A;  1N4R A;  4LUN U;  3FU0 A;  5ITZ F;  2AW6 A;  3TWV A;  3PRE A;  3RO2 A;  1TNO A;  3ZGQ A;  4TXR A;  1N0R A;  4ATG A;  4U0U A;  3O4Z A;  4KVM A;  2LXM A;  3DEO A;  2KZT B;  1JWF A;  3IXE A;  4FHJ A;  3UQ3 A;  3UPV A;  2GRO B;  5BV1 A;  4FAD A;  3UKU G;  4LRZ A;  2QFC A;  4BTA A;  4DLQ A;  3T9K A;  3PZ3 A;  1FPP A;  5FWQ A;  5EIL A;  3C3R A;  3TG5 A;  5DBK A;  4JEH A;  3TWQ A;  4Z68 A;  4ATZ D;  4BT8 A;  3HRA A;  4CRW A;  3I4G A;  3DSU A;  4OVU A;  4FLB A;  5FQ6 A;  5FQ7 A;  2P9U G;  5T4Y A;  4N3C A;  3ASN E;  4XEI G;  5EDS A;  4GA2 A;  4ZHB A;  1DCQ A;  2ZXW E;  4J8F A;  3RO3 A;  2WQ6 A;  3D9K A;  2V0P A;  3KS2 A;  3C72 A;  3MJW A;  3L16 A;  1OCR E;  3CVX A;  1MHQ A;  5HRY A;  4TUM A;  3UIP C;  1SVX A;  1LD8 A;  2MYO A;  2J49 A;  3PZ2 A;  1UG3 A;  1E7U A;  5FJY A;  5A6C A;  4LG6 A;  2VGY A;  4IYP A;  5EID A;  1X5B A;  3S2A A;  2WQ7 A;  2WXH A;  3L22 A;  3TWW A;  2FBN A;  5G04 C;  3IHV A;  5G2N A;  4GML A;  5KJM A;  4WWN A;  5CMW A;  3CHO A;  4I9C A;  2XZD G;  3ML9 A;  3ONK A;  5HQ8 A;  1N4Q A;  4CDN A;  2PM7 A;  4I17 A;  1QQE A;  3DSW A;  2QC9 A;  3MYV A;  4GPM A;  3V79 K;  1XGW A;  2GRN B;  3KEZ A;  3UM0 A;  3D9L A;  5JJ7 A;  3R7Q A;  3LPZ A;  3D9I A;  4AP2 A;  4U8V D;  2XGO A;  3ML8 A;  4LEU A;  4O6F A;  3GYZ A;  5BXO A;  3D3M A;  4J8D A;  3AS4 A;  2R5S A;  3B7T A;  2V4L A;  3R9A B;  4BET A;  1OUV A;  1K8K G;  1S63 A;  4G24 A;  1E8Z A;  2AXV A;  4APF A;  1SW6 A;  5KCM A;  3AU5 A;  2GRL A;  3E37 A;  1NFI E;  4AIF A;  4URK A;  3FEX A;  3FH5 A;  5BNW A;  3CQC B;  3PRZ A;  4U8H A;  1O1T A;  2KAT A;  4I43 A;  3TJP A;  3ZHE A;  4YDO A;  3SBS A;  1OWP A;  2DZO A;  1TNZ A;  4GMR A;  4YVQ C;  4ANX A;  4N39 A;  1FCH A;  3MV2 B;  4BX9 A;  1X81 A;  1Z3Y A;  3W9G A;  2P9L G;  3PNL B;  2RFM A;  4M3O A;  4HVB A;  1OWO A;  3MKQ B;  4C0E A;  3KAE A;  2IFU A;  4U7E B;  1QNF A;  4HLE A;  1N0Q A;  2CG3 A;  3Q49 B;  3I4R B;  3KEA A;  3FUL A;  5ANL A;  3BQO A;  5IY5 E;  3NOC D;  4N3B A;  4RG9 A;  4HRN A;  3QDN A;  4G1T A;  3K9I A;  4FC8 A;  2ETC A;  3FUK A;  3EHQ A;  1AWC B;  2WXO A;  4KBQ A;  4I6G A;  1HO8 A;  5T3R A;  1O1R A;  3SBT B;  3PE4 A;  1D8E A;  1DVP A;  1HG2 A;  4ILH B;  1K1A A;  3E4B A;  4JB8 P;  4ILI A;  1UJJ A;  2ETA A;  4YDY A;  3ISM C;  4M7C A;  2KXP C;  2VSN A;  5CRU A;  4AVX A;  5FZS A;  1KT1 A;  5D66 A;  3SGH A;  2NYJ A;  3GZ2 A;  3KD7 A;  3FTV A;  1S0P A;  2Y0B G;  3JXJ A;  3OAW A;  3PZ1 A;  4CT0 A;  2V8S E;  4F1S A;  3CVQ A;  3HYM B;  4XKC A;  3TGO A;  2ION A;  5AQB A;  5EIB E;  3CVV A;  2XPY A;  2CHX A;  3QC1 A;  2VTB B;  2DCP A;  2VGX A;  1MJ0 A;  4JPS A;  3APC A;  2P9P G;  3PNT B;  5B1B E;  3ASG A;  1H0A A;  3V2X A;  2HR2 A;  1N52 A;  5CRV A;  3NQP A;  3B95 A;  2H6I A;  4AJW A;  3APF A;  4DX6 D;  4FU3 A;  3DST A;  4GTV A;  5LOZ A;  4I6E A;  2RFA A;  1EDU A;  4LNU D;  4GB9 A;  3ZRH A;  4LCT A;  4DX7 D;  1HFA A;  2EQX A;  3MKR A;  3TWU A;  4GA0 A;  2J07 A;  3DSX A;  3EHR A;  1W3B A;  1Z5S C;  4LER A;  2Q7F A;  5CCL A;  4TV3 A;  4B8C B;  2X3M A;  1H6K A;  2XRZ A;  5EKQ D;  4G8K A;  4WUY A;  3PUJ A;  1N4P A;  4BSZ B;  3CHR A;  3JQ1 A;  1IYG A;  3PDN A;  4GZD A;  3IKO B;  1JCR A;  1EYH A;  4KYO B;  2IO3 C;  4FLH A;  3CSF A;  4GTQ A;  1AP7 A;  3PVL A;  4DPR A;  2H6G A;  3CVY A;  1QBQ A;  3BG1 B;  3UM1 A;  5AQ7 A;  3KSL A;  5CEA A;  1UN9 A;  2EIN E;  2F8X K;  1OY3 D;  4B0Z A;  3LEW A;  2IF4 A;  3AG4 E;  1SA5 A;  5D0Q D;  5G05 C;  1IXV A;  1V54 E;  4J8E A;  3JYS A;  3S7D A;  2QYJ A;  1YCS B;  1A5E A;  3CHP A;  2XCC A;  3ESK A;  3BEE A;  4OYS A;  5G04 J;  3HIZ A;  1GW6 A;  2X6K A;  3G2V A;  3ZHE B;  1OWM A;  1A17 A;  3LY9 A;  3UKR G;  4G23 A;  3FU3 A;  1OT8 A;  1IQU A;  4HS2 A;  4B94 A;  4G2V A;  4GCN A;  5KJK A;  4LNB A;  4WNG A;  3HVE B;  4YND A;  2RD0 A;  1TN6 A;  3ABK E;  1ZU2 A;  1TEZ A;  2GGF A;  1IKN D;  3EJN A;  1B89 A;  2CHZ A;  2NSZ A;  2VYI A;  1MQS A;  2QY7 A;  3MA5 A;  4JA7 A;  1KZO A;  3AS8 A;  2A5E A;  1Y6I A;  2VJ8 A;  4U95 D;  1ZB1 A;  1EPU A;  3FTS A;  1N11 A;  2OVF A;  1H6O A;  2EIL E;  4AM9 A;  3SFX A;  1TJC A;  3SFZ A;  4F7A A;  2YHC A;  2WXR A;  2J4B A;  3JUE A;  1N4S A;  4CDR A;  4HFG A;  2IEJ A;  4G25 A;  4KXK B;  2J8S D;  3LYA A;  4UQX A;  2BTD A;  3TWX A;  3NOG D;  3CHM A;  2P9N G;  4Y6C A;  4UWH A;  2LXL A;  1WY6 A;  4J6I A;  1KZP A;  3C3O A;  4A1G A;  4KZ0 A;  3L08 A;  5H7P A;  3APD A;  4UI9 C;  4YDW A;  4JVS A;  3Q75 A;  2LNI A;  2XQ0 A;  3C98 A;  4YDE A;  3ZXP A;  1HH8 A;  4DX5 D;  1MX4 A;  2IJG X;  4XX5 A;  2WB2 A;  4GPK A;  3V31 A;  2WQH A;  4U8Y D;  4PS8 A;  3LDZ A;  3W9F A;  2DYS E;  4UWK A;  4GTR A;  5FZR A;  3PE3 A; 
#chains in the Genus database with same CATH homology
 2V4H C;  5BXU A;  4CYM D;  5KNH D;  5JMN D;  5CER B;  4DUI A;  4DX2 A;  1BI8 B;  5EYL A;  4BES A;  4NIK A;  3C5R A;  3V30 A;  4BER A;  1IKN D;  4HNA D;  5CEC B;  2JAB A;  5D66 A;  5FIN A;  4C48 B;  3Q9U C;  4HLL A;  3ZU7 B;  2NYJ A;  3SO8 A;  5HRY A;  4TUM A;  5ENR D;  1SVX A;  5EYP F;  5HS0 A;  5JA4 D;  2MYO A;  2P2C P;  3ZNG A;  5CBO A;  5FIO A;  2DZO A;  4J8Y A;  4OAV B;  2Y0B G;  4O1O A;  4GMR A;  3JXJ A;  4HRM B;  4F1P A;  5ITZ F;  4HRL A;  3TWR A;  2V5Q C;  4LG6 A;  3W9G A;  5KWD A;  3TWV A;  2A5E A;  5ENO D;  5EID A;  4K5A B;  2VGE A;  2RFM A;  5AQB A;  3ZKJ A;  1AP7 A;  4G8L A;  5HKP A;  4DRX E;  1MX6 A;  5EIB E;  2DVW A;  2F8Y A;  4U95 D;  3TWW A;  4U96 D;  4A63 B;  5KNG A;  1N0R A;  5CBN A;  4O1P A;  1N11 A;  3AJI A;  3TWS A;  3DEO A;  1DCQ A;  3AAA C;  2BKG A;  2PNN A;  1G3N B;  5ENT D;  5AQ7 A;  3IXE A;  5CEA A;  1DC2 A;  1MJ0 A;  5AAO A;  3F6Q A;  4O60 A;  1N0Q A;  2B0O E;  1UOH A;  1YMP A;  5AN8 A;  5AAR A;  3LJN A;  5AQ9 A;  2F8X K;  1WDY A;  5ENQ D;  2HE0 A;  1TR4 A;  1OY3 D;  4BEP A;  2XEH A;  3UXG A;  4HQD A;  2XZD G;  3HG0 D;  3V2X A;  1MX2 A;  1QYM A;  3DEP A;  4LSZ E;  3B7B A;  4HI8 A;  3JUE A;  2ZGD A;  1IXV A;  4N5Q A;  3UTM A;  3KEA A;  2AJA A;  1K1B A;  3B95 A;  4B93 B;  2QYJ A;  1YCS B;  2J8S D;  3T9K A;  2QC9 A;  4GPM A;  5EN5 D;  3JXI A;  3TWX A;  3UI2 A;  3V79 K;  3NOG D;  4HBD A;  3Q9N C;  1BLX B;  2XEE A;  3NOC D;  4RLY A;  1K3Z D;  4HI9 A;  3ZUV B;  4DX6 D;  1A5E A;  3NBN B;  5EIL A;  4HRN A;  3EU9 A;  3T8K A;  2FO1 E;  4QFV A;  2RFA A;  2DWZ A;  2F37 A;  4LNU D;  4U8V D;  2Y1L E;  2ETC A;  5AQA A;  3TWQ A;  4DX7 D;  2L6B A;  3EHQ A;  3D9H A;  5BXO A;  3J5P A;  3TWU A;  4Z68 A;  4ZFH A;  5ENP D;  1AWC B;  4YDW A;  4CZ2 D;  2XEN A;  5KBA A;  1BD8 A;  4QQI A;  4ATZ D;  4OAU C;  1OT8 A;  2XZT G;  3EHR A;  3HRA A;  4DX5 D;  5CED B;  4BET A;  4K5B A;  1MYO A;  1MX4 A;  1BI7 B;  2ZGG A;  1IHB A;  1BU9 A;  1K1A A;  2ETB A;  2KBX A;  4JB8 P;  3V31 A;  1SW6 A;  2DZN A;  4HB5 A;  4F6R D;  1S70 B;  4U8Y D;  2ETA A;  4UUC A;  4YDY A;  2BKK B;  4J7W A;  3W9F A;  1WG0 A;  3TWT A;  4G8K A;  1NFI E;  3J5Q B;  1YYH A;  3V2O A;  4DX1 A;  4K5C A;  5ENS D;  4BSZ B;  4ZHB A;  1D9S A;  2KXP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...