1BISA

Hiv-1 integrase core domain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
154
structure length
146
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACEWAGIKQEFGIPIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 INTEGRASE
publication title Three new structures of the core domain of HIV-1 integrase: an active site that binds magnesium.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 44
structure length 146
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bisA00
1HPZA 3DRRA 5CZ2A 3OYDA 4CF1A 3VQQA 4DTMA 4KI6A 3VQDA 3ISNC 2G8WA 3O3HA 3MXJA 1MU2A 3AVHA 4F3TA 2Z1HA 4HUEA 2BGGA 4FZYA 3CFPA 1UOCA 3K5NA 1IH7A 1WSFA 2YNHA 3SQ4A 3P5JA 3NFAA 4O0JA 3VQEA 3O4QA 3KK1A 4E7JA 1W9HA 3ALYA 4KPYA 4Z4HA 4OKJA 3NDKA 1BQMA 4W5QA 1Y97A 3LP2A 3P83D 3QEWA 2IGIA 4E89A 3QIPA 4NYNA 3EZ5A 4BWJA 3C6UA 4IG3A 3O4NA 1S9EA 3OYCA 4DFKA 4B9LA 4Z4FA 5C42A 1BL3A 2GV9A 3V9UA 3ZT3A 1DTQA 3T19A 2FBVA 4W5RA 3I8DA 3SQ1A 2G8UA 5JS2A 1X9MA 4NCAA 4MQ3A 2Y1IA 4EZ6A 4Q0BA 4DSEA 4OLAA 2BANA 3T3FA 2O4GA 3V9ZA 1S1WA 2EX3A 3TAEA 2HNZA 2RKIA 4TSXA 4FJIA 4KHWA 3V1QA 3UIQA 3PX4A 3IRXA 2JLEA 1EETA 3DOKA 4E7IA 3B6PA 4B8CA 3ZT4A 1BISA 4I2PA 4KKOA 1FXXA 3VQ6A 4CJRA 3L3VA 1CZBA 3LPUA 2YKNA 3OJSA 3P1GA 3U3GA 3ZCMA 3V4IA 4CJFA 4O5BA 3S3OA 1JL2A 3VQCA 4CERA 1TL1A 4HCCA 3OYKA 3TANA 4KO0A 3K2PA 4IFVA 1UAXA 1ASWA 3LWMA 4IKFA 4AHCA 2E6MA 2B5JA 4CE9A 4BDYA 1BGXT 3MECA 3PO5A 3HO1A 1LWFA 2B6AA 1SUQA 1K6YA 3QLHA 2Q3SA 3BDPA 4M3ZA 4DF4A 3SUQA 1J9AA 1RBSA 4ICLA 2A1RA 4B9TA 4PQUA 1QE1A 1GOCA 2OZSA 3AA4A 1WAFA 4CEFA 1L3SA 2W42A 3DLKA 3HYFA 2B4JA 4IG0A 4DS5A 5FRMA 1QSSA 2HHTA 2Z1JA 4EP5A 3OYAA 1ZBHA 2FBTA 1JLFA 4CJ4A 3OJUA 5EU7A 1B9DA 4IFYA 1D9FA 5J2QA 5DMRA 1NJYA 4B9SA 4AHTA 1REVA 1XWLA 3OYMA 3AVLA 4DSLA 3BGRA 5HRNA 1NKBA 2FBYA 3KD5E 3SI6A 3OYNA 3NF9A 1SL0A 3AA5X 1LV5A 1KLMA 3TAMA 3AVFA 3ITHA 3KIOA 4HUFA 1RT5A 2RF2A 4O0IA 3AVIA 4XIUA 2XY6A 1KLNA 5J1EA 1KRPA 1B92A 4C8NA 3AVAA 1HYSA 4CF9A 3CFOA 1TKZA 3LAMA 1UA0A 3L2QA 4OGEA 4QOZB 1ASUA 2PYLA 2YNGA 5CZ1A 3T1AA 1LW2A 5E41A 1NOZA 4GMJB 3QEPA 3KJVA 3AO2A 3V81A 5HROA 1QQCA 4Y1CA 1NK5A 4I2QA 1NK4A 3QO9A 3VQPA 1C1CA 2I5JA 4C8LA 1BCMA 2X6NA 4FLXA 1NK9A 4KHNA 2VG5A 2Y1JA 3PV8A 4DQSA 4ZTFA 3D0PA 4DQIA 4LH5A 3LWLA 1RILA 3QERA 3ULDA 2P1JA 4NYFA 4CEDA 4DQPA 4AHVA 4CFAA 3AVGA 1HQUA 1HMVA 2GUIA 4FLTA 4E1MA 1NK8A 3DRPA 3F73A 3LP1A 4FM0A 1CXUA 2XHBA 4QCLA 1IO2A 1R0AA 3SJJA 4OLBA 1ZBIA 3AVNA 4FCYA 4Z4EA 2HVHA 1FKOA 2OPQA 2LSNA 2X74A 5KI6A 2YV0X 1JKHA 3DMJA 4CHOA 4RW4A 4FK0A 4FJXA 4CHNA 4J2DA 4CJPA 3SUNA 1S5JA 4FLWA 4H8KA 5J2NA 1L5UA 3ZSYA 2HHVA 3NF8A 4ZHRA 1U04A 1IG9A 1Z25A 1RTDA 4BACA 4Q5VA 1RT4A 5KRTA 1BHLA 3KLIA 3NH2A 1O1WA 3MEDA 3SQ2A 3TAPA 1Q9YA 5J2MA 1RT3A 2HW3A 4DTPA 3V1OA 3VQ5A 3D45A 2G8KA 4KB1A 4DG1A 3DOLA 3THVA 5FROA 2BE2A 3KK3A 5K14A 3LP3A 2HHWA 4DU1A 4AILC 2YHAA 2KQ2A 2D5RA 4FJJA 4J2AA 4H4MA 4DF8A 3C94A 3WNFA 5KGWA 4FVMA 4OJRA 1U4BA 3FFIA 4WE1A 3LANA 3RRHA 1WSGA 4K8XA 2VG7A 3IS9A 4CECA 4O4GA 1LAWA 3TAQA 1Q8IA 2WOMA 4C8KA 4RW9A 4FJ5A 4DTRA 3OY9A 5HRSA 2OZMA 1S6PA 4FJHA 3RTVA 4E7KA 1BIZA 1HRHA 1ZYQA 1XC9A 3A2FA 2HNYA 3SV4A 3DRSA 4OPJA 3M8SA 3JYTA 3QNNA 3ZT1A 3M8PA 5CYQA 4CGIA 4PWDA 2HHSA 4Z4CA 3ZSZA 2DTUA 3HPGA 4M41A 1ZBFA 3G0ZA 3OYEA 1B9FA 3QETA 5CYMA 3ZT0A 3PX6A 1S6QA 3AO5A 4CEEA 3QIOA 4DQRA 4FZXC 4FJ8A 1NJWA 4Z0UA 4CGFA 3LP0A 5C24A 4F8RA 1RDBA 3HVTA 3VA3A 1KVAA 3IAYA 2QXFA 3SNNA 4N41A 3LPTA 4AHUA 1A5WA 1RBTA 3C6TA 3HXMA 4DU3A 4ELVA 1J54A 3SV3A 1RCHA 3SPZA 3SUOA 2D0AA 5KGXA 1XHXA 3AO3A 3CYMA 3NBPA 3HPOA 4F4KA 2OPSA 4CHZA 4KAZA 2AJQA 3OYJA 4FK2A 4KB0A 1ZBLA 2RN2A 1J53A 3S3MA 1SV5A 3PX0A 1T7PA 3DLRA 1HNVA 4NCGA 1X9WA 1NK7A 4CCHA 1EX4A 3KK2A 4CFBA 4PUOA 5I42A 4B8AB 4E1NA 4N56A 2FBXA 3VQ8A 3RR7A 4AHSA 5DK5A 4CF2A 1RBVA 1A5VA 2VWKA 3MEEA 3RR8A 3KTQA 3SCXA 4DFPA 1TAQA 2OPPA 1NKEA 4DFJA 2FC0A 3NF7A 3DM2A 1LWEA 4N5SA 1A5XA 1I39A 1VSEA 3CM5A 1QTMA 1T8EA 4EZ9A 2GBZA 3RWUA 4HUGA 4M3XA 1GOAA 2YNFA 2KFNA 3I0RA 2YHBA 1NK6A 4DS4A 5FRNA 3CG7A 4YNQA 4CJEA 3TARA 4E7LA 4DSKA 4DWIA 2Z1IA 2QKBA 4KFBA 4ID1A 1TK5A 2QKKA 3K5OA 1ITGA 4KHYA 2XY8A 3HJFA 4FLUA 4CJWA 1JLAA 1FK9A 1RT1A 5KTQA 4CFDA 3KKSA 3LZIA 4HHTA 1WLJA 3QEIA 1SKWA 4F3OA 5D3GA 4GVMA 3MAQA 3VQ4A 1CLQA 4CHYA 1RDAA 4PA1A 2P51A 5I3UA 2P5GA 3M8RA 4RW6A 1C0UA 4DTXA 1N5YA 3L2VA 4M3YA 5HRPA 5HRRA 4J2EA 1IKYA 1JLGA 4CK2A 1QSLA 1NOYA 3V6DA 3NH1A 4DSIA 2Z1GA 2PZSA 4H4OA 2P5OA 1S1VA 4B9UA 4KHQA 3L2RA 4JS5A 4CEQA 1NKCA 4KV8A 2HMIA 4IDKA 4CJQA 2EHGA 4CIFA 3IG1A 2ZE2A 1U47A 4ELUA 1YVUA 2HB5A 3U3YA 3KLGA 2F96A 3V9WA 4M42A 1SL1A 3TWHA 4CEAA 2HHUA 4B9VA 3LAKA 2G8VA 2WONA 4CGHA 1KFDA 4OKEA 1TKDA 3ZSXA 1JXBA 1Q9XA 4AH9A 3NF6A 4W5TA 1WSEA 3MXMA 4E0DA 4FJ9A 3AA2A 1S1UA 4E19A 1EP4A 2XO7A 2HHXA 1Z26A 3HP6A 4KHUA 3ZSRA 3L8BA 1HJRA 3KLFA 1KVBA 4I7FA 4Y1DA 2OA8A 3RMAA 4FW1A 4RW8A 3SYZA 5HP1A 1RBUA 5FDLA 3EY1A 5J2PA 2PY5A 3QNOA 3O3GA 3ZSVA 2E4LA 1JLQA 3AVJA 1RT6A 3L3UA 2X6SA 3QINA 1HYVA 1RBRA 1J5OA 2G8FA 4C8OA 4FJMA 2R7YA 2QK9A 4PY5A 3F9KA 3K59A 5JS1A 4FJLA 3TAGA 4M3UA 3VQAA 4CIEA 4FJGA 1UWBA 4FXDA 1VSDA 3MXIA 1EXQA 4DMNA 3S9HA 3VQ7A 4DSJA 2KTQA 3AVBA 4FLYA 3EYZA 1ASVA 1DLOA 4CHPA 4JS4A 3HSTB 1WAJA 4CF0A 2IDOA 4BWMA 3NCIA 4KI4A 4FK4A 3KD1E 3CFRA 3TABA 1VSHA 4LH4A 4HTUA 4FM2A 1BCOA 3WNGA 1D8YA 4CGGA 4BDZA 2D0BA 1RDCA 3CQ8A 4DTOA 3SPYA 4B9NA 3ZT2A 4JRPA 4DTJA 3V9SA 1RT2A 3LDSA 4Z4IA 4JLHA 2G8IA 1I3AA 1S1XA 1WSIA 3NGYA 5HBMA 4CGDA 4DU4A 4DLEA 4LSLA 3PO4A 2KFZA 3OVNA 2KZZA 1GOBA 1TGOA 1D9DA 3NHGA 2OYQA 4FLZA 3ZSQA 3H08A 1WN7A 3OYGA 1NJZA 4M3WA 2O4IA 4DFMA 1C0MA 2ZD1A 1LWCA 1NJXA 4O44A 4CJUA 1FKPA 3HT3A 1KFSA 1ZBUA 2XY5A 3OYFA 3QESA 1KCFA 3KLHA 3TR8A 3WNEA 4FM1A 4E7HA 4RG8A 4EP4A 5SWMA 4DTNA 3M8QA 2D0CA 2IC3A 1RDDA 1IKXA 4CJKA 5HLFA 4ZTJA 4LY7A 1TK0A 3NAEA 3ZSOA 4CJ3A 4K8ZA 3L2UA 3AO1A 4LD0A 3RMCA 4GW6A 1TKXA 1JLCA 2RPIA 5KRSA 3HPHA 1S9GA 4FJNA 2IAJA 4I9LA 3ZSWA 1C1AA 4KTWA 1TV6A 1TL3A 3AA3A 1L3UA 3VQ9A 4HVJA 4M3RA 4OPKA 1VSFA 3L2WA 3I0SA 1CXQA 1SKSA 4FZZA 4F2RA 1VK0A 1UA1A 4DLGA 2ETJA 1TAUA 4YFUA 3DLHA 4JRQA 4OGCA 4I9QA 2ITGA 3AV9A 1U49A 2A1SA 3AVKA 4B3OA 4R5PA 1RTJA 3K57A 4QAGA 1WNSA 1F21A 3RMBA 2DY4A 2XY7A 1C6VA 1TVRA 3OS2A 4ELTA 1QHTA 1KSPA 3V1RA 2HHQA 4CEZA 1EKEA 1YTAA 2JGUA 3NH0A 3DLEA 2VG6A 3VA0A 3OS0A 2DFEA 4CJTA 1XHZA 2PYJA 2HNDA 1TKTA 1VRUA 3AO4A 4CFCA 3K5MA 2F8TA 1HNIA 1U48A 1VSIA 4CK1A 4J2BA 5SZTA 4M45A 4KREA 2HVIA 2G8HA 4CK3A 3DLGA 5C25A 5T7BA 1U45A 4Z4GA 1VRTA 2YKMA 1C0TA 2DFHA 3LZJA 4BE0A 1KVCA 2OPRA 4IBNA 3TI0A 3HM9A 3HP9A 4OKKA 1G15A 2DFFA 4HCBA 3WNHA 4UQGA 2XRIA 3OYLA 1X1PA 2ATQA 4B08A 1RTHA 4CF8A 3VN5A 3HVRA 3QEXA 3OYHA 1T05A 4BDPA 4CIGA 4BE1A 1YT3A 4OVLA 4CEBA 2YNIA 1W0HA 1KTQA 1C1BA 1X9SA 4CJLA 1JLBA 3B6OA 4L8RB 4CJVA 4C8MA 3VQBA 1RTIA 3AVCA 2ZQBA 3SUPA 4BE2A 4W5OA 1T03A 3V9XA 4AHRA 1TK8A 4FLVA 3RMDA 1YTUA 1JXEA 1BIUA 4FYDA 4FW2A 1HQEA 4DQQA 4CJ5A 3NGIA 1QS4A 1SL2A 4W5NA 4CGJA 1XI1A 3HL8A 3NGZA 1L3TA 4N47A 3QEVA 1JL1A 4DTUA 3KKRA 3OYBA 4KTQA 3K5LA 4LSNA 3TAFA 3CM6A 1VSLA 1VSKA 4G1QA 4ID5A 3OYIA 4DTSA 1IKVA 2X78A 2NUBA 1IKWA 2VWJA 3JSMA 4M3TA 1HYZA 4CESA 2F8SA 1DTTA 1LW0A 4KHSA 3RRGA 1SKRA 4CJSA 4MFBA 1BI4B 1VSMA 3HK2A 4FJKA 2KW4A 3DI6A 4DSFA 5CY4A 4O55A 3PUFA 1QSYA 4NCBA 4B9MA 4KRFA 3G10A 3LALA 1BQNA 3AVMA 1JLEA 3C95A 2IS3A 3DLBA 1CZ9A 3SQ0A 3K58A 3NE6A 1RNHA 2KZMA 1NK0A 1BI4A 4E3SA 3KLEA 4CEOA 3ASMA 2BDPA 4FJ7A 4RW7A 3SZ2A 1VSJA 3S3NA 1WSHA 3OS1A 3U6FA 2IOCA 4N76A 4KTZA 1D5AA 3O3FA 1N6QA 3DYAA 3PY8A 4F2SA 4CHQA 1RT7A 2E6LA 3E01A 1S1TA 1LAVA 1L3VA 1WSJA 3MEGA
chains in the Genus database with same CATH superfamily
5LJWA 3MX2A 4JI6K 3VQDA 4CZLA 2G8WA 1MU2A 4HUEA 2VQEK 3MWTA 2YNHA 3NFAA 1E4FT 1Y64A 1R59O 3R8EA 1W9HA 4YOUA 4OKJA 1BQMA 4W5QA 2KHOA 1V4TA 3P83D 5MLCQ 1KD1O 1Q7YO 2CGJA 3KVGA 2GV9A 2FBVA 1HKGA 4W5RA 4MQ3A 4YDUA 2BANA 3V9ZA 1S1WA 4IZ9A 3PX4A 3IRXA 4JKCA 4E7IA 3B6PA 1NMDA 1GLEG 4B8CA 4BRHA 4CW7B 3VMFB 4KKOA 4CJRA 4RWTA 1FXXA 3L3VA 2P9LA 4B3RK 3OJSA 3CC7N 5BREA 4O5BA 3LDOA 3C7NA 3LWMA 4AHCA 4CE9A 1W97L 1LWFA 2B6AA 1ATRA 3BDPA 4M3ZA 2CH5A 4DF4A 3VF4A 3SUQA 4PQUA 1GOCA 3ATVA 3AA4A 5AQJA 1L3SA 4IG0A 1MWKA 1IBKK 4EP5A 3G6EN 1ZBHA 4CJ4A 5J2QA 5LJVA 4NCAA 1XWLA 3T69A 3WQTA 3AVLA 3OYMA 3BGRA 1NKBA 3SI6A 1SL0A 3NF9A 3AA5X 3VEOA 2W6LA 1KLMA 1OH6A 3AVFA 3ZX2A 1RT5A 3ZEUB 5E84A 2XY6A 5J1EA 1B92A 4C8NA 3AVAA 3CHWA 1UA0A 1XC3A 1TKZA 3LAMA 1KC8O 3L2QA 1EWQA 4OGEA 5CZ1A 5E41A 3AO2A 3V81A 1QQCA 4PKHA 1NK4A 4KBOA 1BCMA 3GG4A 4K41A 5M1NA 4KHNA 1RILA 4K25A 2P1JA 4NYFA 4CEDA 4CFAA 1HMVA 3EL2A 4B1UB 2JWKA 3F73A 2XHBA 1W7AA 2HVHA 1NM1A 5EY4A 5BR9A 1FKOA 2OPQA 2X74A 3ZYYX 4OPHA 4FJXA 1S5JA 4FWRA 5IWAK 3NF8A 4LFAK 3AAQA 1RT4A 4BR5A 4U7BA 3KLIA 3NH2A 1O1WA 3MEDA 1Q9YA 3RSEB 4WQ5A 1QHAA 3E1YA 2HHHK 4IXCA 4H0XB 3THVA 3CJCA 3QFUA 2NRTA 4DU1A 1Z05A 4FJJA 4H4MA 3WNFA 2J4RA 5KGWA 4K8XA 3FFIA 3MWPA 2P9PA 3LANA 1WSGA 3RRHA 1HNWK 2VG7A 2O8EA 4QS7A 1LAWA 4C8KA 4DTRA 1VQNN 1S6PA 4XEIA 1QZ6A 3VGMA 1ZYQA 3SMPA 3DRSA 3QNNA 1T6DA 4CGIA 5CYQA 4CZEA 3ZSZA 2DTUA 4LF7K 1NWKA 1ZBFA 4BQLA 3QETA 4A2BA 3U9ZA 4DQRA 1XQSC 4Z0UA 3LP0A 5C24A 1VQ5N 3D2FA 3SNNA 3LPTA 1RBTA 2Q97A 1J54A 3SPZA 1XHXA 3CYMA 3CCQN 4F4KA 3WXJA 4CI6A 2H3GX 4KB0A 3S3MA 1J53A 3EE8A 3AGKA 3DLRA 1HNVA 4NCGA 1NK7A 1EX4A 4FPBA 3KK2A 4PUOA 3SLCA 5DM6L 3O1BA 4CF2A 5DK5A 4B1ZA 1A5VA 2VWKA 2VYPA 3SCXA 2GELA 4DFJA 4CJ7A 3DM2A 5AZIB 1I39A 1VSEA 5HOOA 1NGEA 4EZ9A 3RWUA 3NVKA 3THWA 2NRZA 2YHBA 5FRNA 4JI5K 4DWIA 2Z1IA 3OBWA 4DV1K 5KTQA 3LZIA 3KKSA 1SKWA 4F3OA 1WLJA 2OCEA 4LF8K 3VQ4A 4I6MA 4AM7A 2P51A 1GLJO 1OH7A 1C0UA 3S41A 1N5YA 3L2VA 4M3YA 5HRPA 1IKYA 4NLCA 1BWFO 3ENBA 4H4OA 2NRHA 4KHQA 3L2RA 2ASPA 4KV8A 1KXPA 3FR0A 4IDKA 3LDPA 2EHGA 1E3MA 4FO0A 1YVUA 3KLGA 4M42A 3TWHA 2G8VA 1GLFO 1SQKA 1KFDA 4CGHA 4LF5K 1Q9XA 4E0DA 3NF6A 1NMNA 1WSEA 1MDUB 4DHYA 3AA2A 5AQWA 4E19A 1EP4A 3MXMA 4FJ9A 2HHXA 3HP6A 4KHUA 2O8FB 2A6AA 2NNWA 4I7FA 1RGIA 3D6RA 4JI2K 1HKBA 1TYQA 4FW1A 3SYZA 1I94K 5IT9O 1OH8A 2PY5A 3QINA 2R7YA 3K59A 1QQOA 4GV9A 3MXIA 2QWMA 4DMNA 3AVBA 4FLYA 1ASVA 1DLOA 4KI4A 3NCIA 3BP8A 3KD1E 4BRFA 3CFRA 3Q7CA 1VSHA 4LH4A 1BCOA 2D0BA 3CQ8A 3JXUA 3V9SA 1RT2A 4Z4IA 2ASOA 4CGDA 5KPTA 4BR9A 3OVNA 5TKWA 1GOBA 2OYQA 3CCLN 1WN7A 3PIPL 3OYGA 3CMEN 4K0KK 1C0MA 5JICA 1NJXA 1JCGA 3UKUA 4BC2A 2V7ZA 4JKAA 1QQMA 3OYFA 3TR8A 3WNEA 1DT9A 4FM1A 4RG8A 4EP4A 2D0CA 3NAEA 3O9RA 4K8ZA 4BR4A 4PL8A 1TKXA 2E2NA 1S9GA 1GLCG 5CE3A 1TV6A 1U2VA 1ZC6A 4B3MK 3VEXA 1VSFA 4B1YB 3PLAA 5C12A 5BRDA 4DLGA 1BUPA 3DLHA 3QDKA 1U49A 3K57A 4YOVA 4B9QA 1DEJA 1QHTA 3VA0A 2VG6A 2E1ZA 4JD2A 2DFEA 2NZTA 1TKTA 3AO4A 2FSNA 3IUCA 1HNIA 4M45A 1D4XA 4UY8O 4NO7A 5T7BA 1U6ZA 4WF9L 4LFCK 4EFHA 2YCHA 3F2KA 2HSTA 2W41A 4B1VA 4HCBA 4B08A 2ZJPL 1N36K 3VN5A 1T05A 1IV0A 3VEWA 1EO1A 1YT3A 1T44A 2YNIA 3TSPA 1Q81O 3VOVA 1X9SA 1C1BA 4H03B 4DR5K 4RTFD 4FLVA 1NU0A 3QBXA 3LDQA 1YTUA 3H1QA 5CR4A 3VETA 4DQQA 4CJ5A 3NGIA 4B3SK 2UXCK 3HOTA 4N47A 4WQ4C 1JL1A 3E66A 4LSNA 3SAFA 1WOQA 1JCFA 3BZKA 3MN6A 1VSLA 4DR3K 4LC9B 2HBJA 1QVGM 5I9EB 4M3TA 2YJEA 4KHSA 3LDNA 3ATUA 4CJSA 3I56N 1SAZA 1YHQN 4BR7A 2KW4A 2P9IB 4U67L 4DSFA 4NCBA 3G10A 3LALA 3P4IA 3E9OA 3AVMA 1JLEA 3SQ0A 1SZ2A 5LL6Z 2I7PA 1RNHA 3O9QA 1NK0A 4XH5A 3ASMA 5DM7L 5F0XA 1V4SA 2IOCA 2V52B 4ILJA 4N76A 1XNRK 1P8ZA 2FLOA 3PY8A 4F2SA 5AQIA 1RT7A 2QXLA 2HF3A 2OANA 4DTMA 3O3HA 2Z1HA 3RSEA 3CFPA 1UOCA 4FZYA 2P9UB 4KPYA 5M1FA 4Z4HA 5AQKA 3LP2A 1BOTO 3EZ5A 3AAPA 4IG3A 3OYCA 1VQLN 1NGAA 3O8MA 3CCVN 3V9UA 4BRMA 1DTQA 3T19A 2Q31A 2E2PA 2G8UA 5JS2A 1VAZA 1YITN 3A5NC 3HTVA 4NB4A 3VEYA 4EZ6A 4FJIA 3VF6A 4ISFA 3M1FA 4IOCL 4A59A 3W3DA 3O08A 2YI1A 3C65A 3SMSA 4CD3A 2YKNA 1P90A 4A5AA 4DV5K 4HCCA 1TL1A 4CZKA 3OYKA 4FOIA 3K2PA 1UAXA 5BR8K 3HO1A 2EWSA 1QVFM 1SUQA 2Q3SA 1VQKN 5BRFA 4B9TA 2GX9A 1WBDA 2OZSA 1NG9A 2CGLA 4B1XB 3DLKA 3HYFA 1EWRA 1QSSA 2FBTA 1K8KA 3OJUA 4IFYA 3E9LA 5DMRA 4Z94A 4B9SA 4DSLA 1KAZA 4DB3A 2E88A 2FBYA 3KD5E 1LV5A 3TAMA 3SK3A 3CCEN 2ITMA 2ZJRL 3WEEA 1ASUA 2YNGA 4BVOA 4CZHA 3QEPA 4O8UA 5JMVA 2IIRA 2Q2RA 1NK5A 4C8LA 4MLEA 3ID6A 4DQSA 2NRXA 3D0PA 3EKSA 3LWLA 4AHVA 1HQUA 4JI0K 4MO5A 2GUIA 1NK8A 3LP1A 5KPZA 4JKGB 2ZGYA 4QCLA 4K42A 1FJGK 1ZBIA 2O8CB 3CERA 1K9MO 1X3NA 4Z4EA 1OVYA 5LMUK 2YV0X 4B1WB 3SBTA 5AQSA 2ASMA 3VPZA 4FLWA 4GY2B 1TUUA 4K43A 1IG9A 1Z25A 2WTUA 4BRDA 2O8FA 2QM1A 5KRTA 3SQ2A 5EVZA 3LL3A 2HW3A 4DTPA 4EIAA 3CPEA 4KB1A 4DG1A 3DOLA 3UE5A 5AQZA 2KQ2A 4CZJA 3G4SN 4OJRA 1Z6RA 3F9MA 4O4GA 1NLVA 2OZMA 3FLCO 4DV4K 4DV7K 4JKFA 1BIZA 1HRHA 1NJIO 1XC9A 3JYTA 2GWKA 4DV3K 3M8PA 4Z4CA 1ATSA 3G0ZA 4AQYK 3ZT0A 3PX6A 4CEEA 3QIOA 1NJWA 4CGFA 1DKGD 4FPAA 3CETA 4ELVA 3SV3A 1RCHA 3SUOA 3QBWA 2D0AA 4GV6A 3DXKB 3IMXA 2F4VK 3WXKA 3N4PA 1ZBLA 1SV5A 1X9WA 4CCHA 2E2QA 5FPMA 4CFBA 5I42A 4B8AB 5E26A 4EAHD 2FBXA 4N56A 1Q18A 2QWNA 4AHSA 1KQSM 3MEEA 2Q0RA 1TUYA 1TAQA 2OPPA 1IBMK 1A5XA 3CM5A 4JI4K 4M3XA 4HUGA 1GOAA 2YNFA 3L4IA 2KFNA 1X3MA 4DS4A 3CG7A 4JHDB 4CJEA 3TARA 4E7LA 4KH5A 1TK5A 2QKKA 3K5OA 2O8DB 4FLUA 4H5NA 1FK9A 1RT1A 3IDHA 5D3GA 4GVMA 4FWKA 4X62K 4BRIA 1RDAA 4C23A 3AGRA 1K8AO 2P5GA 1T6CA 3AARA 1YF5L 5LMNK 1Q86O 5GADP 3NH1A 2PZSA 2P5OA 1W2BM 5AQQA 3HSCA 5BPLA 3CCSN 4JS5A 1NKCA 3D2EA 4C1NK 4BREA 5FPNA 2ZE2A 5H1SQ 2QWRA 5EXWA 4X65K 2F96A 4PHTX 4CEAA 4B9VA 4FWLA 4OKEA 3OHRA 3P31A 3I8BA 4W5TA 4HTLA 2XO7A 3A5OC 3ZSRA 1KVBA 1HUXA 3TU5A 3K9KA 3RMAA 4RW8A 1YVNA 5HP1A 1RBUA 4L3QA 3QNOA 3ZSVA 2E4LA 1JLQA 3AVJA 1RT6A 3L3UA 2QK9A 1RBRA 2E5LK 4FJMA 4NLBA 3F9KA 3U8XA 5JS1A 4FJLA 4M3UA 4FXDA 4KH4A 3VQ7A 3O5BA 3OBYA 3CJ9A 4JS4A 2E1YA 3R1XA 2HBKA 2RE2A 4CF0A 1VQ9N 1HJOA 4X66K 3CQXA 4HTUA 1D8YA 4B9NA 3HM8A 3JS6A 4JRPA 2P9IA 4JLHA 3O9SA 2G8IA 1S1XA 1WSIA 5HBMA 4DU4A 3TSUA 2KFZA 4PKIA 3BY5A 3NHGA 4R79A 1RFQA 4M3WA 4DFMA 2ZD1A 4H0PA 2NLXA 4O44A 5FPEA 1KFSA 3SBGA 1KCFA 3CJAA 3AY9A 1QQNA 3J80O 3KLHA 2QEXN 4E7HA 1BG3A 4DTNA 3M8QA 2IC3A 1RDDA 4H5RA 3CF5L 3ZSOA 4IO8A 3AO1A 4LD0A 4GW6A 2P9UA 5JVHL 2RPIA 5KRSA 4FJNA 3ZETB 3ZSWA 3AA3A 2WUSA 4HVJA 3BEXA 1SKSA 2WC9A 3JAMO 1ESVA 4OGCA 3AV9A 3ULEB 1NGBA 4R5PA 1RTJA 3SJHA 4WFAL 1BA0A 1C6VA 1TVRA 3NH0A 2PYJA 1YJNN 4CJTA 1C0FA 3MN7A 2F8TA 5SZTA 1K73O 2HVIA 1U45A 4Z4GA 1VRTA 3VGKA 2OPRA 3BZCA 4IBNA 3HM9A 2ZJQL 3WNHA 3DWLA 4X64K 3DXMB 2XRIA 4BC4A 3HVRA 4CF8A 3QEXA 2GUPA 2NRRA 4BDPA 5ADXH 4OVLA 4JK8A 2F7TA 2KLAA 4JKHA 4E1JA 1BU6O 2W6KA 4LF9K 4W5OA 4O5FA 1TK8A 4BGBA 3RMDA 1JXEA 1HQEA 1QS4A 4CGJA 1XI1A 1L3TA 4XH4A 1EQYA 4DQ8A 2UXDK 4DR1K 3CM6A 1VSKA 3OYIA 2OTLN 4DTSA 1IKWA 5M1QA 2IVPA 3UB5A 5A2QO 1HYZA 4CESA 2F8SA 3O9UA 1DTTA 1VQMN 3RRGA 1SKRA 2IVNA 4MFBA 1VSMA 3HK2A 3DI6A 5CY4A 3HZ6A 4JNEA 4KRFA 3C95A 3DLBA 1CZ9A 2P9NA 1BI4A 4BRPA 3THYB 4JEPA 5EX5A 4FJ7A 2A3ZA 1VSJA 4BC3A 2O8CA 3DJCA 3ZLJA 3O3FA 1N6QA 1YUWA 4CHQA 1HNXK 3J81O 4NXNK 1BA1A 4JK9A 1LAVA 3EN9A 1WSJA 3HI0A 1HPZA 1GLAG 5CZ2A 4KI6A 1BDGA 3ISNC 5KQ8A 3T1YK 4F3TA 3AVHA 5JVGL 2BGGA 3GE1A 2ZM6K 3K5NA 1IH7A 4O0JA 3O1WA 3O4QA 3VQEA 3MMVA 4E7JA 3ALYA 4JKDA 1Y97A 2IGIA 5C15A 4XH1A 4A5BA 3A5MC 3FE1A 4B9LA 4Z4FA 5C42A 1BL3A 1YJWN 3C6AA 2WBNA 4JI7K 1X9MA 2KKZA 2Y1IA 1ILYA 3T3FA 2P9LB 2O4GA 4BR2A 2EX3A 4KHWA 2RKIA 3V1QA 3UIQA 1S3XA 2F9WA 3DLLL 1EETA 5F1XA 2FSKA 3CD6N 5AQGA 3MN9A 1BISA 4I2PA 5C2FA 1VQON 1CZBA 3TTCA 3U3GA 3ZCMA 4GKJK 3V4IA 3A8YA 3S3OA 1JL2A 3R6MA 4KO0A 3DAWA 3ZX3A 3PO5A 1BGXT 3C6HA 1RBSA 4ICLA 2A1RA 3FZLA 1QE1A 2Q36A 3HOSA 4CEFA 4DS5A 5FRMA 2Z1JA 4BRKA 1JLFA 5EU7A 3WT0A 4AHTA 1YI2N 3OYNA 3IFRA 5AQFA 2QA4N 5AQYA 3ITHA 3LM9A 2RF2A 4XIUA 1KLNA 4JHDA 1HYSA 4CF9A 3CFOA 3CC4N 1ATNA 4QOZB 2PYLA 3T1AA 1NGFA 2O8DA 1NOZA 3GL1A 3KJVA 2HMPA 4IEIA 3ZEUA 4I2QA 1C1CA 4FLXA 2X6NA 1NK9A 2Y1JA 3PV8A 4LH5A 2Q0UA 3QERA 4DQPA 4FLTA 5GAHP 4E1MA 3DRPA 4DUZK 1HPMA 4FM0A 3SJJA 4EHTA 5M1OA 5GINA 5ADXA 1JKHA 3DMJA 4CHOA 4GV3A 4CHNA 4J2DA 4CJPA 3SUNA 2ZWHA 5BPMA 2YHWA 4H8KA 1L5UA 3ZSYA 3CCJN 4FL9A 4ILGB 3VTHA 5J2MA 3K9JA 3FZFA 2G8KA 2QWPA 2BE2A 3E9PA 5K14A 5FROA 3KK3A 3LP3A 4PKGA 2HHWA 4AILC 4ISGA 4J2AA 5AFUH 1NBWA 4YORA 1U4BA 4WE1A 3GDQA 3IS9A 1Q8IA 2WOMA 4JV5K 3IKMA 2VCPA 4FJ5A 3OY9A 2Q1NA 5TKYA 2QW9A 2HNYA 3SV4A 3L0QA 4PWDA 2HHSA 3HPGA 3WQUA 3OYEA 4FJ8A 3R9PA 2HBMA 3EEQA 2A5XA 3VA3A 1KVAA 4DR6K 4N41A 1RDUA 4AHUA 3VGLA 1A5WA 3C6TA 4Y0WA 4DU3A 2FXUA 5KGXA 4BRGA 2AJQA 3QICA 3NBPA 2OPSA 4CHZA 4KAZA 2E20A 1IJJA 3VEZA 3PX0A 4YDUC 5AQPA 3P38A 4E1NA 3VQ8A 3RR7A 2OTJN 3RR8A 3FZKA 4DFPA 1NKEA 3NF7A 3UKRB 4N5SA 1YIJN 1QTMA 1T8EA 2GBZA 4CD1A 4MLHA 5AZIA 4KFBA 5AZJB 3FZHA 1S72N 4ID1A 4DV2K 2XY8A 3HJFA 4CJWA 1JLAA 3SAHA 4DUYK 4CFDA 2ZGZA 2D0OA 3TPQA 3ID8A 1CLQA 4CZMA 4CHYA 1N34K 3M8RA 4RW6A 3O6WA 4DTXA 2O8BB 4J2EA 1JLGA 1M1KO 1NOYA 1KAYA 1S1VA 5AQVA 2FF6A 3O9TA 4WQ4A 2QTDA 4M7YA 4BG9A 4CZGA 2GTDA 2QWQA 4CJQA 2CH6A 3IG1A 2V7YA 3V9WA 3FGUA 1SL1A 2HHUA 1TYQB 4DKWA 3BF1A 1X9JA 1TKDA 1E4GT 1JXBA 4AH9A 4YOXA 1HJRA 3KLFA 1VQPN 4Y1DA 5GIOA 3EY1A 1J5OA 5B8HA 1HYVA 2QWOA 3KK7A 2G8FA 4IWVA 5EOYA 4PY5A 4IO9L 2E2OA 3VQAA 4FJGA 1UWBA 1VSDA 3S9HA 4DSJA 2KTQA 3HRGA 4CHPA 3H3NO 1WAJA 2IDOA 4FK4A 3P39A 2PBDA 1J5EK 4LFBK 3H46O 1GLDG 4DTOA 4DTJA 4WQ5C 4CBWA 1RDWX 3NGYA 5AQNA 4DLEA 3PO4A 1TGOA 1D9DA 3THYA 4FLZA 1YJ9N 1HKCA 3H08A 1NJZA 1LWCA 4YHHK 1FKPA 3HT3A 3GOIA 1N33K 2I7NA 1VQ8N 1MWMA 1WUAA 3EKUA 5SWMA 3EZWA 3OTOK 3TSQA 3H1VX 4JN4A 1U2VB 1IKXA 5HLFA 3THXB 4LF4K 4CJ3A 5C0YA 4RCHA 3C0BA 3G71N 2P9SB 3F5TA 4I9LA 4EHUA 4KTWA 2YHXA 3U9DA 1TL3A 2HBLA 3VQ9A 2PAVA 3L2WA 4BRNA 3I0SA 5AFUA 3OA9A 2UUCK 3MCPA 4YFUA 4JD2B 4I9QA 2ITGA 3AVKA 4CVNE 4JKEA 4QAGA 1WNSA 1F21A 4F9OA 3OS2A 1KSPA 3V1RA 4CEZA 1N32K 2JGUA 3DLEA 3M5RA 1KAXA 3OS0A 1J6ZA 2HNDA 1VRUA 3K5MA 4CFCA 5BN9A 2V51B 4IJNA 4CK1A 4J2BA 5AQTA 3DLGA 5C25A 2F9TA 2D1KA 3VEVA 2VQFK 3TI0A 3M6GA 4BG8A 3OYLA 1X1PA 1RTHA 3OYHA 4BE1A 3MDQA 4CEBA 1KTQA 1WBBA 4CJLA 1JLBA 3B6OA 4FWMA 4L8RB 4CJVA 3VQBA 3CI5A 1RTIA 2ZQBA 4MDAA 4BE2A 3V9XA 4AHRA 5AQRA 2A41A 1BIUA 5BN8A 3T7ZA 3GBTA 3HL8A 3NGZA 2IVOA 4KH6A 3KKRA 5JLHA 3OYBA 2D0PA 1NGIA 4V19S 3TAFA 3KWIA 4A62A 1IKVA 2X78A 2NUBA 3LM2A 2VWJA 1MA9B 5ELZA 3JSMA 4OO1J 3TTDA 3PSFA 4JKBA 1LW0A 4ILHA 4O55A 3PUFA 1QSYA 1BQNA 3Q7BA 3N4QA 2IS3A 4YY3K 5AQHA 2KZMA 3MK6A 3KLEA 4IOXA 4CEOA 2VGNA 4RW7A 3SZ2A 4KHPK 3U6FA 3T1HK 1N8RO 1DGKN 1VQ6N 3E01A 4WFBL 1L3VA 2GEMA 3L8BA 1GLLO 2YHYA 3CJBA 3DRRA 3OYDA 4CF1A 3VQQA 3MXJA 5M1PA 1VHXA 2HF4A 1WSFA 3SQ4A 3P5JA 3KK1A 4BC5A 3NDKA 3QEWA 2UYTA 4E89A 3QIPA 4NYNA 4BWJA 3C6UA 3CXCM 3O4NA 1S9EA 4DFKA 4WFNL 3VESA 3ZT3A 3CQYA 1HX1A 3I8DA 3SQ1A 3J7AP 4DR7K 4Q0BA 4MO4A 4DSEA 4OLAA 1G99A 1SS6A 2BTFA 3TAEA 2HNZA 4TSXA 4NXMK 2GWJA 4JYAK 3ENHA 2JLEA 5FPDA 3DOKA 2FSJA 5AQXA 3KWGA 3WXLA 3ZT4A 4CBUA 1XMOK 3VQ6A 3VF2A 3LPUA 3P1GA 3BUZB 4CJFA 1OVQA 3VQCA 4CERA 2P9KB 3TANA 4IFVA 5F2RA 1ASWA 4IKFA 2E6MA 2B5JA 3L4QA 4BDYA 3MECA 3BF3A 1K8KB 3MX5A 4YOTA 1K6YA 3QLHA 2UUAK 1J9AA 4GVEA 1WAFA 2W42A 2UXBK 2B4JA 4FWPA 2HHTA 3QB0A 3OYAA 1BO5O 3H6EA 5C2DA 1B9DA 1D9FA 4BR0A 4ISEA 1NJYA 1REVA 5AR0A 3WEEB 5HRNA 3UKRA 4IOAL 3MCAB 3KIOA 4HUFA 4O0IA 3IAYA 1WB9A 3AVIA 1YAGA 1KRPA 3KZBA 5AZJA 1LW2A 4GMJB 3L6QA 4H0OA 5HROA 4IJAA 4Y1CA 4A57A 5M1KA 4IFEA 3QO9A 3VQPA 2I5JA 2VG5A 4ZTFA 4DQIA 2O8BA 1XMQK 3ULDA 3AVGA 4JK7A 5AQMA 1CXUA 1IO2A 1R0AA 4OLBA 3CC2N 3AVNA 4FCYA 2LSNA 5KI6A 4A61A 4RW4A 4FK0A 5FLXO 4JKGA 5GAGP 1YXQA 2BUPA 5J2NA 1FW6A 3H3OB 3VENA 2HHVA 4ZHRA 1U04A 1OKJA 1RTDA 4BACA 3W0LA 4CBXA 4Q5VA 1BHLA 1IG8A 3TAPA 1RT3A 3V1OA 3VQ5A 3D45A 4FWOA 4IDHA 2RHKA 4OPAA 4HWIA 2YHAA 1XUPO 2D5RA 3J7YP 4DF8A 3C94A 4FVMA 3CMAN 5CHIA 5KQDA 4CECA 3TAQA 4RW9A 4FJHA 5AJ3K 5HRSA 3RTVA 4E7KA 3A2FA 4OPJA 4BY9C 3M8SA 3ZT1A 4DCHA 2YJFA 4AM6A 2VGMA 4M41A 1B9FA 5CYMA 1S6QA 3AO5A 3J7ZO 4FZXC 3R3LA 3VERA 4F8RA 1RDBA 3KHYA 2NRVA 3HVTA 4QS9A 2QXFA 1O13A 4M7XA 3HXMA 3C7NB 4JAXA 3U4LA 3HPOA 3AO3A 1OH5A 3OYJA 2FF3B 4FK2A 2RN2A 1T7PA 3G25A 5GIPA 3THXA 3DXKA 1HLUA 1RBVA 5AQUA 4BVPA 3KTQA 2P9SA 2UUBK 3K0SA 2FC0A 1LWEA 4IEEA 4BRQA 3CJ7A 2QWLA 3EE9A 3I0RA 1T3VA 1NK6A 5JLFA 3FFKB 4YNQA 3I55N 4DSKA 3WXMB 2QKBA 4FOEA 1ITGA 4KHYA 2YX6A 1NNEA 1LCUA 4HHTA 3QEIA 3HBTA 3MAQA 4PL7A 4PA1A 5I3UA 4QS8A 4J8FA 3D2EB 5HRRA 3EO3A 4CK2A 1QSLA 3WXIA 3V6DA 4JI3K 4DSIA 2Z1GA 2A42A 4B9UA 2DPNA 4JI8K 2WFBA 4MDBA 4CEQA 2HMIA 4CIFA 1U47A 4ELUA 2HB5A 4H0YB 1VQ7N 4G9ZA 4H0TB 3U3YA 3LAKA 1JCEA 2WONA 3PSIA 3ZSXA 4FWNA 5KPRA 1S1UA 4BRLA 1Z26A 5BPNA 4YOWA 2OA8A 3M3ZA 5FDLA 5J2PA 4CZIA 3O3GA 2X6SA 4C8OA 3FZMA 1HR0K 1NGHA 3TAGA 3ENOA 3A0IX 4CIEA 1NGDA 1EXQA 2P9PB 1NGCA 2O8EB 3EYZA 3HSTB 2NRWA 4BWMA 5LY3A 4CZFA 3TABA 4FM2A 3WNGA 4YOYA 2JWLA 4CGGA 4BDZA 1RDCA 3SPYA 4C1NI 3ZT2A 3LDSA 3QMLA 1I3AA 4LSLA 1Q82O 3LDLA 4H5TA 2KZZA 3CIPA 4DV0K 3ZSQA 1JJ2M 4GNIA 1IBLK 3D2FB 1XNQK 2O4IA 4FVUA 4CJUA 1S22A 2CGKA 1ZBUA 5C10A 2XY5A 3QESA 3O4WA 4H0VB 3MN5A 4FWQA 2AP1A 4DR2K 4BRAA 4CJKA 4ZTJA 4LY7A 1TK0A 3L2UA 3PIOL 3RMCA 4JI1K 3NVMA 1JLCA 3HPHA 2HOEA 4BRCA 2IAJA 1C1AA 1L3UA 3THWB 4M3RA 4OPKA 1HNZK 1CXQA 4FZZA 3I33A 4F2RA 4OX9K 4LF6K 1VK0A 1UA1A 2QI2A 2ETJA 2W40A 1TAUA 3ZETA 4JRQA 4A2AA 5AQLA 1M90O 3CJ1A 2AA4A 2A1SA 3CCMN 4B3OA 1H1VA 3RMBA 2DY4A 2XY7A 4ELTA 3J8AA 2HHQA 1EKEA 1YTAA 4I6MB 1XHZA 3QFPA 3ULEA 2E8AA 3OW2M 1U48A 1VSIA 4KREA 2G8HA 4CK3A 4BGAA 4O8KA 3LZJA 2YKMA 1C0TA 2DFHA 2P9KA 4WCEL 4BE0A 1KVCA 3ZX0A 1C0GA 3HP9A 1G15A 2DFFA 3D7EO 4OKKA 3SAGA 4UQGA 2ATQA 2ZF5O 3CPWM 3CCRN 4CIGA 1W0HA 4FWSA 4BROA 1LOTB 3B8AX 4H5VA 3TTFA 3NMUA 1NGGA 3DXMA 4C8MA 4WYBA 2PFUA 3AVCA 3VTIA 3SUPA 4H5WA 1T03A 1QZ5A 2UU9K 3H45C 4FYDA 4BQZA 4FW2A 1SL2A 4GKKK 3WUHA 4W5NA 4B3TK 1ZXOA 3QEVA 4DTUA 4KTQA 3K5LA 3RVCA 5HL7L 1NGJA 2A40A 1VQ4N 1GLBG 1ZBSA 4G1QA 4ID5A 4M63C 3A5LC 2P9NB 5GAEP 1CZAN 1BI4B 4FJKA 5BRHA 4DR4K 4B9MA 4DV6K 2D4WA 3O80A 3CCUN 3K58A 3NE6A 5AQOA 4AF1A 4E3SA 2BDPA 3S3NA 1WSHA 3OS1A 4KTZA 1D5AA 2BH1A 3DYAA 2VWBA 3UKUB 2E6LA 1S1TA 4FSVA 3MEGA
chains in the Genus database with same CATH topology
1HPZA 3DRRA 5CZ2A 3OYDA 4CF1A 3VQQA 4DTMA 4KI6A 3VQDA 3ISNC 2G8WA 3O3HA 3MXJA 1MU2A 3AVHA 4F3TA 2Z1HA 4HUEA 2BGGA 4FZYA 3CFPA 1UOCA 3K5NA 1IH7A 1WSFA 2YNHA 3SQ4A 3P5JA 3NFAA 4O0JA 3VQEA 3O4QA 3KK1A 4E7JA 1W9HA 3ALYA 4KPYA 4Z4HA 4OKJA 3NDKA 1BQMA 4W5QA 1Y97A 3LP2A 3P83D 3QEWA 2IGIA 4E89A 3QIPA 4NYNA 3EZ5A 4BWJA 3C6UA 4IG3A 3O4NA 1S9EA 3OYCA 4DFKA 4B9LA 4Z4FA 5C42A 1BL3A 2GV9A 3V9UA 3ZT3A 1DTQA 3T19A 2FBVA 4W5RA 3I8DA 3SQ1A 2G8UA 5JS2A 1X9MA 4NCAA 4MQ3A 2Y1IA 4EZ6A 4Q0BA 4DSEA 4OLAA 2BANA 3T3FA 2O4GA 3V9ZA 1S1WA 2EX3A 3TAEA 2HNZA 2RKIA 4TSXA 4FJIA 4KHWA 3V1QA 3UIQA 3PX4A 3IRXA 2JLEA 1EETA 3DOKA 4E7IA 3B6PA 4B8CA 3ZT4A 1BISA 4I2PA 4KKOA 1FXXA 3VQ6A 4CJRA 3L3VA 1CZBA 3LPUA 2YKNA 3OJSA 3P1GA 3U3GA 3ZCMA 3V4IA 4CJFA 4O5BA 3S3OA 1JL2A 3VQCA 4CERA 1TL1A 4HCCA 3OYKA 3TANA 4KO0A 3K2PA 4IFVA 1UAXA 1ASWA 3LWMA 4IKFA 4AHCA 2E6MA 2B5JA 4CE9A 4BDYA 1BGXT 3MECA 3PO5A 3HO1A 1LWFA 2B6AA 1SUQA 1K6YA 3QLHA 2Q3SA 3BDPA 4M3ZA 4DF4A 3SUQA 1J9AA 1RBSA 4ICLA 2A1RA 4B9TA 4PQUA 1QE1A 1GOCA 2OZSA 3AA4A 1WAFA 4CEFA 1L3SA 2W42A 3DLKA 3HYFA 2B4JA 4IG0A 4DS5A 5FRMA 1QSSA 2HHTA 2Z1JA 4EP5A 3OYAA 1ZBHA 2FBTA 1JLFA 4CJ4A 3OJUA 5EU7A 1B9DA 4IFYA 1D9FA 5J2QA 5DMRA 1NJYA 4B9SA 4AHTA 1REVA 1XWLA 3OYMA 3AVLA 4DSLA 3BGRA 5HRNA 1NKBA 2FBYA 3KD5E 3SI6A 3OYNA 3NF9A 1SL0A 3AA5X 1LV5A 1KLMA 3TAMA 3AVFA 3ITHA 3KIOA 4HUFA 1RT5A 2RF2A 4O0IA 3AVIA 4XIUA 2XY6A 1KLNA 5J1EA 1KRPA 1B92A 4C8NA 3AVAA 1HYSA 4CF9A 3CFOA 1TKZA 3LAMA 1UA0A 3L2QA 4OGEA 4QOZB 1ASUA 2PYLA 2YNGA 5CZ1A 3T1AA 1LW2A 5E41A 1NOZA 4GMJB 3QEPA 3KJVA 3AO2A 3V81A 5HROA 1QQCA 4Y1CA 1NK5A 4I2QA 1NK4A 3QO9A 3VQPA 1C1CA 2I5JA 4C8LA 1BCMA 2X6NA 4FLXA 1NK9A 4KHNA 2VG5A 2Y1JA 3PV8A 4DQSA 4ZTFA 3D0PA 4DQIA 4LH5A 3LWLA 1RILA 3QERA 3ULDA 2P1JA 4NYFA 4CEDA 4DQPA 4AHVA 4CFAA 3AVGA 1HQUA 1HMVA 2GUIA 4FLTA 4E1MA 1NK8A 3DRPA 3F73A 3LP1A 4FM0A 1CXUA 2XHBA 4QCLA 1IO2A 1R0AA 3SJJA 4OLBA 1ZBIA 3AVNA 4FCYA 4Z4EA 2HVHA 1FKOA 2OPQA 2LSNA 2X74A 5KI6A 2YV0X 1JKHA 3DMJA 4CHOA 4RW4A 4FK0A 4FJXA 4CHNA 4J2DA 4CJPA 3SUNA 1S5JA 4FLWA 4H8KA 5J2NA 1L5UA 3ZSYA 2HHVA 3NF8A 4ZHRA 1U04A 1IG9A 1Z25A 1RTDA 4BACA 4Q5VA 1RT4A 5KRTA 1BHLA 3KLIA 3NH2A 1O1WA 3MEDA 3SQ2A 3TAPA 1Q9YA 5J2MA 1RT3A 2HW3A 4DTPA 3V1OA 3VQ5A 3D45A 2G8KA 4KB1A 4DG1A 3DOLA 3THVA 5FROA 2BE2A 3KK3A 5K14A 3LP3A 2HHWA 4DU1A 4AILC 2YHAA 2KQ2A 2D5RA 4FJJA 4J2AA 4H4MA 4DF8A 3C94A 3WNFA 5KGWA 4FVMA 4OJRA 1U4BA 3FFIA 4WE1A 3LANA 3RRHA 1WSGA 4K8XA 2VG7A 3IS9A 4CECA 4O4GA 1LAWA 3TAQA 1Q8IA 2WOMA 4C8KA 4RW9A 4FJ5A 4DTRA 3OY9A 5HRSA 2OZMA 1S6PA 4FJHA 3RTVA 4E7KA 1BIZA 1HRHA 1ZYQA 1XC9A 3A2FA 2HNYA 3SV4A 3DRSA 4OPJA 3M8SA 3JYTA 3QNNA 3ZT1A 3M8PA 5CYQA 4CGIA 4PWDA 2HHSA 4Z4CA 3ZSZA 2DTUA 3HPGA 4M41A 1ZBFA 3G0ZA 3OYEA 1B9FA 3QETA 5CYMA 3ZT0A 3PX6A 1S6QA 3AO5A 4CEEA 3QIOA 4DQRA 4FZXC 4FJ8A 1NJWA 4Z0UA 4CGFA 3LP0A 5C24A 4F8RA 1RDBA 3HVTA 3VA3A 1KVAA 3IAYA 2QXFA 3SNNA 4N41A 3LPTA 4AHUA 1A5WA 1RBTA 3C6TA 3HXMA 4DU3A 4ELVA 1J54A 3SV3A 1RCHA 3SPZA 3SUOA 2D0AA 5KGXA 1XHXA 3AO3A 3CYMA 3NBPA 3HPOA 4F4KA 2OPSA 4CHZA 4KAZA 2AJQA 3OYJA 4FK2A 4KB0A 1ZBLA 2RN2A 1J53A 3S3MA 1SV5A 3PX0A 1T7PA 3DLRA 1HNVA 4NCGA 1X9WA 1NK7A 4CCHA 1EX4A 3KK2A 4CFBA 4PUOA 5I42A 4B8AB 4E1NA 4N56A 2FBXA 3VQ8A 3RR7A 4AHSA 5DK5A 4CF2A 1RBVA 1A5VA 2VWKA 3MEEA 3RR8A 3KTQA 3SCXA 4DFPA 1TAQA 2OPPA 1NKEA 4DFJA 2FC0A 3NF7A 3DM2A 1LWEA 4N5SA 1A5XA 1I39A 1VSEA 3CM5A 1QTMA 1T8EA 4EZ9A 2GBZA 3RWUA 4HUGA 4M3XA 1GOAA 2YNFA 2KFNA 3I0RA 2YHBA 1NK6A 4DS4A 5FRNA 3CG7A 4YNQA 4CJEA 3TARA 4E7LA 4DSKA 4DWIA 2Z1IA 2QKBA 4KFBA 4ID1A 1TK5A 2QKKA 3K5OA 1ITGA 4KHYA 2XY8A 3HJFA 4FLUA 4CJWA 1JLAA 1FK9A 1RT1A 5KTQA 4CFDA 3KKSA 3LZIA 4HHTA 1WLJA 3QEIA 1SKWA 4F3OA 5D3GA 4GVMA 3MAQA 3VQ4A 1CLQA 4CHYA 1RDAA 4PA1A 2P51A 5I3UA 2P5GA 3M8RA 4RW6A 1C0UA 4DTXA 1N5YA 3L2VA 4M3YA 5HRPA 5HRRA 4J2EA 1IKYA 1JLGA 4CK2A 1QSLA 1NOYA 3V6DA 3NH1A 4DSIA 2Z1GA 2PZSA 4H4OA 2P5OA 1S1VA 4B9UA 4KHQA 3L2RA 4JS5A 4CEQA 1NKCA 4KV8A 2HMIA 4IDKA 4CJQA 2EHGA 4CIFA 3IG1A 2ZE2A 1U47A 4ELUA 1YVUA 2HB5A 3U3YA 3KLGA 2F96A 3V9WA 4M42A 1SL1A 3TWHA 4CEAA 2HHUA 4B9VA 3LAKA 2G8VA 2WONA 4CGHA 1KFDA 4OKEA 1TKDA 3ZSXA 1JXBA 1Q9XA 4AH9A 3NF6A 4W5TA 1WSEA 3MXMA 4E0DA 4FJ9A 3AA2A 1S1UA 4E19A 1EP4A 2XO7A 2HHXA 1Z26A 3HP6A 4KHUA 3ZSRA 3L8BA 1HJRA 3KLFA 1KVBA 4I7FA 4Y1DA 2OA8A 3RMAA 4FW1A 4RW8A 3SYZA 5HP1A 1RBUA 5FDLA 3EY1A 5J2PA 2PY5A 3QNOA 3O3GA 3ZSVA 2E4LA 1JLQA 3AVJA 1RT6A 3L3UA 2X6SA 3QINA 1HYVA 1RBRA 1J5OA 2G8FA 4C8OA 4FJMA 2R7YA 2QK9A 4PY5A 3F9KA 3K59A 5JS1A 4FJLA 3TAGA 4M3UA 3VQAA 4CIEA 4FJGA 1UWBA 4FXDA 1VSDA 3MXIA 1EXQA 4DMNA 3S9HA 3VQ7A 4DSJA 2KTQA 3AVBA 4FLYA 3EYZA 1ASVA 1DLOA 4CHPA 4JS4A 3HSTB 1WAJA 4CF0A 2IDOA 4BWMA 3NCIA 4KI4A 4FK4A 3KD1E 3CFRA 3TABA 1VSHA 4LH4A 4HTUA 4FM2A 1BCOA 3WNGA 1D8YA 4CGGA 4BDZA 2D0BA 1RDCA 3CQ8A 4DTOA 3SPYA 4B9NA 3ZT2A 4JRPA 4DTJA 3V9SA 1RT2A 3LDSA 4Z4IA 4JLHA 2G8IA 1I3AA 1S1XA 1WSIA 3NGYA 5HBMA 4CGDA 4DU4A 4DLEA 4LSLA 3PO4A 2KFZA 3OVNA 2KZZA 1GOBA 1TGOA 1D9DA 3NHGA 2OYQA 4FLZA 3ZSQA 3H08A 1WN7A 3OYGA 1NJZA 4M3WA 2O4IA 4DFMA 1C0MA 2ZD1A 1LWCA 1NJXA 4O44A 4CJUA 1FKPA 3HT3A 1KFSA 1ZBUA 2XY5A 3OYFA 3QESA 1KCFA 3KLHA 3TR8A 3WNEA 4FM1A 4E7HA 4RG8A 4EP4A 5SWMA 4DTNA 3M8QA 2D0CA 2IC3A 1RDDA 1IKXA 4CJKA 5HLFA 4ZTJA 4LY7A 1TK0A 3NAEA 3ZSOA 4CJ3A 4K8ZA 3L2UA 3AO1A 4LD0A 3RMCA 4GW6A 1TKXA 1JLCA 2RPIA 5KRSA 3HPHA 1S9GA 4FJNA 2IAJA 4I9LA 3ZSWA 1C1AA 4KTWA 1TV6A 1TL3A 3AA3A 1L3UA 3VQ9A 4HVJA 4M3RA 4OPKA 1VSFA 3L2WA 3I0SA 1CXQA 1SKSA 4FZZA 4F2RA 1VK0A 1UA1A 4DLGA 2ETJA 1TAUA 4YFUA 3DLHA 4JRQA 4OGCA 4I9QA 2ITGA 3AV9A 1U49A 2A1SA 3AVKA 4B3OA 4R5PA 1RTJA 3K57A 4QAGA 1WNSA 1F21A 3RMBA 2DY4A 2XY7A 1C6VA 1TVRA 3OS2A 4ELTA 1QHTA 1KSPA 3V1RA 2HHQA 4CEZA 1EKEA 1YTAA 2JGUA 3NH0A 3DLEA 2VG6A 3VA0A 3OS0A 2DFEA 4CJTA 1XHZA 2PYJA 2HNDA 1TKTA 1VRUA 3AO4A 4CFCA 3K5MA 2F8TA 1HNIA 1U48A 1VSIA 4CK1A 4J2BA 5SZTA 4M45A 4KREA 2HVIA 2G8HA 4CK3A 3DLGA 5C25A 5T7BA 1U45A 4Z4GA 1VRTA 2YKMA 1C0TA 2DFHA 3LZJA 4BE0A 1KVCA 2OPRA 4IBNA 3TI0A 3HM9A 3HP9A 4OKKA 1G15A 2DFFA 4HCBA 3WNHA 4UQGA 2XRIA 3OYLA 1X1PA 2ATQA 4B08A 1RTHA 4CF8A 3VN5A 3HVRA 3QEXA 3OYHA 1T05A 4BDPA 4CIGA 4BE1A 1YT3A 4OVLA 4CEBA 2YNIA 1W0HA 1KTQA 1C1BA 1X9SA 4CJLA 1JLBA 3B6OA 4L8RB 4CJVA 4C8MA 3VQBA 1RTIA 3AVCA 2ZQBA 3SUPA 4BE2A 4W5OA 1T03A 3V9XA 4AHRA 1TK8A 4FLVA 3RMDA 1YTUA 1JXEA 1BIUA 4FYDA 4FW2A 1HQEA 4DQQA 4CJ5A 3NGIA 1QS4A 1SL2A 4W5NA 4CGJA 1XI1A 3HL8A 3NGZA 1L3TA 4N47A 3QEVA 1JL1A 4DTUA 3KKRA 3OYBA 4KTQA 3K5LA 4LSNA 3TAFA 3CM6A 1VSLA 1VSKA 4G1QA 4ID5A 3OYIA 4DTSA 1IKVA 2X78A 2NUBA 1IKWA 2VWJA 3JSMA 4M3TA 1HYZA 4CESA 2F8SA 1DTTA 1LW0A 4KHSA 3RRGA 1SKRA 4CJSA 4MFBA 1BI4B 1VSMA 3HK2A 4FJKA 2KW4A 3DI6A 4DSFA 5CY4A 4O55A 3PUFA 1QSYA 4NCBA 4B9MA 4KRFA 3G10A 3LALA 1BQNA 3AVMA 1JLEA 3C95A 2IS3A 3DLBA 1CZ9A 3SQ0A 3K58A 3NE6A 1RNHA 2KZMA 1NK0A 1BI4A 4E3SA 3KLEA 4CEOA 3ASMA 2BDPA 4FJ7A 4RW7A 3SZ2A 1VSJA 3S3NA 1WSHA 3OS1A 3U6FA 2IOCA 4N76A 4KTZA 1D5AA 3O3FA 1N6QA 3DYAA 3PY8A 4F2SA 4CHQA 1RT7A 2E6LA 3E01A 1S1TA 1LAVA 1L3VA 1WSJA 3MEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HPZ A;  3DRR A;  5CZ2 A;  3OYD A;  4CF1 A;  3VQQ A;  4DTM A;  4KI6 A;  3VQD A;  3ISN C;  2G8W A;  3O3H A;  3MXJ A;  1MU2 A;  3AVH A;  4F3T A;  2Z1H A;  4HUE A;  2BGG A;  4FZY A;  3CFP A;  1UOC A;  3K5N A;  1IH7 A;  1WSF A;  2YNH A;  3SQ4 A;  3P5J A;  3NFA A;  4O0J A;  3VQE A;  3O4Q A;  3KK1 A;  4E7J A;  1W9H A;  3ALY A;  4KPY A;  4Z4H A;  4OKJ A;  3NDK A;  1BQM A;  4W5Q A;  1Y97 A;  3LP2 A;  3P83 D;  3QEW A;  2IGI A;  4E89 A;  3QIP A;  4NYN A;  3EZ5 A;  4BWJ A;  3C6U A;  4IG3 A;  3O4N A;  1S9E A;  3OYC A;  4DFK A;  4B9L A;  4Z4F A;  5C42 A;  1BL3 A;  2GV9 A;  3V9U A;  3ZT3 A;  1DTQ A;  3T19 A;  2FBV A;  4W5R A;  3I8D A;  3SQ1 A;  2G8U A;  5JS2 A;  1X9M A;  4NCA A;  4MQ3 A;  2Y1I A;  4EZ6 A;  4Q0B A;  4DSE A;  4OLA A;  2BAN A;  3T3F A;  2O4G A;  3V9Z A;  1S1W A;  2EX3 A;  3TAE A;  2HNZ A;  2RKI A;  4TSX A;  4FJI A;  4KHW A;  3V1Q A;  3UIQ A;  3PX4 A;  3IRX A;  2JLE A;  1EET A;  3DOK A;  4E7I A;  3B6P A;  4B8C A;  3ZT4 A;  1BIS A;  4I2P A;  4KKO A;  1FXX A;  3VQ6 A;  4CJR A;  3L3V A;  1CZB A;  3LPU A;  2YKN A;  3OJS A;  3P1G A;  3U3G A;  3ZCM A;  3V4I A;  4CJF A;  4O5B A;  3S3O A;  1JL2 A;  3VQC A;  4CER A;  1TL1 A;  4HCC A;  3OYK A;  3TAN A;  4KO0 A;  3K2P A;  4IFV A;  1UAX A;  1ASW A;  3LWM A;  4IKF A;  4AHC A;  2E6M A;  2B5J A;  4CE9 A;  4BDY A;  1BGX T;  3MEC A;  3PO5 A;  3HO1 A;  1LWF A;  2B6A A;  1SUQ A;  1K6Y A;  3QLH A;  2Q3S A;  3BDP A;  4M3Z A;  4DF4 A;  3SUQ A;  1J9A A;  1RBS A;  4ICL A;  2A1R A;  4B9T A;  4PQU A;  1QE1 A;  1GOC A;  2OZS A;  3AA4 A;  1WAF A;  4CEF A;  1L3S A;  2W42 A;  3DLK A;  3HYF A;  2B4J A;  4IG0 A;  4DS5 A;  5FRM A;  1QSS A;  2HHT A;  2Z1J A;  4EP5 A;  3OYA A;  1ZBH A;  2FBT A;  1JLF A;  4CJ4 A;  3OJU A;  5EU7 A;  1B9D A;  4IFY A;  1D9F A;  5J2Q A;  5DMR A;  1NJY A;  4B9S A;  4AHT A;  1REV A;  1XWL A;  3OYM A;  3AVL A;  4DSL A;  3BGR A;  5HRN A;  1NKB A;  2FBY A;  3KD5 E;  3SI6 A;  3OYN A;  3NF9 A;  1SL0 A;  3AA5 X;  1LV5 A;  1KLM A;  3TAM A;  3AVF A;  3ITH A;  3KIO A;  4HUF A;  1RT5 A;  2RF2 A;  4O0I A;  3AVI A;  4XIU A;  2XY6 A;  1KLN A;  5J1E A;  1KRP A;  1B92 A;  4C8N A;  3AVA A;  1HYS A;  4CF9 A;  3CFO A;  1TKZ A;  3LAM A;  1UA0 A;  3L2Q A;  4OGE A;  4QOZ B;  1ASU A;  2PYL A;  2YNG A;  5CZ1 A;  3T1A A;  1LW2 A;  5E41 A;  1NOZ A;  4GMJ B;  3QEP A;  3KJV A;  3AO2 A;  3V81 A;  5HRO A;  1QQC A;  4Y1C A;  1NK5 A;  4I2Q A;  1NK4 A;  3QO9 A;  3VQP A;  1C1C A;  2I5J A;  4C8L A;  1BCM A;  2X6N A;  4FLX A;  1NK9 A;  4KHN A;  2VG5 A;  2Y1J A;  3PV8 A;  4DQS A;  4ZTF A;  3D0P A;  4DQI A;  4LH5 A;  3LWL A;  1RIL A;  3QER A;  3ULD A;  2P1J A;  4NYF A;  4CED A;  4DQP A;  4AHV A;  4CFA A;  3AVG A;  1HQU A;  1HMV A;  2GUI A;  4FLT A;  4E1M A;  1NK8 A;  3DRP A;  3F73 A;  3LP1 A;  4FM0 A;  1CXU A;  2XHB A;  4QCL A;  1IO2 A;  1R0A A;  3SJJ A;  4OLB A;  1ZBI A;  3AVN A;  4FCY A;  4Z4E A;  2HVH A;  1FKO A;  2OPQ A;  2LSN A;  2X74 A;  5KI6 A;  2YV0 X;  1JKH A;  3DMJ A;  4CHO A;  4RW4 A;  4FK0 A;  4FJX A;  4CHN A;  4J2D A;  4CJP A;  3SUN A;  1S5J A;  4FLW A;  4H8K A;  5J2N A;  1L5U A;  3ZSY A;  2HHV A;  3NF8 A;  4ZHR A;  1U04 A;  1IG9 A;  1Z25 A;  1RTD A;  4BAC A;  4Q5V A;  1RT4 A;  5KRT A;  1BHL A;  3KLI A;  3NH2 A;  1O1W A;  3MED A;  3SQ2 A;  3TAP A;  1Q9Y A;  5J2M A;  1RT3 A;  2HW3 A;  4DTP A;  3V1O A;  3VQ5 A;  3D45 A;  2G8K A;  4KB1 A;  4DG1 A;  3DOL A;  3THV A;  5FRO A;  2BE2 A;  3KK3 A;  5K14 A;  3LP3 A;  2HHW A;  4DU1 A;  4AIL C;  2YHA A;  2KQ2 A;  2D5R A;  4FJJ A;  4J2A A;  4H4M A;  4DF8 A;  3C94 A;  3WNF A;  5KGW A;  4FVM A;  4OJR A;  1U4B A;  3FFI A;  4WE1 A;  3LAN A;  3RRH A;  1WSG A;  4K8X A;  2VG7 A;  3IS9 A;  4CEC A;  4O4G A;  1LAW A;  3TAQ A;  1Q8I A;  2WOM A;  4C8K A;  4RW9 A;  4FJ5 A;  4DTR A;  3OY9 A;  5HRS A;  2OZM A;  1S6P A;  4FJH A;  3RTV A;  4E7K A;  1BIZ A;  1HRH A;  1ZYQ A;  1XC9 A;  3A2F A;  2HNY A;  3SV4 A;  3DRS A;  4OPJ A;  3M8S A;  3JYT A;  3QNN A;  3ZT1 A;  3M8P A;  5CYQ A;  4CGI A;  4PWD A;  2HHS A;  4Z4C A;  3ZSZ A;  2DTU A;  3HPG A;  4M41 A;  1ZBF A;  3G0Z A;  3OYE A;  1B9F A;  3QET A;  5CYM A;  3ZT0 A;  3PX6 A;  1S6Q A;  3AO5 A;  4CEE A;  3QIO A;  4DQR A;  4FZX C;  4FJ8 A;  1NJW A;  4Z0U A;  4CGF A;  3LP0 A;  5C24 A;  4F8R A;  1RDB A;  3HVT A;  3VA3 A;  1KVA A;  3IAY A;  2QXF A;  3SNN A;  4N41 A;  3LPT A;  4AHU A;  1A5W A;  1RBT A;  3C6T A;  3HXM A;  4DU3 A;  4ELV A;  1J54 A;  3SV3 A;  1RCH A;  3SPZ A;  3SUO A;  2D0A A;  5KGX A;  1XHX A;  3AO3 A;  3CYM A;  3NBP A;  3HPO A;  4F4K A;  2OPS A;  4CHZ A;  4KAZ A;  2AJQ A;  3OYJ A;  4FK2 A;  4KB0 A;  1ZBL A;  2RN2 A;  1J53 A;  3S3M A;  1SV5 A;  3PX0 A;  1T7P A;  3DLR A;  1HNV A;  4NCG A;  1X9W A;  1NK7 A;  4CCH A;  1EX4 A;  3KK2 A;  4CFB A;  4PUO A;  5I42 A;  4B8A B;  4E1N A;  4N56 A;  2FBX A;  3VQ8 A;  3RR7 A;  4AHS A;  5DK5 A;  4CF2 A;  1RBV A;  1A5V A;  2VWK A;  3MEE A;  3RR8 A;  3KTQ A;  3SCX A;  4DFP A;  1TAQ A;  2OPP A;  1NKE A;  4DFJ A;  2FC0 A;  3NF7 A;  3DM2 A;  1LWE A;  4N5S A;  1A5X A;  1I39 A;  1VSE A;  3CM5 A;  1QTM A;  1T8E A;  4EZ9 A;  2GBZ A;  3RWU A;  4HUG A;  4M3X A;  1GOA A;  2YNF A;  2KFN A;  3I0R A;  2YHB A;  1NK6 A;  4DS4 A;  5FRN A;  3CG7 A;  4YNQ A;  4CJE A;  3TAR A;  4E7L A;  4DSK A;  4DWI A;  2Z1I A;  2QKB A;  4KFB A;  4ID1 A;  1TK5 A;  2QKK A;  3K5O A;  1ITG A;  4KHY A;  2XY8 A;  3HJF A;  4FLU A;  4CJW A;  1JLA A;  1FK9 A;  1RT1 A;  5KTQ A;  4CFD A;  3KKS A;  3LZI A;  4HHT A;  1WLJ A;  3QEI A;  1SKW A;  4F3O A;  5D3G A;  4GVM A;  3MAQ A;  3VQ4 A;  1CLQ A;  4CHY A;  1RDA A;  4PA1 A;  2P51 A;  5I3U A;  2P5G A;  3M8R A;  4RW6 A;  1C0U A;  4DTX A;  1N5Y A;  3L2V A;  4M3Y A;  5HRP A;  5HRR A;  4J2E A;  1IKY A;  1JLG A;  4CK2 A;  1QSL A;  1NOY A;  3V6D A;  3NH1 A;  4DSI A;  2Z1G A;  2PZS A;  4H4O A;  2P5O A;  1S1V A;  4B9U A;  4KHQ A;  3L2R A;  4JS5 A;  4CEQ A;  1NKC A;  4KV8 A;  2HMI A;  4IDK A;  4CJQ A;  2EHG A;  4CIF A;  3IG1 A;  2ZE2 A;  1U47 A;  4ELU A;  1YVU A;  2HB5 A;  3U3Y A;  3KLG A;  2F96 A;  3V9W A;  4M42 A;  1SL1 A;  3TWH A;  4CEA A;  2HHU A;  4B9V A;  3LAK A;  2G8V A;  2WON A;  4CGH A;  1KFD A;  4OKE A;  1TKD A;  3ZSX A;  1JXB A;  1Q9X A;  4AH9 A;  3NF6 A;  4W5T A;  1WSE A;  3MXM A;  4E0D A;  4FJ9 A;  3AA2 A;  1S1U A;  4E19 A;  1EP4 A;  2XO7 A;  2HHX A;  1Z26 A;  3HP6 A;  4KHU A;  3ZSR A;  3L8B A;  1HJR A;  3KLF A;  1KVB A;  4I7F A;  4Y1D A;  2OA8 A;  3RMA A;  4FW1 A;  4RW8 A;  3SYZ A;  5HP1 A;  1RBU A;  5FDL A;  3EY1 A;  5J2P A;  2PY5 A;  3QNO A;  3O3G A;  3ZSV A;  2E4L A;  1JLQ A;  3AVJ A;  1RT6 A;  3L3U A;  2X6S A;  3QIN A;  1HYV A;  1RBR A;  1J5O A;  2G8F A;  4C8O A;  4FJM A;  2R7Y A;  2QK9 A;  4PY5 A;  3F9K A;  3K59 A;  5JS1 A;  4FJL A;  3TAG A;  4M3U A;  3VQA A;  4CIE A;  4FJG A;  1UWB A;  4FXD A;  1VSD A;  3MXI A;  1EXQ A;  4DMN A;  3S9H A;  3VQ7 A;  4DSJ A;  2KTQ A;  3AVB A;  4FLY A;  3EYZ A;  1ASV A;  1DLO A;  4CHP A;  4JS4 A;  3HST B;  1WAJ A;  4CF0 A;  2IDO A;  4BWM A;  3NCI A;  4KI4 A;  4FK4 A;  3KD1 E;  3CFR A;  3TAB A;  1VSH A;  4LH4 A;  4HTU A;  4FM2 A;  1BCO A;  3WNG A;  1D8Y A;  4CGG A;  4BDZ A;  2D0B A;  1RDC A;  3CQ8 A;  4DTO A;  3SPY A;  4B9N A;  3ZT2 A;  4JRP A;  4DTJ A;  3V9S A;  1RT2 A;  3LDS A;  4Z4I A;  4JLH A;  2G8I A;  1I3A A;  1S1X A;  1WSI A;  3NGY A;  5HBM A;  4CGD A;  4DU4 A;  4DLE A;  4LSL A;  3PO4 A;  2KFZ A;  3OVN A;  2KZZ A;  1GOB A;  1TGO A;  1D9D A;  3NHG A;  2OYQ A;  4FLZ A;  3ZSQ A;  3H08 A;  1WN7 A;  3OYG A;  1NJZ A;  4M3W A;  2O4I A;  4DFM A;  1C0M A;  2ZD1 A;  1LWC A;  1NJX A;  4O44 A;  4CJU A;  1FKP A;  3HT3 A;  1KFS A;  1ZBU A;  2XY5 A;  3OYF A;  3QES A;  1KCF A;  3KLH A;  3TR8 A;  3WNE A;  4FM1 A;  4E7H A;  4RG8 A;  4EP4 A;  5SWM A;  4DTN A;  3M8Q A;  2D0C A;  2IC3 A;  1RDD A;  1IKX A;  4CJK A;  5HLF A;  4ZTJ A;  4LY7 A;  1TK0 A;  3NAE A;  3ZSO A;  4CJ3 A;  4K8Z A;  3L2U A;  3AO1 A;  4LD0 A;  3RMC A;  4GW6 A;  1TKX A;  1JLC A;  2RPI A;  5KRS A;  3HPH A;  1S9G A;  4FJN A;  2IAJ A;  4I9L A;  3ZSW A;  1C1A A;  4KTW A;  1TV6 A;  1TL3 A;  3AA3 A;  1L3U A;  3VQ9 A;  4HVJ A;  4M3R A;  4OPK A;  1VSF A;  3L2W A;  3I0S A;  1CXQ A;  1SKS A;  4FZZ A;  4F2R A;  1VK0 A;  1UA1 A;  4DLG A;  2ETJ A;  1TAU A;  4YFU A;  3DLH A;  4JRQ A;  4OGC A;  4I9Q A;  2ITG A;  3AV9 A;  1U49 A;  2A1S A;  3AVK A;  4B3O A;  4R5P A;  1RTJ A;  3K57 A;  4QAG A;  1WNS A;  1F21 A;  3RMB A;  2DY4 A;  2XY7 A;  1C6V A;  1TVR A;  3OS2 A;  4ELT A;  1QHT A;  1KSP A;  3V1R A;  2HHQ A;  4CEZ A;  1EKE A;  1YTA A;  2JGU A;  3NH0 A;  3DLE A;  2VG6 A;  3VA0 A;  3OS0 A;  2DFE A;  4CJT A;  1XHZ A;  2PYJ A;  2HND A;  1TKT A;  1VRU A;  3AO4 A;  4CFC A;  3K5M A;  2F8T A;  1HNI A;  1U48 A;  1VSI A;  4CK1 A;  4J2B A;  5SZT A;  4M45 A;  4KRE A;  2HVI A;  2G8H A;  4CK3 A;  3DLG A;  5C25 A;  5T7B A;  1U45 A;  4Z4G A;  1VRT A;  2YKM A;  1C0T A;  2DFH A;  3LZJ A;  4BE0 A;  1KVC A;  2OPR A;  4IBN A;  3TI0 A;  3HM9 A;  3HP9 A;  4OKK A;  1G15 A;  2DFF A;  4HCB A;  3WNH A;  4UQG A;  2XRI A;  3OYL A;  1X1P A;  2ATQ A;  4B08 A;  1RTH A;  4CF8 A;  3VN5 A;  3HVR A;  3QEX A;  3OYH A;  1T05 A;  4BDP A;  4CIG A;  4BE1 A;  1YT3 A;  4OVL A;  4CEB A;  2YNI A;  1W0H A;  1KTQ A;  1C1B A;  1X9S A;  4CJL A;  1JLB A;  3B6O A;  4L8R B;  4CJV A;  4C8M A;  3VQB A;  1RTI A;  3AVC A;  2ZQB A;  3SUP A;  4BE2 A;  4W5O A;  1T03 A;  3V9X A;  4AHR A;  1TK8 A;  4FLV A;  3RMD A;  1YTU A;  1JXE A;  1BIU A;  4FYD A;  4FW2 A;  1HQE A;  4DQQ A;  4CJ5 A;  3NGI A;  1QS4 A;  1SL2 A;  4W5N A;  4CGJ A;  1XI1 A;  3HL8 A;  3NGZ A;  1L3T A;  4N47 A;  3QEV A;  1JL1 A;  4DTU A;  3KKR A;  3OYB A;  4KTQ A;  3K5L A;  4LSN A;  3TAF A;  3CM6 A;  1VSL A;  1VSK A;  4G1Q A;  4ID5 A;  3OYI A;  4DTS A;  1IKV A;  2X78 A;  2NUB A;  1IKW A;  2VWJ A;  3JSM A;  4M3T A;  1HYZ A;  4CES A;  2F8S A;  1DTT A;  1LW0 A;  4KHS A;  3RRG A;  1SKR A;  4CJS A;  4MFB A;  1BI4 B;  1VSM A;  3HK2 A;  4FJK A;  2KW4 A;  3DI6 A;  4DSF A;  5CY4 A;  4O55 A;  3PUF A;  1QSY A;  4NCB A;  4B9M A;  4KRF A;  3G10 A;  3LAL A;  1BQN A;  3AVM A;  1JLE A;  3C95 A;  2IS3 A;  3DLB A;  1CZ9 A;  3SQ0 A;  3K58 A;  3NE6 A;  1RNH A;  2KZM A;  1NK0 A;  1BI4 A;  4E3S A;  3KLE A;  4CEO A;  3ASM A;  2BDP A;  4FJ7 A;  4RW7 A;  3SZ2 A;  1VSJ A;  3S3N A;  1WSH A;  3OS1 A;  3U6F A;  2IOC A;  4N76 A;  4KTZ A;  1D5A A;  3O3F A;  1N6Q A;  3DYA A;  3PY8 A;  4F2S A;  4CHQ A;  1RT7 A;  2E6L A;  3E01 A;  1S1T A;  1LAV A;  1L3V A;  1WSJ A;  3MEG A; 
#chains in the Genus database with same CATH topology
 5LJW A;  3MX2 A;  4JI6 K;  3VQD A;  4CZL A;  2G8W A;  1MU2 A;  4HUE A;  2VQE K;  3MWT A;  2YNH A;  3NFA A;  1E4F T;  1Y64 A;  1R59 O;  3R8E A;  1W9H A;  4YOU A;  4OKJ A;  1BQM A;  4W5Q A;  2KHO A;  1V4T A;  3P83 D;  5MLC Q;  1KD1 O;  1Q7Y O;  2CGJ A;  3KVG A;  2GV9 A;  2FBV A;  1HKG A;  4W5R A;  4MQ3 A;  4YDU A;  2BAN A;  3V9Z A;  1S1W A;  4IZ9 A;  3PX4 A;  3IRX A;  4JKC A;  4E7I A;  3B6P A;  1NMD A;  1GLE G;  4B8C A;  4BRH A;  4CW7 B;  3VMF B;  4KKO A;  4CJR A;  4RWT A;  1FXX A;  3L3V A;  2P9L A;  4B3R K;  3OJS A;  3CC7 N;  5BRE A;  4O5B A;  3LDO A;  3C7N A;  3LWM A;  4AHC A;  4CE9 A;  1W97 L;  1LWF A;  2B6A A;  1ATR A;  3BDP A;  4M3Z A;  2CH5 A;  4DF4 A;  3VF4 A;  3SUQ A;  4PQU A;  1GOC A;  3ATV A;  3AA4 A;  5AQJ A;  1L3S A;  4IG0 A;  1MWK A;  1IBK K;  4EP5 A;  3G6E N;  1ZBH A;  4CJ4 A;  5J2Q A;  5LJV A;  4NCA A;  1XWL A;  3T69 A;  3WQT A;  3AVL A;  3OYM A;  3BGR A;  1NKB A;  3SI6 A;  1SL0 A;  3NF9 A;  3AA5 X;  3VEO A;  2W6L A;  1KLM A;  1OH6 A;  3AVF A;  3ZX2 A;  1RT5 A;  3ZEU B;  5E84 A;  2XY6 A;  5J1E A;  1B92 A;  4C8N A;  3AVA A;  3CHW A;  1UA0 A;  1XC3 A;  1TKZ A;  3LAM A;  1KC8 O;  3L2Q A;  1EWQ A;  4OGE A;  5CZ1 A;  5E41 A;  3AO2 A;  3V81 A;  1QQC A;  4PKH A;  1NK4 A;  4KBO A;  1BCM A;  3GG4 A;  4K41 A;  5M1N A;  4KHN A;  1RIL A;  4K25 A;  2P1J A;  4NYF A;  4CED A;  4CFA A;  1HMV A;  3EL2 A;  4B1U B;  2JWK A;  3F73 A;  2XHB A;  1W7A A;  2HVH A;  1NM1 A;  5EY4 A;  5BR9 A;  1FKO A;  2OPQ A;  2X74 A;  3ZYY X;  4OPH A;  4FJX A;  1S5J A;  4FWR A;  5IWA K;  3NF8 A;  4LFA K;  3AAQ A;  1RT4 A;  4BR5 A;  4U7B A;  3KLI A;  3NH2 A;  1O1W A;  3MED A;  1Q9Y A;  3RSE B;  4WQ5 A;  1QHA A;  3E1Y A;  2HHH K;  4IXC A;  4H0X B;  3THV A;  3CJC A;  3QFU A;  2NRT A;  4DU1 A;  1Z05 A;  4FJJ A;  4H4M A;  3WNF A;  2J4R A;  5KGW A;  4K8X A;  3FFI A;  3MWP A;  2P9P A;  3LAN A;  1WSG A;  3RRH A;  1HNW K;  2VG7 A;  2O8E A;  4QS7 A;  1LAW A;  4C8K A;  4DTR A;  1VQN N;  1S6P A;  4XEI A;  1QZ6 A;  3VGM A;  1ZYQ A;  3SMP A;  3DRS A;  3QNN A;  1T6D A;  4CGI A;  5CYQ A;  4CZE A;  3ZSZ A;  2DTU A;  4LF7 K;  1NWK A;  1ZBF A;  4BQL A;  3QET A;  4A2B A;  3U9Z A;  4DQR A;  1XQS C;  4Z0U A;  3LP0 A;  5C24 A;  1VQ5 N;  3D2F A;  3SNN A;  3LPT A;  1RBT A;  2Q97 A;  1J54 A;  3SPZ A;  1XHX A;  3CYM A;  3CCQ N;  4F4K A;  3WXJ A;  4CI6 A;  2H3G X;  4KB0 A;  3S3M A;  1J53 A;  3EE8 A;  3AGK A;  3DLR A;  1HNV A;  4NCG A;  1NK7 A;  1EX4 A;  4FPB A;  3KK2 A;  4PUO A;  3SLC A;  5DM6 L;  3O1B A;  4CF2 A;  5DK5 A;  4B1Z A;  1A5V A;  2VWK A;  2VYP A;  3SCX A;  2GEL A;  4DFJ A;  4CJ7 A;  3DM2 A;  5AZI B;  1I39 A;  1VSE A;  5HOO A;  1NGE A;  4EZ9 A;  3RWU A;  3NVK A;  3THW A;  2NRZ A;  2YHB A;  5FRN A;  4JI5 K;  4DWI A;  2Z1I A;  3OBW A;  4DV1 K;  5KTQ A;  3LZI A;  3KKS A;  1SKW A;  4F3O A;  1WLJ A;  2OCE A;  4LF8 K;  3VQ4 A;  4I6M A;  4AM7 A;  2P51 A;  1GLJ O;  1OH7 A;  1C0U A;  3S41 A;  1N5Y A;  3L2V A;  4M3Y A;  5HRP A;  1IKY A;  4NLC A;  1BWF O;  3ENB A;  4H4O A;  2NRH A;  4KHQ A;  3L2R A;  2ASP A;  4KV8 A;  1KXP A;  3FR0 A;  4IDK A;  3LDP A;  2EHG A;  1E3M A;  4FO0 A;  1YVU A;  3KLG A;  4M42 A;  3TWH A;  2G8V A;  1GLF O;  1SQK A;  1KFD A;  4CGH A;  4LF5 K;  1Q9X A;  4E0D A;  3NF6 A;  1NMN A;  1WSE A;  1MDU B;  4DHY A;  3AA2 A;  5AQW A;  4E19 A;  1EP4 A;  3MXM A;  4FJ9 A;  2HHX A;  3HP6 A;  4KHU A;  2O8F B;  2A6A A;  2NNW A;  4I7F A;  1RGI A;  3D6R A;  4JI2 K;  1HKB A;  1TYQ A;  4FW1 A;  3SYZ A;  1I94 K;  5IT9 O;  1OH8 A;  2PY5 A;  3QIN A;  2R7Y A;  3K59 A;  1QQO A;  4GV9 A;  3MXI A;  2QWM A;  4DMN A;  3AVB A;  4FLY A;  1ASV A;  1DLO A;  4KI4 A;  3NCI A;  3BP8 A;  3KD1 E;  4BRF A;  3CFR A;  3Q7C A;  1VSH A;  4LH4 A;  1BCO A;  2D0B A;  3CQ8 A;  3JXU A;  3V9S A;  1RT2 A;  4Z4I A;  2ASO A;  4CGD A;  5KPT A;  4BR9 A;  3OVN A;  5TKW A;  1GOB A;  2OYQ A;  3CCL N;  1WN7 A;  3PIP L;  3OYG A;  3CME N;  4K0K K;  1C0M A;  5JIC A;  1NJX A;  1JCG A;  3UKU A;  4BC2 A;  2V7Z A;  4JKA A;  1QQM A;  3OYF A;  3TR8 A;  3WNE A;  1DT9 A;  4FM1 A;  4RG8 A;  4EP4 A;  2D0C A;  3NAE A;  3O9R A;  4K8Z A;  4BR4 A;  4PL8 A;  1TKX A;  2E2N A;  1S9G A;  1GLC G;  5CE3 A;  1TV6 A;  1U2V A;  1ZC6 A;  4B3M K;  3VEX A;  1VSF A;  4B1Y B;  3PLA A;  5C12 A;  5BRD A;  4DLG A;  1BUP A;  3DLH A;  3QDK A;  1U49 A;  3K57 A;  4YOV A;  4B9Q A;  1DEJ A;  1QHT A;  3VA0 A;  2VG6 A;  2E1Z A;  4JD2 A;  2DFE A;  2NZT A;  1TKT A;  3AO4 A;  2FSN A;  3IUC A;  1HNI A;  4M45 A;  1D4X A;  4UY8 O;  4NO7 A;  5T7B A;  1U6Z A;  4WF9 L;  4LFC K;  4EFH A;  2YCH A;  3F2K A;  2HST A;  2W41 A;  4B1V A;  4HCB A;  4B08 A;  2ZJP L;  1N36 K;  3VN5 A;  1T05 A;  1IV0 A;  3VEW A;  1EO1 A;  1YT3 A;  1T44 A;  2YNI A;  3TSP A;  1Q81 O;  3VOV A;  1X9S A;  1C1B A;  4H03 B;  4DR5 K;  4RTF D;  4FLV A;  1NU0 A;  3QBX A;  3LDQ A;  1YTU A;  3H1Q A;  5CR4 A;  3VET A;  4DQQ A;  4CJ5 A;  3NGI A;  4B3S K;  2UXC K;  3HOT A;  4N47 A;  4WQ4 C;  1JL1 A;  3E66 A;  4LSN A;  3SAF A;  1WOQ A;  1JCF A;  3BZK A;  3MN6 A;  1VSL A;  4DR3 K;  4LC9 B;  2HBJ A;  1QVG M;  5I9E B;  4M3T A;  2YJE A;  4KHS A;  3LDN A;  3ATU A;  4CJS A;  3I56 N;  1SAZ A;  1YHQ N;  4BR7 A;  2KW4 A;  2P9I B;  4U67 L;  4DSF A;  4NCB A;  3G10 A;  3LAL A;  3P4I A;  3E9O A;  3AVM A;  1JLE A;  3SQ0 A;  1SZ2 A;  5LL6 Z;  2I7P A;  1RNH A;  3O9Q A;  1NK0 A;  4XH5 A;  3ASM A;  5DM7 L;  5F0X A;  1V4S A;  2IOC A;  2V52 B;  4ILJ A;  4N76 A;  1XNR K;  1P8Z A;  2FLO A;  3PY8 A;  4F2S A;  5AQI A;  1RT7 A;  2QXL A;  2HF3 A;  2OAN A;  4DTM A;  3O3H A;  2Z1H A;  3RSE A;  3CFP A;  1UOC A;  4FZY A;  2P9U B;  4KPY A;  5M1F A;  4Z4H A;  5AQK A;  3LP2 A;  1BOT O;  3EZ5 A;  3AAP A;  4IG3 A;  3OYC A;  1VQL N;  1NGA A;  3O8M A;  3CCV N;  3V9U A;  4BRM A;  1DTQ A;  3T19 A;  2Q31 A;  2E2P A;  2G8U A;  5JS2 A;  1VAZ A;  1YIT N;  3A5N C;  3HTV A;  4NB4 A;  3VEY A;  4EZ6 A;  4FJI A;  3VF6 A;  4ISF A;  3M1F A;  4IOC L;  4A59 A;  3W3D A;  3O08 A;  2YI1 A;  3C65 A;  3SMS A;  4CD3 A;  2YKN A;  1P90 A;  4A5A A;  4DV5 K;  4HCC A;  1TL1 A;  4CZK A;  3OYK A;  4FOI A;  3K2P A;  1UAX A;  5BR8 K;  3HO1 A;  2EWS A;  1QVF M;  1SUQ A;  2Q3S A;  1VQK N;  5BRF A;  4B9T A;  2GX9 A;  1WBD A;  2OZS A;  1NG9 A;  2CGL A;  4B1X B;  3DLK A;  3HYF A;  1EWR A;  1QSS A;  2FBT A;  1K8K A;  3OJU A;  4IFY A;  3E9L A;  5DMR A;  4Z94 A;  4B9S A;  4DSL A;  1KAZ A;  4DB3 A;  2E88 A;  2FBY A;  3KD5 E;  1LV5 A;  3TAM A;  3SK3 A;  3CCE N;  2ITM A;  2ZJR L;  3WEE A;  1ASU A;  2YNG A;  4BVO A;  4CZH A;  3QEP A;  4O8U A;  5JMV A;  2IIR A;  2Q2R A;  1NK5 A;  4C8L A;  4MLE A;  3ID6 A;  4DQS A;  2NRX A;  3D0P A;  3EKS A;  3LWL A;  4AHV A;  1HQU A;  4JI0 K;  4MO5 A;  2GUI A;  1NK8 A;  3LP1 A;  5KPZ A;  4JKG B;  2ZGY A;  4QCL A;  4K42 A;  1FJG K;  1ZBI A;  2O8C B;  3CER A;  1K9M O;  1X3N A;  4Z4E A;  1OVY A;  5LMU K;  2YV0 X;  4B1W B;  3SBT A;  5AQS A;  2ASM A;  3VPZ A;  4FLW A;  4GY2 B;  1TUU A;  4K43 A;  1IG9 A;  1Z25 A;  2WTU A;  4BRD A;  2O8F A;  2QM1 A;  5KRT A;  3SQ2 A;  5EVZ A;  3LL3 A;  2HW3 A;  4DTP A;  4EIA A;  3CPE A;  4KB1 A;  4DG1 A;  3DOL A;  3UE5 A;  5AQZ A;  2KQ2 A;  4CZJ A;  3G4S N;  4OJR A;  1Z6R A;  3F9M A;  4O4G A;  1NLV A;  2OZM A;  3FLC O;  4DV4 K;  4DV7 K;  4JKF A;  1BIZ A;  1HRH A;  1NJI O;  1XC9 A;  3JYT A;  2GWK A;  4DV3 K;  3M8P A;  4Z4C A;  1ATS A;  3G0Z A;  4AQY K;  3ZT0 A;  3PX6 A;  4CEE A;  3QIO A;  1NJW A;  4CGF A;  1DKG D;  4FPA A;  3CET A;  4ELV A;  3SV3 A;  1RCH A;  3SUO A;  3QBW A;  2D0A A;  4GV6 A;  3DXK B;  3IMX A;  2F4V K;  3WXK A;  3N4P A;  1ZBL A;  1SV5 A;  1X9W A;  4CCH A;  2E2Q A;  5FPM A;  4CFB A;  5I42 A;  4B8A B;  5E26 A;  4EAH D;  2FBX A;  4N56 A;  1Q18 A;  2QWN A;  4AHS A;  1KQS M;  3MEE A;  2Q0R A;  1TUY A;  1TAQ A;  2OPP A;  1IBM K;  1A5X A;  3CM5 A;  4JI4 K;  4M3X A;  4HUG A;  1GOA A;  2YNF A;  3L4I A;  2KFN A;  1X3M A;  4DS4 A;  3CG7 A;  4JHD B;  4CJE A;  3TAR A;  4E7L A;  4KH5 A;  1TK5 A;  2QKK A;  3K5O A;  2O8D B;  4FLU A;  4H5N A;  1FK9 A;  1RT1 A;  3IDH A;  5D3G A;  4GVM A;  4FWK A;  4X62 K;  4BRI A;  1RDA A;  4C23 A;  3AGR A;  1K8A O;  2P5G A;  1T6C A;  3AAR A;  1YF5 L;  5LMN K;  1Q86 O;  5GAD P;  3NH1 A;  2PZS A;  2P5O A;  1W2B M;  5AQQ A;  3HSC A;  5BPL A;  3CCS N;  4JS5 A;  1NKC A;  3D2E A;  4C1N K;  4BRE A;  5FPN A;  2ZE2 A;  5H1S Q;  2QWR A;  5EXW A;  4X65 K;  2F96 A;  4PHT X;  4CEA A;  4B9V A;  4FWL A;  4OKE A;  3OHR A;  3P31 A;  3I8B A;  4W5T A;  4HTL A;  2XO7 A;  3A5O C;  3ZSR A;  1KVB A;  1HUX A;  3TU5 A;  3K9K A;  3RMA A;  4RW8 A;  1YVN A;  5HP1 A;  1RBU A;  4L3Q A;  3QNO A;  3ZSV A;  2E4L A;  1JLQ A;  3AVJ A;  1RT6 A;  3L3U A;  2QK9 A;  1RBR A;  2E5L K;  4FJM A;  4NLB A;  3F9K A;  3U8X A;  5JS1 A;  4FJL A;  4M3U A;  4FXD A;  4KH4 A;  3VQ7 A;  3O5B A;  3OBY A;  3CJ9 A;  4JS4 A;  2E1Y A;  3R1X A;  2HBK A;  2RE2 A;  4CF0 A;  1VQ9 N;  1HJO A;  4X66 K;  3CQX A;  4HTU A;  1D8Y A;  4B9N A;  3HM8 A;  3JS6 A;  4JRP A;  2P9I A;  4JLH A;  3O9S A;  2G8I A;  1S1X A;  1WSI A;  5HBM A;  4DU4 A;  3TSU A;  2KFZ A;  4PKI A;  3BY5 A;  3NHG A;  4R79 A;  1RFQ A;  4M3W A;  4DFM A;  2ZD1 A;  4H0P A;  2NLX A;  4O44 A;  5FPE A;  1KFS A;  3SBG A;  1KCF A;  3CJA A;  3AY9 A;  1QQN A;  3J80 O;  3KLH A;  2QEX N;  4E7H A;  1BG3 A;  4DTN A;  3M8Q A;  2IC3 A;  1RDD A;  4H5R A;  3CF5 L;  3ZSO A;  4IO8 A;  3AO1 A;  4LD0 A;  4GW6 A;  2P9U A;  5JVH L;  2RPI A;  5KRS A;  4FJN A;  3ZET B;  3ZSW A;  3AA3 A;  2WUS A;  4HVJ A;  3BEX A;  1SKS A;  2WC9 A;  3JAM O;  1ESV A;  4OGC A;  3AV9 A;  3ULE B;  1NGB A;  4R5P A;  1RTJ A;  3SJH A;  4WFA L;  1BA0 A;  1C6V A;  1TVR A;  3NH0 A;  2PYJ A;  1YJN N;  4CJT A;  1C0F A;  3MN7 A;  2F8T A;  5SZT A;  1K73 O;  2HVI A;  1U45 A;  4Z4G A;  1VRT A;  3VGK A;  2OPR A;  3BZC A;  4IBN A;  3HM9 A;  2ZJQ L;  3WNH A;  3DWL A;  4X64 K;  3DXM B;  2XRI A;  4BC4 A;  3HVR A;  4CF8 A;  3QEX A;  2GUP A;  2NRR A;  4BDP A;  5ADX H;  4OVL A;  4JK8 A;  2F7T A;  2KLA A;  4JKH A;  4E1J A;  1BU6 O;  2W6K A;  4LF9 K;  4W5O A;  4O5F A;  1TK8 A;  4BGB A;  3RMD A;  1JXE A;  1HQE A;  1QS4 A;  4CGJ A;  1XI1 A;  1L3T A;  4XH4 A;  1EQY A;  4DQ8 A;  2UXD K;  4DR1 K;  3CM6 A;  1VSK A;  3OYI A;  2OTL N;  4DTS A;  1IKW A;  5M1Q A;  2IVP A;  3UB5 A;  5A2Q O;  1HYZ A;  4CES A;  2F8S A;  3O9U A;  1DTT A;  1VQM N;  3RRG A;  1SKR A;  2IVN A;  4MFB A;  1VSM A;  3HK2 A;  3DI6 A;  5CY4 A;  3HZ6 A;  4JNE A;  4KRF A;  3C95 A;  3DLB A;  1CZ9 A;  2P9N A;  1BI4 A;  4BRP A;  3THY B;  4JEP A;  5EX5 A;  4FJ7 A;  2A3Z A;  1VSJ A;  4BC3 A;  2O8C A;  3DJC A;  3ZLJ A;  3O3F A;  1N6Q A;  1YUW A;  4CHQ A;  1HNX K;  3J81 O;  4NXN K;  1BA1 A;  4JK9 A;  1LAV A;  3EN9 A;  1WSJ A;  3HI0 A;  1HPZ A;  1GLA G;  5CZ2 A;  4KI6 A;  1BDG A;  3ISN C;  5KQ8 A;  3T1Y K;  4F3T A;  3AVH A;  5JVG L;  2BGG A;  3GE1 A;  2ZM6 K;  3K5N A;  1IH7 A;  4O0J A;  3O1W A;  3O4Q A;  3VQE A;  3MMV A;  4E7J A;  3ALY A;  4JKD A;  1Y97 A;  2IGI A;  5C15 A;  4XH1 A;  4A5B A;  3A5M C;  3FE1 A;  4B9L A;  4Z4F A;  5C42 A;  1BL3 A;  1YJW N;  3C6A A;  2WBN A;  4JI7 K;  1X9M A;  2KKZ A;  2Y1I A;  1ILY A;  3T3F A;  2P9L B;  2O4G A;  4BR2 A;  2EX3 A;  4KHW A;  2RKI A;  3V1Q A;  3UIQ A;  1S3X A;  2F9W A;  3DLL L;  1EET A;  5F1X A;  2FSK A;  3CD6 N;  5AQG A;  3MN9 A;  1BIS A;  4I2P A;  5C2F A;  1VQO N;  1CZB A;  3TTC A;  3U3G A;  3ZCM A;  4GKJ K;  3V4I A;  3A8Y A;  3S3O A;  1JL2 A;  3R6M A;  4KO0 A;  3DAW A;  3ZX3 A;  3PO5 A;  1BGX T;  3C6H A;  1RBS A;  4ICL A;  2A1R A;  3FZL A;  1QE1 A;  2Q36 A;  3HOS A;  4CEF A;  4DS5 A;  5FRM A;  2Z1J A;  4BRK A;  1JLF A;  5EU7 A;  3WT0 A;  4AHT A;  1YI2 N;  3OYN A;  3IFR A;  5AQF A;  2QA4 N;  5AQY A;  3ITH A;  3LM9 A;  2RF2 A;  4XIU A;  1KLN A;  4JHD A;  1HYS A;  4CF9 A;  3CFO A;  3CC4 N;  1ATN A;  4QOZ B;  2PYL A;  3T1A A;  1NGF A;  2O8D A;  1NOZ A;  3GL1 A;  3KJV A;  2HMP A;  4IEI A;  3ZEU A;  4I2Q A;  1C1C A;  4FLX A;  2X6N A;  1NK9 A;  2Y1J A;  3PV8 A;  4LH5 A;  2Q0U A;  3QER A;  4DQP A;  4FLT A;  5GAH P;  4E1M A;  3DRP A;  4DUZ K;  1HPM A;  4FM0 A;  3SJJ A;  4EHT A;  5M1O A;  5GIN A;  5ADX A;  1JKH A;  3DMJ A;  4CHO A;  4GV3 A;  4CHN A;  4J2D A;  4CJP A;  3SUN A;  2ZWH A;  5BPM A;  2YHW A;  4H8K A;  1L5U A;  3ZSY A;  3CCJ N;  4FL9 A;  4ILG B;  3VTH A;  5J2M A;  3K9J A;  3FZF A;  2G8K A;  2QWP A;  2BE2 A;  3E9P A;  5K14 A;  5FRO A;  3KK3 A;  3LP3 A;  4PKG A;  2HHW A;  4AIL C;  4ISG A;  4J2A A;  5AFU H;  1NBW A;  4YOR A;  1U4B A;  4WE1 A;  3GDQ A;  3IS9 A;  1Q8I A;  2WOM A;  4JV5 K;  3IKM A;  2VCP A;  4FJ5 A;  3OY9 A;  2Q1N A;  5TKY A;  2QW9 A;  2HNY A;  3SV4 A;  3L0Q A;  4PWD A;  2HHS A;  3HPG A;  3WQU A;  3OYE A;  4FJ8 A;  3R9P A;  2HBM A;  3EEQ A;  2A5X A;  3VA3 A;  1KVA A;  4DR6 K;  4N41 A;  1RDU A;  4AHU A;  3VGL A;  1A5W A;  3C6T A;  4Y0W A;  4DU3 A;  2FXU A;  5KGX A;  4BRG A;  2AJQ A;  3QIC A;  3NBP A;  2OPS A;  4CHZ A;  4KAZ A;  2E20 A;  1IJJ A;  3VEZ A;  3PX0 A;  4YDU C;  5AQP A;  3P38 A;  4E1N A;  3VQ8 A;  3RR7 A;  2OTJ N;  3RR8 A;  3FZK A;  4DFP A;  1NKE A;  3NF7 A;  3UKR B;  4N5S A;  1YIJ N;  1QTM A;  1T8E A;  2GBZ A;  4CD1 A;  4MLH A;  5AZI A;  4KFB A;  5AZJ B;  3FZH A;  1S72 N;  4ID1 A;  4DV2 K;  2XY8 A;  3HJF A;  4CJW A;  1JLA A;  3SAH A;  4DUY K;  4CFD A;  2ZGZ A;  2D0O A;  3TPQ A;  3ID8 A;  1CLQ A;  4CZM A;  4CHY A;  1N34 K;  3M8R A;  4RW6 A;  3O6W A;  4DTX A;  2O8B B;  4J2E A;  1JLG A;  1M1K O;  1NOY A;  1KAY A;  1S1V A;  5AQV A;  2FF6 A;  3O9T A;  4WQ4 A;  2QTD A;  4M7Y A;  4BG9 A;  4CZG A;  2GTD A;  2QWQ A;  4CJQ A;  2CH6 A;  3IG1 A;  2V7Y A;  3V9W A;  3FGU A;  1SL1 A;  2HHU A;  1TYQ B;  4DKW A;  3BF1 A;  1X9J A;  1TKD A;  1E4G T;  1JXB A;  4AH9 A;  4YOX A;  1HJR A;  3KLF A;  1VQP N;  4Y1D A;  5GIO A;  3EY1 A;  1J5O A;  5B8H A;  1HYV A;  2QWO A;  3KK7 A;  2G8F A;  4IWV A;  5EOY A;  4PY5 A;  4IO9 L;  2E2O A;  3VQA A;  4FJG A;  1UWB A;  1VSD A;  3S9H A;  4DSJ A;  2KTQ A;  3HRG A;  4CHP A;  3H3N O;  1WAJ A;  2IDO A;  4FK4 A;  3P39 A;  2PBD A;  1J5E K;  4LFB K;  3H46 O;  1GLD G;  4DTO A;  4DTJ A;  4WQ5 C;  4CBW A;  1RDW X;  3NGY A;  5AQN A;  4DLE A;  3PO4 A;  1TGO A;  1D9D A;  3THY A;  4FLZ A;  1YJ9 N;  1HKC A;  3H08 A;  1NJZ A;  1LWC A;  4YHH K;  1FKP A;  3HT3 A;  3GOI A;  1N33 K;  2I7N A;  1VQ8 N;  1MWM A;  1WUA A;  3EKU A;  5SWM A;  3EZW A;  3OTO K;  3TSQ A;  3H1V X;  4JN4 A;  1U2V B;  1IKX A;  5HLF A;  3THX B;  4LF4 K;  4CJ3 A;  5C0Y A;  4RCH A;  3C0B A;  3G71 N;  2P9S B;  3F5T A;  4I9L A;  4EHU A;  4KTW A;  2YHX A;  3U9D A;  1TL3 A;  2HBL A;  3VQ9 A;  2PAV A;  3L2W A;  4BRN A;  3I0S A;  5AFU A;  3OA9 A;  2UUC K;  3MCP A;  4YFU A;  4JD2 B;  4I9Q A;  2ITG A;  3AVK A;  4CVN E;  4JKE A;  4QAG A;  1WNS A;  1F21 A;  4F9O A;  3OS2 A;  1KSP A;  3V1R A;  4CEZ A;  1N32 K;  2JGU A;  3DLE A;  3M5R A;  1KAX A;  3OS0 A;  1J6Z A;  2HND A;  1VRU A;  3K5M A;  4CFC A;  5BN9 A;  2V51 B;  4IJN A;  4CK1 A;  4J2B A;  5AQT A;  3DLG A;  5C25 A;  2F9T A;  2D1K A;  3VEV A;  2VQF K;  3TI0 A;  3M6G A;  4BG8 A;  3OYL A;  1X1P A;  1RTH A;  3OYH A;  4BE1 A;  3MDQ A;  4CEB A;  1KTQ A;  1WBB A;  4CJL A;  1JLB A;  3B6O A;  4FWM A;  4L8R B;  4CJV A;  3VQB A;  3CI5 A;  1RTI A;  2ZQB A;  4MDA A;  4BE2 A;  3V9X A;  4AHR A;  5AQR A;  2A41 A;  1BIU A;  5BN8 A;  3T7Z A;  3GBT A;  3HL8 A;  3NGZ A;  2IVO A;  4KH6 A;  3KKR A;  5JLH A;  3OYB A;  2D0P A;  1NGI A;  4V19 S;  3TAF A;  3KWI A;  4A62 A;  1IKV A;  2X78 A;  2NUB A;  3LM2 A;  2VWJ A;  1MA9 B;  5ELZ A;  3JSM A;  4OO1 J;  3TTD A;  3PSF A;  4JKB A;  1LW0 A;  4ILH A;  4O55 A;  3PUF A;  1QSY A;  1BQN A;  3Q7B A;  3N4Q A;  2IS3 A;  4YY3 K;  5AQH A;  2KZM A;  3MK6 A;  3KLE A;  4IOX A;  4CEO A;  2VGN A;  4RW7 A;  3SZ2 A;  4KHP K;  3U6F A;  3T1H K;  1N8R O;  1DGK N;  1VQ6 N;  3E01 A;  4WFB L;  1L3V A;  2GEM A;  3L8B A;  1GLL O;  2YHY A;  3CJB A;  3DRR A;  3OYD A;  4CF1 A;  3VQQ A;  3MXJ A;  5M1P A;  1VHX A;  2HF4 A;  1WSF A;  3SQ4 A;  3P5J A;  3KK1 A;  4BC5 A;  3NDK A;  3QEW A;  2UYT A;  4E89 A;  3QIP A;  4NYN A;  4BWJ A;  3C6U A;  3CXC M;  3O4N A;  1S9E A;  4DFK A;  4WFN L;  3VES A;  3ZT3 A;  3CQY A;  1HX1 A;  3I8D A;  3SQ1 A;  3J7A P;  4DR7 K;  4Q0B A;  4MO4 A;  4DSE A;  4OLA A;  1G99 A;  1SS6 A;  2BTF A;  3TAE A;  2HNZ A;  4TSX A;  4NXM K;  2GWJ A;  4JYA K;  3ENH A;  2JLE A;  5FPD A;  3DOK A;  2FSJ A;  5AQX A;  3KWG A;  3WXL A;  3ZT4 A;  4CBU A;  1XMO K;  3VQ6 A;  3VF2 A;  3LPU A;  3P1G A;  3BUZ B;  4CJF A;  1OVQ A;  3VQC A;  4CER A;  2P9K B;  3TAN A;  4IFV A;  5F2R A;  1ASW A;  4IKF A;  2E6M A;  2B5J A;  3L4Q A;  4BDY A;  3MEC A;  3BF3 A;  1K8K B;  3MX5 A;  4YOT A;  1K6Y A;  3QLH A;  2UUA K;  1J9A A;  4GVE A;  1WAF A;  2W42 A;  2UXB K;  2B4J A;  4FWP A;  2HHT A;  3QB0 A;  3OYA A;  1BO5 O;  3H6E A;  5C2D A;  1B9D A;  1D9F A;  4BR0 A;  4ISE A;  1NJY A;  1REV A;  5AR0 A;  3WEE B;  5HRN A;  3UKR A;  4IOA L;  3MCA B;  3KIO A;  4HUF A;  4O0I A;  3IAY A;  1WB9 A;  3AVI A;  1YAG A;  1KRP A;  3KZB A;  5AZJ A;  1LW2 A;  4GMJ B;  3L6Q A;  4H0O A;  5HRO A;  4IJA A;  4Y1C A;  4A57 A;  5M1K A;  4IFE A;  3QO9 A;  3VQP A;  2I5J A;  2VG5 A;  4ZTF A;  4DQI A;  2O8B A;  1XMQ K;  3ULD A;  3AVG A;  4JK7 A;  5AQM A;  1CXU A;  1IO2 A;  1R0A A;  4OLB A;  3CC2 N;  3AVN A;  4FCY A;  2LSN A;  5KI6 A;  4A61 A;  4RW4 A;  4FK0 A;  5FLX O;  4JKG A;  5GAG P;  1YXQ A;  2BUP A;  5J2N A;  1FW6 A;  3H3O B;  3VEN A;  2HHV A;  4ZHR A;  1U04 A;  1OKJ A;  1RTD A;  4BAC A;  3W0L A;  4CBX A;  4Q5V A;  1BHL A;  1IG8 A;  3TAP A;  1RT3 A;  3V1O A;  3VQ5 A;  3D45 A;  4FWO A;  4IDH A;  2RHK A;  4OPA A;  4HWI A;  2YHA A;  1XUP O;  2D5R A;  3J7Y P;  4DF8 A;  3C94 A;  4FVM A;  3CMA N;  5CHI A;  5KQD A;  4CEC A;  3TAQ A;  4RW9 A;  4FJH A;  5AJ3 K;  5HRS A;  3RTV A;  4E7K A;  3A2F A;  4OPJ A;  4BY9 C;  3M8S A;  3ZT1 A;  4DCH A;  2YJF A;  4AM6 A;  2VGM A;  4M41 A;  1B9F A;  5CYM A;  1S6Q A;  3AO5 A;  3J7Z O;  4FZX C;  3R3L A;  3VER A;  4F8R A;  1RDB A;  3KHY A;  2NRV A;  3HVT A;  4QS9 A;  2QXF A;  1O13 A;  4M7X A;  3HXM A;  3C7N B;  4JAX A;  3U4L A;  3HPO A;  3AO3 A;  1OH5 A;  3OYJ A;  2FF3 B;  4FK2 A;  2RN2 A;  1T7P A;  3G25 A;  5GIP A;  3THX A;  3DXK A;  1HLU A;  1RBV A;  5AQU A;  4BVP A;  3KTQ A;  2P9S A;  2UUB K;  3K0S A;  2FC0 A;  1LWE A;  4IEE A;  4BRQ A;  3CJ7 A;  2QWL A;  3EE9 A;  3I0R A;  1T3V A;  1NK6 A;  5JLF A;  3FFK B;  4YNQ A;  3I55 N;  4DSK A;  3WXM B;  2QKB A;  4FOE A;  1ITG A;  4KHY A;  2YX6 A;  1NNE A;  1LCU A;  4HHT A;  3QEI A;  3HBT A;  3MAQ A;  4PL7 A;  4PA1 A;  5I3U A;  4QS8 A;  4J8F A;  3D2E B;  5HRR A;  3EO3 A;  4CK2 A;  1QSL A;  3WXI A;  3V6D A;  4JI3 K;  4DSI A;  2Z1G A;  2A42 A;  4B9U A;  2DPN A;  4JI8 K;  2WFB A;  4MDB A;  4CEQ A;  2HMI A;  4CIF A;  1U47 A;  4ELU A;  2HB5 A;  4H0Y B;  1VQ7 N;  4G9Z A;  4H0T B;  3U3Y A;  3LAK A;  1JCE A;  2WON A;  3PSI A;  3ZSX A;  4FWN A;  5KPR A;  1S1U A;  4BRL A;  1Z26 A;  5BPN A;  4YOW A;  2OA8 A;  3M3Z A;  5FDL A;  5J2P A;  4CZI A;  3O3G A;  2X6S A;  4C8O A;  3FZM A;  1HR0 K;  1NGH A;  3TAG A;  3ENO A;  3A0I X;  4CIE A;  1NGD A;  1EXQ A;  2P9P B;  1NGC A;  2O8E B;  3EYZ A;  3HST B;  2NRW A;  4BWM A;  5LY3 A;  4CZF A;  3TAB A;  4FM2 A;  3WNG A;  4YOY A;  2JWL A;  4CGG A;  4BDZ A;  1RDC A;  3SPY A;  4C1N I;  3ZT2 A;  3LDS A;  3QML A;  1I3A A;  4LSL A;  1Q82 O;  3LDL A;  4H5T A;  2KZZ A;  3CIP A;  4DV0 K;  3ZSQ A;  1JJ2 M;  4GNI A;  1IBL K;  3D2F B;  1XNQ K;  2O4I A;  4FVU A;  4CJU A;  1S22 A;  2CGK A;  1ZBU A;  5C10 A;  2XY5 A;  3QES A;  3O4W A;  4H0V B;  3MN5 A;  4FWQ A;  2AP1 A;  4DR2 K;  4BRA A;  4CJK A;  4ZTJ A;  4LY7 A;  1TK0 A;  3L2U A;  3PIO L;  3RMC A;  4JI1 K;  3NVM A;  1JLC A;  3HPH A;  2HOE A;  4BRC A;  2IAJ A;  1C1A A;  1L3U A;  3THW B;  4M3R A;  4OPK A;  1HNZ K;  1CXQ A;  4FZZ A;  3I33 A;  4F2R A;  4OX9 K;  4LF6 K;  1VK0 A;  1UA1 A;  2QI2 A;  2ETJ A;  2W40 A;  1TAU A;  3ZET A;  4JRQ A;  4A2A A;  5AQL A;  1M90 O;  3CJ1 A;  2AA4 A;  2A1S A;  3CCM N;  4B3O A;  1H1V A;  3RMB A;  2DY4 A;  2XY7 A;  4ELT A;  3J8A A;  2HHQ A;  1EKE A;  1YTA A;  4I6M B;  1XHZ A;  3QFP A;  3ULE A;  2E8A A;  3OW2 M;  1U48 A;  1VSI A;  4KRE A;  2G8H A;  4CK3 A;  4BGA A;  4O8K A;  3LZJ A;  2YKM A;  1C0T A;  2DFH A;  2P9K A;  4WCE L;  4BE0 A;  1KVC A;  3ZX0 A;  1C0G A;  3HP9 A;  1G15 A;  2DFF A;  3D7E O;  4OKK A;  3SAG A;  4UQG A;  2ATQ A;  2ZF5 O;  3CPW M;  3CCR N;  4CIG A;  1W0H A;  4FWS A;  4BRO A;  1LOT B;  3B8A X;  4H5V A;  3TTF A;  3NMU A;  1NGG A;  3DXM A;  4C8M A;  4WYB A;  2PFU A;  3AVC A;  3VTI A;  3SUP A;  4H5W A;  1T03 A;  1QZ5 A;  2UU9 K;  3H45 C;  4FYD A;  4BQZ A;  4FW2 A;  1SL2 A;  4GKK K;  3WUH A;  4W5N A;  4B3T K;  1ZXO A;  3QEV A;  4DTU A;  4KTQ A;  3K5L A;  3RVC A;  5HL7 L;  1NGJ A;  2A40 A;  1VQ4 N;  1GLB G;  1ZBS A;  4G1Q A;  4ID5 A;  4M63 C;  3A5L C;  2P9N B;  5GAE P;  1CZA N;  1BI4 B;  4FJK A;  5BRH A;  4DR4 K;  4B9M A;  4DV6 K;  2D4W A;  3O80 A;  3CCU N;  3K58 A;  3NE6 A;  5AQO A;  4AF1 A;  4E3S A;  2BDP A;  3S3N A;  1WSH A;  3OS1 A;  4KTZ A;  1D5A A;  2BH1 A;  3DYA A;  2VWB A;  3UKU B;  2E6L A;  1S1T A;  4FSV A;  3MEG A; 
#chains in the Genus database with same CATH homology
 1HPZ A;  3DRR A;  5CZ2 A;  3OYD A;  4CF1 A;  3VQQ A;  4DTM A;  4KI6 A;  3VQD A;  3ISN C;  2G8W A;  3O3H A;  3MXJ A;  1MU2 A;  3AVH A;  4F3T A;  2Z1H A;  4HUE A;  2BGG A;  4FZY A;  3CFP A;  1UOC A;  3K5N A;  1IH7 A;  1WSF A;  2YNH A;  3SQ4 A;  3P5J A;  3NFA A;  4O0J A;  3VQE A;  3O4Q A;  3KK1 A;  4E7J A;  1W9H A;  3ALY A;  4KPY A;  4Z4H A;  4OKJ A;  3NDK A;  1BQM A;  4W5Q A;  1Y97 A;  3LP2 A;  3P83 D;  3QEW A;  2IGI A;  4E89 A;  3QIP A;  4NYN A;  3EZ5 A;  4BWJ A;  3C6U A;  4IG3 A;  3O4N A;  1S9E A;  3OYC A;  4DFK A;  4B9L A;  4Z4F A;  5C42 A;  1BL3 A;  2GV9 A;  3V9U A;  3ZT3 A;  1DTQ A;  3T19 A;  2FBV A;  4W5R A;  3I8D A;  3SQ1 A;  2G8U A;  5JS2 A;  1X9M A;  4NCA A;  4MQ3 A;  2Y1I A;  4EZ6 A;  4Q0B A;  4DSE A;  4OLA A;  2BAN A;  3T3F A;  2O4G A;  3V9Z A;  1S1W A;  2EX3 A;  3TAE A;  2HNZ A;  2RKI A;  4TSX A;  4FJI A;  4KHW A;  3V1Q A;  3UIQ A;  3PX4 A;  3IRX A;  2JLE A;  1EET A;  3DOK A;  4E7I A;  3B6P A;  4B8C A;  3ZT4 A;  1BIS A;  4I2P A;  4KKO A;  1FXX A;  3VQ6 A;  4CJR A;  3L3V A;  1CZB A;  3LPU A;  2YKN A;  3OJS A;  3P1G A;  3U3G A;  3ZCM A;  3V4I A;  4CJF A;  4O5B A;  3S3O A;  1JL2 A;  3VQC A;  4CER A;  1TL1 A;  4HCC A;  3OYK A;  3TAN A;  4KO0 A;  3K2P A;  4IFV A;  1UAX A;  1ASW A;  3LWM A;  4IKF A;  4AHC A;  2E6M A;  2B5J A;  4CE9 A;  4BDY A;  1BGX T;  3MEC A;  3PO5 A;  3HO1 A;  1LWF A;  2B6A A;  1SUQ A;  1K6Y A;  3QLH A;  2Q3S A;  3BDP A;  4M3Z A;  4DF4 A;  3SUQ A;  1J9A A;  1RBS A;  4ICL A;  2A1R A;  4B9T A;  4PQU A;  1QE1 A;  1GOC A;  2OZS A;  3AA4 A;  1WAF A;  4CEF A;  1L3S A;  2W42 A;  3DLK A;  3HYF A;  2B4J A;  4IG0 A;  4DS5 A;  5FRM A;  1QSS A;  2HHT A;  2Z1J A;  4EP5 A;  3OYA A;  1ZBH A;  2FBT A;  1JLF A;  4CJ4 A;  3OJU A;  5EU7 A;  1B9D A;  4IFY A;  1D9F A;  5J2Q A;  5DMR A;  1NJY A;  4B9S A;  4AHT A;  1REV A;  1XWL A;  3OYM A;  3AVL A;  4DSL A;  3BGR A;  5HRN A;  1NKB A;  2FBY A;  3KD5 E;  3SI6 A;  3OYN A;  3NF9 A;  1SL0 A;  3AA5 X;  1LV5 A;  1KLM A;  3TAM A;  3AVF A;  3ITH A;  3KIO A;  4HUF A;  1RT5 A;  2RF2 A;  4O0I A;  3AVI A;  4XIU A;  2XY6 A;  1KLN A;  5J1E A;  1KRP A;  1B92 A;  4C8N A;  3AVA A;  1HYS A;  4CF9 A;  3CFO A;  1TKZ A;  3LAM A;  1UA0 A;  3L2Q A;  4OGE A;  4QOZ B;  1ASU A;  2PYL A;  2YNG A;  5CZ1 A;  3T1A A;  1LW2 A;  5E41 A;  1NOZ A;  4GMJ B;  3QEP A;  3KJV A;  3AO2 A;  3V81 A;  5HRO A;  1QQC A;  4Y1C A;  1NK5 A;  4I2Q A;  1NK4 A;  3QO9 A;  3VQP A;  1C1C A;  2I5J A;  4C8L A;  1BCM A;  2X6N A;  4FLX A;  1NK9 A;  4KHN A;  2VG5 A;  2Y1J A;  3PV8 A;  4DQS A;  4ZTF A;  3D0P A;  4DQI A;  4LH5 A;  3LWL A;  1RIL A;  3QER A;  3ULD A;  2P1J A;  4NYF A;  4CED A;  4DQP A;  4AHV A;  4CFA A;  3AVG A;  1HQU A;  1HMV A;  2GUI A;  4FLT A;  4E1M A;  1NK8 A;  3DRP A;  3F73 A;  3LP1 A;  4FM0 A;  1CXU A;  2XHB A;  4QCL A;  1IO2 A;  1R0A A;  3SJJ A;  4OLB A;  1ZBI A;  3AVN A;  4FCY A;  4Z4E A;  2HVH A;  1FKO A;  2OPQ A;  2LSN A;  2X74 A;  5KI6 A;  2YV0 X;  1JKH A;  3DMJ A;  4CHO A;  4RW4 A;  4FK0 A;  4FJX A;  4CHN A;  4J2D A;  4CJP A;  3SUN A;  1S5J A;  4FLW A;  4H8K A;  5J2N A;  1L5U A;  3ZSY A;  2HHV A;  3NF8 A;  4ZHR A;  1U04 A;  1IG9 A;  1Z25 A;  1RTD A;  4BAC A;  4Q5V A;  1RT4 A;  5KRT A;  1BHL A;  3KLI A;  3NH2 A;  1O1W A;  3MED A;  3SQ2 A;  3TAP A;  1Q9Y A;  5J2M A;  1RT3 A;  2HW3 A;  4DTP A;  3V1O A;  3VQ5 A;  3D45 A;  2G8K A;  4KB1 A;  4DG1 A;  3DOL A;  3THV A;  5FRO A;  2BE2 A;  3KK3 A;  5K14 A;  3LP3 A;  2HHW A;  4DU1 A;  4AIL C;  2YHA A;  2KQ2 A;  2D5R A;  4FJJ A;  4J2A A;  4H4M A;  4DF8 A;  3C94 A;  3WNF A;  5KGW A;  4FVM A;  4OJR A;  1U4B A;  3FFI A;  4WE1 A;  3LAN A;  3RRH A;  1WSG A;  4K8X A;  2VG7 A;  3IS9 A;  4CEC A;  4O4G A;  1LAW A;  3TAQ A;  1Q8I A;  2WOM A;  4C8K A;  4RW9 A;  4FJ5 A;  4DTR A;  3OY9 A;  5HRS A;  2OZM A;  1S6P A;  4FJH A;  3RTV A;  4E7K A;  1BIZ A;  1HRH A;  1ZYQ A;  1XC9 A;  3A2F A;  2HNY A;  3SV4 A;  3DRS A;  4OPJ A;  3M8S A;  3JYT A;  3QNN A;  3ZT1 A;  3M8P A;  5CYQ A;  4CGI A;  4PWD A;  2HHS A;  4Z4C A;  3ZSZ A;  2DTU A;  3HPG A;  4M41 A;  1ZBF A;  3G0Z A;  3OYE A;  1B9F A;  3QET A;  5CYM A;  3ZT0 A;  3PX6 A;  1S6Q A;  3AO5 A;  4CEE A;  3QIO A;  4DQR A;  4FZX C;  4FJ8 A;  1NJW A;  4Z0U A;  4CGF A;  3LP0 A;  5C24 A;  4F8R A;  1RDB A;  3HVT A;  3VA3 A;  1KVA A;  3IAY A;  2QXF A;  3SNN A;  4N41 A;  3LPT A;  4AHU A;  1A5W A;  1RBT A;  3C6T A;  3HXM A;  4DU3 A;  4ELV A;  1J54 A;  3SV3 A;  1RCH A;  3SPZ A;  3SUO A;  2D0A A;  5KGX A;  1XHX A;  3AO3 A;  3CYM A;  3NBP A;  3HPO A;  4F4K A;  2OPS A;  4CHZ A;  4KAZ A;  2AJQ A;  3OYJ A;  4FK2 A;  4KB0 A;  1ZBL A;  2RN2 A;  1J53 A;  3S3M A;  1SV5 A;  3PX0 A;  1T7P A;  3DLR A;  1HNV A;  4NCG A;  1X9W A;  1NK7 A;  4CCH A;  1EX4 A;  3KK2 A;  4CFB A;  4PUO A;  5I42 A;  4B8A B;  4E1N A;  4N56 A;  2FBX A;  3VQ8 A;  3RR7 A;  4AHS A;  5DK5 A;  4CF2 A;  1RBV A;  1A5V A;  2VWK A;  3MEE A;  3RR8 A;  3KTQ A;  3SCX A;  4DFP A;  1TAQ A;  2OPP A;  1NKE A;  4DFJ A;  2FC0 A;  3NF7 A;  3DM2 A;  1LWE A;  4N5S A;  1A5X A;  1I39 A;  1VSE A;  3CM5 A;  1QTM A;  1T8E A;  4EZ9 A;  2GBZ A;  3RWU A;  4HUG A;  4M3X A;  1GOA A;  2YNF A;  2KFN A;  3I0R A;  2YHB A;  1NK6 A;  4DS4 A;  5FRN A;  3CG7 A;  4YNQ A;  4CJE A;  3TAR A;  4E7L A;  4DSK A;  4DWI A;  2Z1I A;  2QKB A;  4KFB A;  4ID1 A;  1TK5 A;  2QKK A;  3K5O A;  1ITG A;  4KHY A;  2XY8 A;  3HJF A;  4FLU A;  4CJW A;  1JLA A;  1FK9 A;  1RT1 A;  5KTQ A;  4CFD A;  3KKS A;  3LZI A;  4HHT A;  1WLJ A;  3QEI A;  1SKW A;  4F3O A;  5D3G A;  4GVM A;  3MAQ A;  3VQ4 A;  1CLQ A;  4CHY A;  1RDA A;  4PA1 A;  2P51 A;  5I3U A;  2P5G A;  3M8R A;  4RW6 A;  1C0U A;  4DTX A;  1N5Y A;  3L2V A;  4M3Y A;  5HRP A;  5HRR A;  4J2E A;  1IKY A;  1JLG A;  4CK2 A;  1QSL A;  1NOY A;  3V6D A;  3NH1 A;  4DSI A;  2Z1G A;  2PZS A;  4H4O A;  2P5O A;  1S1V A;  4B9U A;  4KHQ A;  3L2R A;  4JS5 A;  4CEQ A;  1NKC A;  4KV8 A;  2HMI A;  4IDK A;  4CJQ A;  2EHG A;  4CIF A;  3IG1 A;  2ZE2 A;  1U47 A;  4ELU A;  1YVU A;  2HB5 A;  3U3Y A;  3KLG A;  2F96 A;  3V9W A;  4M42 A;  1SL1 A;  3TWH A;  4CEA A;  2HHU A;  4B9V A;  3LAK A;  2G8V A;  2WON A;  4CGH A;  1KFD A;  4OKE A;  1TKD A;  3ZSX A;  1JXB A;  1Q9X A;  4AH9 A;  3NF6 A;  4W5T A;  1WSE A;  3MXM A;  4E0D A;  4FJ9 A;  3AA2 A;  1S1U A;  4E19 A;  1EP4 A;  2XO7 A;  2HHX A;  1Z26 A;  3HP6 A;  4KHU A;  3ZSR A;  3L8B A;  1HJR A;  3KLF A;  1KVB A;  4I7F A;  4Y1D A;  2OA8 A;  3RMA A;  4FW1 A;  4RW8 A;  3SYZ A;  5HP1 A;  1RBU A;  5FDL A;  3EY1 A;  5J2P A;  2PY5 A;  3QNO A;  3O3G A;  3ZSV A;  2E4L A;  1JLQ A;  3AVJ A;  1RT6 A;  3L3U A;  2X6S A;  3QIN A;  1HYV A;  1RBR A;  1J5O A;  2G8F A;  4C8O A;  4FJM A;  2R7Y A;  2QK9 A;  4PY5 A;  3F9K A;  3K59 A;  5JS1 A;  4FJL A;  3TAG A;  4M3U A;  3VQA A;  4CIE A;  4FJG A;  1UWB A;  4FXD A;  1VSD A;  3MXI A;  1EXQ A;  4DMN A;  3S9H A;  3VQ7 A;  4DSJ A;  2KTQ A;  3AVB A;  4FLY A;  3EYZ A;  1ASV A;  1DLO A;  4CHP A;  4JS4 A;  3HST B;  1WAJ A;  4CF0 A;  2IDO A;  4BWM A;  3NCI A;  4KI4 A;  4FK4 A;  3KD1 E;  3CFR A;  3TAB A;  1VSH A;  4LH4 A;  4HTU A;  4FM2 A;  1BCO A;  3WNG A;  1D8Y A;  4CGG A;  4BDZ A;  2D0B A;  1RDC A;  3CQ8 A;  4DTO A;  3SPY A;  4B9N A;  3ZT2 A;  4JRP A;  4DTJ A;  3V9S A;  1RT2 A;  3LDS A;  4Z4I A;  4JLH A;  2G8I A;  1I3A A;  1S1X A;  1WSI A;  3NGY A;  5HBM A;  4CGD A;  4DU4 A;  4DLE A;  4LSL A;  3PO4 A;  2KFZ A;  3OVN A;  2KZZ A;  1GOB A;  1TGO A;  1D9D A;  3NHG A;  2OYQ A;  4FLZ A;  3ZSQ A;  3H08 A;  1WN7 A;  3OYG A;  1NJZ A;  4M3W A;  2O4I A;  4DFM A;  1C0M A;  2ZD1 A;  1LWC A;  1NJX A;  4O44 A;  4CJU A;  1FKP A;  3HT3 A;  1KFS A;  1ZBU A;  2XY5 A;  3OYF A;  3QES A;  1KCF A;  3KLH A;  3TR8 A;  3WNE A;  4FM1 A;  4E7H A;  4RG8 A;  4EP4 A;  5SWM A;  4DTN A;  3M8Q A;  2D0C A;  2IC3 A;  1RDD A;  1IKX A;  4CJK A;  5HLF A;  4ZTJ A;  4LY7 A;  1TK0 A;  3NAE A;  3ZSO A;  4CJ3 A;  4K8Z A;  3L2U A;  3AO1 A;  4LD0 A;  3RMC A;  4GW6 A;  1TKX A;  1JLC A;  2RPI A;  5KRS A;  3HPH A;  1S9G A;  4FJN A;  2IAJ A;  4I9L A;  3ZSW A;  1C1A A;  4KTW A;  1TV6 A;  1TL3 A;  3AA3 A;  1L3U A;  3VQ9 A;  4HVJ A;  4M3R A;  4OPK A;  1VSF A;  3L2W A;  3I0S A;  1CXQ A;  1SKS A;  4FZZ A;  4F2R A;  1VK0 A;  1UA1 A;  4DLG A;  2ETJ A;  1TAU A;  4YFU A;  3DLH A;  4JRQ A;  4OGC A;  4I9Q A;  2ITG A;  3AV9 A;  1U49 A;  2A1S A;  3AVK A;  4B3O A;  4R5P A;  1RTJ A;  3K57 A;  4QAG A;  1WNS A;  1F21 A;  3RMB A;  2DY4 A;  2XY7 A;  1C6V A;  1TVR A;  3OS2 A;  4ELT A;  1QHT A;  1KSP A;  3V1R A;  2HHQ A;  4CEZ A;  1EKE A;  1YTA A;  2JGU A;  3NH0 A;  3DLE A;  2VG6 A;  3VA0 A;  3OS0 A;  2DFE A;  4CJT A;  1XHZ A;  2PYJ A;  2HND A;  1TKT A;  1VRU A;  3AO4 A;  4CFC A;  3K5M A;  2F8T A;  1HNI A;  1U48 A;  1VSI A;  4CK1 A;  4J2B A;  5SZT A;  4M45 A;  4KRE A;  2HVI A;  2G8H A;  4CK3 A;  3DLG A;  5C25 A;  5T7B A;  1U45 A;  4Z4G A;  1VRT A;  2YKM A;  1C0T A;  2DFH A;  3LZJ A;  4BE0 A;  1KVC A;  2OPR A;  4IBN A;  3TI0 A;  3HM9 A;  3HP9 A;  4OKK A;  1G15 A;  2DFF A;  4HCB A;  3WNH A;  4UQG A;  2XRI A;  3OYL A;  1X1P A;  2ATQ A;  4B08 A;  1RTH A;  4CF8 A;  3VN5 A;  3HVR A;  3QEX A;  3OYH A;  1T05 A;  4BDP A;  4CIG A;  4BE1 A;  1YT3 A;  4OVL A;  4CEB A;  2YNI A;  1W0H A;  1KTQ A;  1C1B A;  1X9S A;  4CJL A;  1JLB A;  3B6O A;  4L8R B;  4CJV A;  4C8M A;  3VQB A;  1RTI A;  3AVC A;  2ZQB A;  3SUP A;  4BE2 A;  4W5O A;  1T03 A;  3V9X A;  4AHR A;  1TK8 A;  4FLV A;  3RMD A;  1YTU A;  1JXE A;  1BIU A;  4FYD A;  4FW2 A;  1HQE A;  4DQQ A;  4CJ5 A;  3NGI A;  1QS4 A;  1SL2 A;  4W5N A;  4CGJ A;  1XI1 A;  3HL8 A;  3NGZ A;  1L3T A;  4N47 A;  3QEV A;  1JL1 A;  4DTU A;  3KKR A;  3OYB A;  4KTQ A;  3K5L A;  4LSN A;  3TAF A;  3CM6 A;  1VSL A;  1VSK A;  4G1Q A;  4ID5 A;  3OYI A;  4DTS A;  1IKV A;  2X78 A;  2NUB A;  1IKW A;  2VWJ A;  3JSM A;  4M3T A;  1HYZ A;  4CES A;  2F8S A;  1DTT A;  1LW0 A;  4KHS A;  3RRG A;  1SKR A;  4CJS A;  4MFB A;  1BI4 B;  1VSM A;  3HK2 A;  4FJK A;  2KW4 A;  3DI6 A;  4DSF A;  5CY4 A;  4O55 A;  3PUF A;  1QSY A;  4NCB A;  4B9M A;  4KRF A;  3G10 A;  3LAL A;  1BQN A;  3AVM A;  1JLE A;  3C95 A;  2IS3 A;  3DLB A;  1CZ9 A;  3SQ0 A;  3K58 A;  3NE6 A;  1RNH A;  2KZM A;  1NK0 A;  1BI4 A;  4E3S A;  3KLE A;  4CEO A;  3ASM A;  2BDP A;  4FJ7 A;  4RW7 A;  3SZ2 A;  1VSJ A;  3S3N A;  1WSH A;  3OS1 A;  3U6F A;  2IOC A;  4N76 A;  4KTZ A;  1D5A A;  3O3F A;  1N6Q A;  3DYA A;  3PY8 A;  4F2S A;  4CHQ A;  1RT7 A;  2E6L A;  3E01 A;  1S1T A;  1LAV A;  1L3V A;  1WSJ A;  3MEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...